Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B039008.837ON37937916910.0
CAGL0M02937g8.837ON37338612211e-167
TDEL0B006008.837ON36938711391e-155
NCAS0C004308.837ON36938311351e-154
Kpol_1068.118.837ON38139511151e-151
SAKL0D01540g8.837ON36538110841e-147
Smik_13.4898.837ON37238510841e-147
Skud_13.4488.837ON36439010691e-145
TPHA0I002208.837ON37738910661e-144
YMR276W (DSK2)8.837ON37338110561e-142
NDAI0K004408.837ON40440910541e-142
ZYRO0G14124g8.837ON36939710371e-140
Kwal_27.102758.837ON37939010361e-139
Suva_13.4648.837ON36638310131e-136
KLTH0C03938g8.837ON3763999891e-132
Ecym_46088.837ON4064189801e-130
KLLA0D01859g8.837ON3713869751e-130
TBLA0D032308.837ON3753859661e-129
ABL129W8.837ON3453799611e-128
KNAG0J002908.837ON3673988451e-111
TBLA0B032408.837ON2842211733e-13
Kpol_1036.628.311ON77511154e-07
ZYRO0D05962g8.311ON77561084e-06
CAGL0B01589g8.311ON77631084e-06
TPHA0C008908.311ON77581068e-06
TDEL0G017504.16ON77511058e-06
Skud_9.205.701ON125511081e-05
Smik_11.3575.701ON125511081e-05
NDAI0H002704.16ON77511041e-05
Smik_9.215.701ON124511071e-05
Suva_10.32singletonON62511022e-05
SAKL0H15818g8.311ON77501032e-05
KLTH0G12540g8.311ON77711032e-05
NCAS0B035208.311ON77561005e-05
YDR139C (RUB1)8.311ON7758971e-04
TDEL0F043808.311ON7748952e-04
Kwal_YGOB_Anc_5.7015.701ON12851982e-04
KAFR0D022305.701ON12851982e-04
KAFR0H002205.701ON12851982e-04
Suva_11.3305.701ON12851982e-04
Skud_11.3335.701ON12851982e-04
YIL148W (RPL40A)5.701ON12851982e-04
YKR094C (RPL40B)5.701ON12851982e-04
ZYRO0G06622g5.701ON12851982e-04
KLTH0E01078g5.701ON12851983e-04
SAKL0E14894g5.701ON12851983e-04
NDAI0E050305.701ON12851983e-04
NCAS0A032105.701ON12851983e-04
NCAS0G002405.701ON12851983e-04
Ecym_40195.701ON12851983e-04
KLLA0A00616g5.701ON12851973e-04
TPHA0E002405.701ON12851973e-04
TPHA0D046005.701ON12851973e-04
TBLA0E021105.701ON12851973e-04
CAGL0G02475g5.701ON12851973e-04
Kpol_1043.695.701ON12851973e-04
AFR285C5.701ON12851973e-04
KNAG0L021205.701ON12851973e-04
TDEL0B022005.701ON12851973e-04
Suva_9.405.701ON14451974e-04
KLLA0F17974g8.311ON7756934e-04
Ecym_41818.386ON15251975e-04
TPHA0C023908.386ON15051966e-04
KNAG0J028804.16ON15351966e-04
ZYRO0C04026g8.386ON15251966e-04
Ecym_84084.16ON15351966e-04
NDAI0J010708.311ON7751926e-04
TPHA0K022504.16ON15351966e-04
NCAS0C029408.386ON15251967e-04
KLTH0F08734g8.386ON15051967e-04
Kwal_23.33118.386ON15051967e-04
Suva_10.34singletonON15151967e-04
SAKL0H13926g8.386ON15451967e-04
KNAG0C065805.701ON14951957e-04
KLLA0D18304g8.386ON15051958e-04
KAFR0H020008.386ON15251968e-04
AGL128W8.386ON15251958e-04
YLR167W (RPS31)8.386ON15251958e-04
NDAI0G022808.386ON15251958e-04
Kwal_27.101521.480ON38153999e-04
KNAG0A027308.386ON15051950.001
CAGL0G08173g8.386ON15251940.001
TDEL0F051008.386ON15051940.001
Kpol_1030.58.386ON15251940.001
Kpol_1024.168.386ON15251940.001
SAKL0H25784g4.16ON30558970.001
TBLA0G006704.16ON22951960.001
NDAI0D049304.16ON22951960.001
KAFR0I014704.16ON22951960.001
KLTH0E05852g4.16ON40951980.001
KAFR0C030008.142ON39740980.001
Kwal_55.206074.16ON23151960.001
NDAI0F003005.701ON18751950.002
Suva_10.33singletonON25451960.002
Suva_10.2668.386ON15251930.002
Skud_12.2348.386ON15251930.002
Smik_12.2298.386ON15251930.002
Skud_12.294.16ON38158970.002
YLL039C (UBI4)4.16ON38158970.002
TBLA0H031808.386ON15251930.002
Kpol_1070.64.16ON53358970.002
ACL062C4.16ON38251960.002
Suva_10.304.16ON38151960.003
KLLA0E00749g4.16ON38151960.003
AFR358W1.480ON41369960.003
NCAS0C058504.16ON38851950.003
Smik_12.184.16ON46051960.003
ZYRO0G07854g4.16ON46051960.003
CAGL0D05082g4.16ON53351960.003
CAGL0L01309g1.480ON39264940.004
NDAI0G003301.480ON42753920.007
KLTH0C03410g1.480ON39146910.008
NDAI0B01850singletonON40344900.014
NCAS0B045908.142ON44742890.016
TBLA0D022108.142ON56338900.017
CAGL0L06028g8.142ON50538880.024
Ecym_35721.480ON44369870.027
KAFR0E005301.480ON37963850.056
SAKL0H24772g8.142ON41443840.078
KLLA0E22133g1.480ON38346830.10
TDEL0B046908.142ON44238830.11
Smik_7.918.142ON39938820.13
YGL181W (GTS1)8.142ON39638820.13
KAFR0I027801.480ON21460800.14
SAKL0D11814g1.480ON40067800.23
TDEL0C025901.480ON36867790.30
Suva_7.818.142ON40138770.43
Kwal_55.19849singletonOFF10029710.58
Smik_5.561.480ON39766760.69
Suva_5.321.480ON40953760.72
Skud_5.531.480ON39763750.76
KNAG0G005101.480ON37569741.0
TPHA0O004401.480ON36958741.1
SAKL0G19426g2.652ON24074721.4
YEL037C (RAD23)1.480ON39853731.7
Kpol_1033.288.303ON153153722.7
Skud_7.908.142ON39638694.5
NCAS0G041201.480ON39226685.8
TPHA0H004008.142ON46638686.1
Kpol_541.508.142ON51138687.0
Kpol_370.61.480ON40458678.7
NCAS0C040908.142ON39647678.9
KLLA0A08316gna 1ON70051679.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B03900
         (379 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   655   0.0  
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   474   e-167
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   443   e-155
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   441   e-154
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   434   e-151
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   422   e-147
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   422   e-147
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   416   e-145
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   415   e-144
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   411   e-142
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   410   e-142
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   404   e-140
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   403   e-139
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   394   e-136
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   385   e-132
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   382   e-130
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   380   e-130
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   376   e-129
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   374   e-128
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   330   e-111
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    71   3e-13
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    49   4e-07
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    46   4e-06
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    46   4e-06
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    45   8e-06
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    45   8e-06
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     46   1e-05
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    46   1e-05
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    45   1e-05
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     46   1e-05
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    44   2e-05
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    44   2e-05
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    44   2e-05
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    43   5e-05
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    42   1e-04
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    41   2e-04
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    42   2e-04
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    42   2e-04
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    42   2e-04
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    42   2e-04
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    42   2e-04
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    42   2e-04
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    42   2e-04
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    42   2e-04
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    42   3e-04
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    42   3e-04
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    42   3e-04
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    42   3e-04
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    42   3e-04
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    42   3e-04
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    42   3e-04
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    42   3e-04
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    42   3e-04
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    42   3e-04
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    42   3e-04
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    42   3e-04
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    42   3e-04
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    42   3e-04
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    42   3e-04
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     42   4e-04
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    40   4e-04
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    42   5e-04
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    42   6e-04
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    42   6e-04
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    42   6e-04
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    42   6e-04
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    40   6e-04
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    42   6e-04
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    42   7e-04
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    42   7e-04
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    42   7e-04
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    42   7e-04
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    42   7e-04
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    41   7e-04
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    41   8e-04
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    42   8e-04
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    41   8e-04
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    41   8e-04
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    41   8e-04
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    43   9e-04
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    41   0.001
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    41   0.001
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    41   0.001
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    41   0.001
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    41   0.001
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    42   0.001
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    42   0.001
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              42   0.001
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    42   0.001
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    42   0.001
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    42   0.001
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    42   0.001
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        41   0.002
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    42   0.002
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    40   0.002
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    40   0.002
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    40   0.002
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    42   0.002
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    42   0.002
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    40   0.002
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    42   0.002
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    42   0.002
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    42   0.003
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    42   0.003
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    42   0.003
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             41   0.003
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    42   0.003
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    42   0.003
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    42   0.003
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    41   0.004
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    40   0.007
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    40   0.008
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    39   0.014
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    39   0.016
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    39   0.017
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    39   0.024
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    38   0.027
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    37   0.056
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    37   0.078
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    37   0.10 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    37   0.11 
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    36   0.13 
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    36   0.13 
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    35   0.14 
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    35   0.23 
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    35   0.30 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    34   0.43 
Kwal_55.19849 s55 (152277..152579) [303 bp, 100 aa] {OFF} [conti...    32   0.58 
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    34   0.69 
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    34   0.72 
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    33   0.76 
KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}...    33   1.0  
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    33   1.1  
SAKL0G19426g Chr7 complement(1670664..1671386) [723 bp, 240 aa] ...    32   1.4  
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    33   1.7  
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...    32   2.7  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    31   4.5  
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    31   5.8  
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    31   6.1  
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    31   7.0  
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    30   8.7  
NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142     30   8.9  
KLLA0A08316g Chr1 (733200..735302) [2103 bp, 700 aa] {ON} simila...    30   9.0  

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/379 (87%), Positives = 330/379 (87%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
           KIEEGHSIHLVKSGGNVAR                      VPSNIASGQTGGFNPLNDL
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDL 120

Query: 121 TSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ 180
           TSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ
Sbjct: 121 TSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ 180

Query: 181 SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFPAP 240
           SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFPAP
Sbjct: 181 SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFPAP 240

Query: 241 GEASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPFGAMSSNTNG 300
           GEASASTNEQN                           PFDALFNPAANPFGAMSSNTNG
Sbjct: 241 GEASASTNEQNTNASGESTTAGGATNNTNSTSAPAAANPFDALFNPAANPFGAMSSNTNG 300

Query: 301 SQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVAAL 360
           SQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVAAL
Sbjct: 301 SQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVAAL 360

Query: 361 RRSGGSVQGALDALLNGDV 379
           RRSGGSVQGALDALLNGDV
Sbjct: 361 RRSGGSVQGALDALLNGDV 379

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  474 bits (1221), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 253/386 (65%), Positives = 280/386 (72%), Gaps = 20/386 (5%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MSITIHIKSGQNKWDV+ + S +I  LKEEI+K+SEIP+ NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
            I++ H+IH+VKSGGN +                       VPSNIASGQTGGFNPL DL
Sbjct: 61  NIKDDHAIHMVKSGGNAS-----TSNAPTNANESSNSSTTAVPSNIASGQTGGFNPLADL 115

Query: 121 TSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ 180
           T ARYAGY N+PSADMFGPDGG+N+ P QD+MLRM++NP+FQSQMNEMLSNP+M+DFMIQ
Sbjct: 116 TGARYAGYANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMIQ 175

Query: 181 SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNG-GNDPAATGNDPSAFPA 239
           SNPQLQAMGPQARQMLQSP FRQML NP MIRQSMQFARMMNG G  P A   D SAFPA
Sbjct: 176 SNPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGMPGADATDASAFPA 235

Query: 240 PGEASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPFGAMSSNTN 299
           PG     T   +                              AL +PA+NPF AM  N N
Sbjct: 236 PGGDDTETTTGSTENTSTNNRTNSNANANPNAAANPFA----ALMDPASNPFAAMMGNMN 291

Query: 300 ----GSQPQQPAFDPALLASMLG--MPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDF 353
               G+  QQPAFDP LLAS+LG  +P     PAQ+DNRPPEERYE QLRQLNDMGFFDF
Sbjct: 292 NQQGGAGVQQPAFDPTLLASLLGGQLP----APAQEDNRPPEERYEQQLRQLNDMGFFDF 347

Query: 354 DRNVAALRRSGGSVQGALDALLNGDV 379
           DRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 348 DRNVAALRRSGGSVQGALDALLNGDV 373

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  443 bits (1139), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 238/387 (61%), Positives = 280/387 (72%), Gaps = 26/387 (6%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MSIT+ +K GQ+KW+V+ N   ++A  K+EI+K+SEIPA NQRLIYSGKILKDDQ VESY
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
           KI++GH+IHLVKSGG                          VPSNIASGQTGGFNPL+DL
Sbjct: 61  KIQDGHAIHLVKSGGG-GGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDL 119

Query: 121 TSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ 180
           TSARYAG+ N+PSADMFGPDGGL + P+QDDML ML+NP+FQSQMNEMLSNPQM+DFMIQ
Sbjct: 120 TSARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQ 179

Query: 181 SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMN--GGNDPAATGNDPSAFP 238
           SNPQLQAMGPQARQ+LQSP FRQML NP M+RQSMQF+ MMN  GGND AA     ++FP
Sbjct: 180 SNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAA-----ASFP 234

Query: 239 APGEAS--ASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPFGAMSS 296
           APG+++  AS+ E N                              A+FNP +NP  +M  
Sbjct: 235 APGDSTTEASSTEANTDANANTNANANTNAANPFA----------AMFNPGSNPLASMFG 284

Query: 297 NTN----GSQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFD 352
           N       +Q  QP FDP++LAS+LG   +QQ  A+QDNRPPEERYE QLRQLNDMGFFD
Sbjct: 285 NQGVGAADNQQNQP-FDPSMLASLLGGGAAQQR-AEQDNRPPEERYEQQLRQLNDMGFFD 342

Query: 353 FDRNVAALRRSGGSVQGALDALLNGDV 379
           F++NVAALRRSGGSVQGALD+LLNGDV
Sbjct: 343 FEKNVAALRRSGGSVQGALDSLLNGDV 369

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  441 bits (1135), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 237/383 (61%), Positives = 271/383 (70%), Gaps = 18/383 (4%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MSI+IH+KSGQN W V+ + + +I  LKEEI+K+SE+PATNQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
           KI +G SIH+VKSGG  A                       V  N+A+G+TGGFNPL+DL
Sbjct: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTATP-------VAPNMAAGETGGFNPLSDL 113

Query: 121 TSARYAGYLNMPSADMFGPDGGLN-SGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMI 179
           TSARYAGYLN+PSAD FGPDGGLN SGP+QD+MLRMLDNPVFQSQMNEMLSNPQM+DF+I
Sbjct: 114 TSARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFII 173

Query: 180 QSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATG--NDPSAF 237
           Q+NPQLQAMGPQARQ+LQ+PMFRQML NPDMIRQSMQ AR MNGG DP   G  N  S F
Sbjct: 174 QANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDF 233

Query: 238 PAPGEASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPFGAMSSN 297
           PAPG      ++ N                           PF +LFNPA NPF A  +N
Sbjct: 234 PAPG-----GDDDNTVSENTPSTTNTASTNPSSTATTNAANPFASLFNPAMNPFAAGMAN 288

Query: 298 TNGS-QPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRN 356
           TN +     PAFDP+  ASM           Q+D RPPEERYE QLRQLNDMGFFDFDRN
Sbjct: 289 TNAAGSGNPPAFDPSFFASMFQ--PPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRN 346

Query: 357 VAALRRSGGSVQGALDALLNGDV 379
           VAALRRSGG+V+ AL+ALLNGDV
Sbjct: 347 VAALRRSGGNVESALNALLNGDV 369

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  434 bits (1115), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 240/395 (60%), Positives = 270/395 (68%), Gaps = 30/395 (7%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           M I IHIKSGQNKW+V  ++S+++  LKEEI+K+SEIP  NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
           KI++ HSIHLVKSGG                          +PSNIA+GQ+GGFNPL+DL
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDL 120

Query: 121 TSARYAGY-LNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMI 179
           TSARYAGY LN+PSADMFGPDGG+NS P+QDDMLRML+NPVFQSQMNEMLSNPQMIDFMI
Sbjct: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180

Query: 180 QSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFPA 239
           QSNPQLQAMGP+ARQM QSP FRQML NP+MIRQSMQ A MM GGN         S+FPA
Sbjct: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMM-GGNGQFGANAAASSFPA 239

Query: 240 PGE----ASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPF---- 291
           PGE    A+A TN +                            PF +LFNPA NPF    
Sbjct: 240 PGETDTTAAAETNTE-----------TTSTPAATGAAAAGQQNPFASLFNPAMNPFAAMM 288

Query: 292 -------GAMSSNTNGSQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQ 344
                      +         PAFDP+L ASM      QQ   +QDNRPPEERYE+QLRQ
Sbjct: 289 NNNAAAAAGAGATGAAGATGTPAFDPSLFASMFQ--PPQQQQQEQDNRPPEERYESQLRQ 346

Query: 345 LNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 379
           LNDMGFFDFDRNVAALRRSGGSVQGALDALL+ DV
Sbjct: 347 LNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  422 bits (1084), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 229/381 (60%), Positives = 260/381 (68%), Gaps = 18/381 (4%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MSIT+HIKSGQNKWDV+   ++++  LKE ISK+SEIP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
           KI + H++HLV+SGG                          VPSNI+SGQTGGFNPL DL
Sbjct: 61  KIADDHAVHLVRSGG---PKPAASKSESTSATDTGAAAAAAVPSNISSGQTGGFNPLADL 117

Query: 121 TSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ 180
           T ARYAGY N+PSADMFGPDGGL + P+ D++L MLDNP+ QSQMNEMLSNPQM+DFMIQ
Sbjct: 118 TGARYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQ 177

Query: 181 SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFPAP 240
            NPQLQAMGP+AR++LQS  FRQM+ NPDMIRQSMQFARM               AFPAP
Sbjct: 178 QNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFGM----EGAEGAGGAFPAP 233

Query: 241 GEASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPFGAMSSNTNG 300
           G A+ + + +                            PF +LFN  ANPF +M    NG
Sbjct: 234 GTATQTASTEG----GPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFP--NG 287

Query: 301 SQPQQPAFDPALLASMLG--MPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVA 358
             PQ   FDP+LL+S LG       Q    QDNRPPEERYE QLRQLNDMGFFDFDRNVA
Sbjct: 288 RAPQ---FDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVA 344

Query: 359 ALRRSGGSVQGALDALLNGDV 379
           ALRRSGGSVQGALDALLNGDV
Sbjct: 345 ALRRSGGSVQGALDALLNGDV 365

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  422 bits (1084), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 231/385 (60%), Positives = 263/385 (68%), Gaps = 19/385 (4%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MS+ IHIKSGQ+KW+V+     +++  KE ISK + +P  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
            I++GHS+HLVKS     +                         N++SGQ+ GFNPL DL
Sbjct: 61  HIQDGHSVHLVKS---QPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAGFNPLADL 117

Query: 121 TSARYAGYLNMPSADMFGPDGGL--NSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFM 178
           TSARYAGYLNMPSADMFGPDGG   N   +QD++LRM++NP+FQSQMNEMLSNPQM+DFM
Sbjct: 118 TSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFM 177

Query: 179 IQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFP 238
           IQSNPQLQAMGPQARQMLQSPMFRQML NPDMIRQSMQFARMM+      +TG   SAFP
Sbjct: 178 IQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGTGSTGGAASAFP 237

Query: 239 APGEASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPFGAMSSNT 298
           APG  +     +                            PF +L NPA NPF A + N 
Sbjct: 238 APGGDA----PEESANTNTNTNTASSPNAGSNASSSTAANPFASLLNPALNPF-ASAGNA 292

Query: 299 NGSQPQQPAFDPALLASMLGMPQSQQTPAQ----QDNRPPEERYEAQLRQLNDMGFFDFD 354
            G+    PAFDPALLASM    Q QQ  AQ    +D RPPEERYE QLRQLNDMGFFDFD
Sbjct: 293 TGTG--MPAFDPALLASMF---QPQQASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFD 347

Query: 355 RNVAALRRSGGSVQGALDALLNGDV 379
           RNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 348 RNVAALRRSGGSVQGALDSLLNGDV 372

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  416 bits (1069), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 233/390 (59%), Positives = 264/390 (67%), Gaps = 37/390 (9%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MS+ IHIKSGQ+KW+V      ++   KE ISK + IP  NQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
            I++GHS+HLVKS     +                         N++SGQ+ GFNPL DL
Sbjct: 61  HIQDGHSVHLVKS---QPKPDAGGATGANNATATSAAVGTSATPNMSSGQSAGFNPLADL 117

Query: 121 TSARYAGYLNMPSADMFGPDGGL--NSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFM 178
           TSARYAGYLNMPSADMFGPDGG   N   +QD++LRM++NP+FQSQMNEMLSNPQM+DFM
Sbjct: 118 TSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFM 177

Query: 179 IQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFP 238
           IQSNPQLQAMGPQARQMLQSPMFRQML NP+M+RQSMQFARMM    DP A  +  SAFP
Sbjct: 178 IQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMM----DPNADNSAASAFP 233

Query: 239 APG----EASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPFGAM 294
           APG    E  A+TN                              PF +L NPA NPF   
Sbjct: 234 APGGDASEEGANTN------------AVPSSNAGTNGSANAAANPFASLLNPALNPF--- 278

Query: 295 SSNTNGSQPQ-QPAFDPALLASMLGMPQSQQTPAQ----QDNRPPEERYEAQLRQLNDMG 349
            +N   + P   PAFDPALLASM    Q QQ  AQ    +D+RPPEERYE QLRQLNDMG
Sbjct: 279 -ANAGNTAPTGMPAFDPALLASMF---QPQQASAQASQPEDSRPPEERYEHQLRQLNDMG 334

Query: 350 FFDFDRNVAALRRSGGSVQGALDALLNGDV 379
           FFDFDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 335 FFDFDRNVAALRRSGGSVQGALDSLLNGDV 364

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  415 bits (1066), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 232/389 (59%), Positives = 268/389 (68%), Gaps = 22/389 (5%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MSI++ IKSGQNKWDV    S++I   KE ISK S+IPA NQRLIYSGKILKD +TVESY
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
           KI++GHSIHLVKSG   A                       VP+NI SGQT GFNPL DL
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADL 120

Query: 121 TSARYAGY-LNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMI 179
           TSARYAGY L MPSADMFGPDGG+ + P+QDDML ML+NPVFQSQMNEMLSNPQM+++MI
Sbjct: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180

Query: 180 QSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDP-SAFP 238
            SNPQLQA+GPQAR+M QSP FRQML NPDMIRQSM+ ARMM G       G +  S+FP
Sbjct: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMGGEGVGIGGGLNGDSSFP 240

Query: 239 APGEAS--ASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPFGAM-- 294
           APGE S  ++T E N                              ALFNP  NPF  +  
Sbjct: 241 APGETSTESATAEDNAAARNPAATNPAAANPANPFA---------ALFNPGMNPFAGLGN 291

Query: 295 --SSNTNGS--QPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGF 350
             ++ + G+   PQ P F+P++LASML  P+    PAQ+D RPPE RYE+QLRQLNDMGF
Sbjct: 292 PAAAGSTGAPGTPQYPGFNPSMLASMLQQPRQ---PAQEDTRPPEVRYESQLRQLNDMGF 348

Query: 351 FDFDRNVAALRRSGGSVQGALDALLNGDV 379
           F+FDRN+AALRRSGGSVQGALDALLN DV
Sbjct: 349 FEFDRNIAALRRSGGSVQGALDALLNNDV 377

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  411 bits (1056), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 226/381 (59%), Positives = 256/381 (67%), Gaps = 10/381 (2%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MS+ IHIKSGQ+KW+VN     ++   KE I+K + IP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
            I++GHS+HLVKS     +                         N++SGQ+ GFNPL DL
Sbjct: 61  HIQDGHSVHLVKSQ---PKPQTASAAGANNATATGAAAGTGATPNMSSGQSAGFNPLADL 117

Query: 121 TSARYAGYLNMPSADMFGPDGGL--NSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFM 178
           TSARYAGYLNMPSADMFGPDGG   N   +QD++LRM++NP+FQSQMNEMLSNPQM+DFM
Sbjct: 118 TSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFM 177

Query: 179 IQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFP 238
           IQSNPQLQAMGPQARQMLQSPMFRQML NPDMIRQSMQFARMM+      + G   SAFP
Sbjct: 178 IQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGMGSAGGAASAFP 237

Query: 239 APGEASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPFGAMSSNT 298
           APG  +                                  PF +L NPA NPF   ++  
Sbjct: 238 APGGDAPEEGSNTNTTSSSNTGNNAGTNAGTNAGANTAANPFASLLNPALNPF---ANAG 294

Query: 299 NGSQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVA 358
           N +    PAFDPALLASM   P   Q    +D RPPEERYE QLRQLNDMGFFDFDRNVA
Sbjct: 295 NAASTGMPAFDPALLASMFQPP--VQASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVA 352

Query: 359 ALRRSGGSVQGALDALLNGDV 379
           ALRRSGGSVQGALD+LLNGDV
Sbjct: 353 ALRRSGGSVQGALDSLLNGDV 373

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  410 bits (1054), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 232/409 (56%), Positives = 267/409 (65%), Gaps = 38/409 (9%)

Query: 2   SITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYK 61
           +I+IHIKSGQN W V+ + + SIATLK+EI+K+SEIPATNQRLIYSGKILKDDQ V+ Y 
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  IEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDLT 121
           I++GHS+HLV+SG                           VPSNI++GQTGGFNPL DLT
Sbjct: 63  IQDGHSVHLVRSG-------KKSTPTPATTNTTTNASNNTVPSNISAGQTGGFNPLADLT 115

Query: 122 SARYAGY-LNMPSADMFGPDGGLN-SGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMI 179
           SARYAGY LN+PSAD FGPDGG+N SG + D+ L MLDNP+ QSQMNEMLSNPQMIDFMI
Sbjct: 116 SARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMI 175

Query: 180 QSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGG----NDPAATGNDPS 235
           QSNPQLQAMGPQARQM QSPMFRQML NPDMIRQSMQ A MM  G        AT N  S
Sbjct: 176 QSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAAS 235

Query: 236 AFPAPG-------EASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAA 288
           +FPAPG         + +    N                           PF +LFNP A
Sbjct: 236 SFPAPGGDDIINNNNTNTNTNTNTNNDTNDTATSNNDNANNNASSANTQNPFASLFNPTA 295

Query: 289 N---------PFGAM--------SSNTNGSQPQQPAFDPALLASMLGMPQS-QQTPAQQD 330
           N         PF AM         +N  G+    P FDP++ AS+ G   +   TP QQD
Sbjct: 296 NNDSTGLAPNPFLAMLNNAGAGSGTNNAGATGTLPPFDPSMFASLFGGAGAPSTTPQQQD 355

Query: 331 NRPPEERYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 379
            RPPEERYE QLRQLNDMGFFDFDRN+AALRR+GGSV+ A++ALLNGDV
Sbjct: 356 TRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  404 bits (1037), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 265/397 (66%), Gaps = 49/397 (12%)

Query: 2   SITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYK 61
           +IT+ IKSGQNKW+V  +   +++T KEEISK+SEIPA++QRLIYSGKILKDDQT++ Y 
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  IEEGHSIHLVKSG---GNVARXXXXXXXXXXX--------XXXXXXXXXXXVPSNIASGQ 110
           +++GHS+HLVKS    GN +                                PSN+++GQ
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 111 TGGFNPLNDLTSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLS 170
           +GGFNPL DLTSARYAG+ ++PSADMFGPDGG  + P+Q+D+L MLDNP+FQSQMNEMLS
Sbjct: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182

Query: 171 NPQMIDFMIQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMN--GGNDPA 228
           NPQM+DFMIQSNPQLQAMGPQARQM QSP FRQML NP MIRQSMQFARMMN  GG + A
Sbjct: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDA 242

Query: 229 ATGNDPSAFPAP------GEASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDA 282
           A     +AFPAP      GE++A  N+                                 
Sbjct: 243 A-----NAFPAPGNENTEGESAAGANDGGNPAAAATNAGAPP------------------ 279

Query: 283 LFNPAANPFGAMSSNTNGSQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQL 342
               A NPF A+       Q Q    DP LLASMLG P  QQ P  QDNRPPEERYE QL
Sbjct: 280 ----AGNPFAALLGGGGPLQ-QPGGLDPQLLASMLGAPSQQQQP--QDNRPPEERYETQL 332

Query: 343 RQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 379
           RQLN+MGFFDFDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 333 RQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  403 bits (1036), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 217/390 (55%), Positives = 262/390 (67%), Gaps = 22/390 (5%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MSIT+H+KSGQ+KWDV+ +   ++A  K  I++ S+I   NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXX-XXXXXXXXXXVPSNIASGQTGGFNPLND 119
           KI +GH++HLVKSG                             P++++SGQ GGFNPL+D
Sbjct: 61  KILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNPLSD 120

Query: 120 LTSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMI 179
           LTSARYAGYLN+PSAD FGPDGG+ S P+ DDMLRML+NPV QSQMNEMLSNPQMIDF+I
Sbjct: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180

Query: 180 QSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFPA 239
           Q +PQLQ+MGPQARQMLQSP FRQM+ NP+MIRQSMQF+ ++ G  DP+A G +  AFPA
Sbjct: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAGAN--AFPA 238

Query: 240 PGEASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALF----------NPAAN 289
           PG A +  + Q                            PF +L           +  AN
Sbjct: 239 PGTADSDASAQ---------PASTNTSTADAAQSATNANPFASLLAGQAAAPGGASAPAN 289

Query: 290 PFGAMSSNTNGSQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMG 349
           PF +M           PAFDPA+L+++LG   +  +   QD RPPEERYE QLRQLNDMG
Sbjct: 290 PFLSMLGQQAPGAGGLPAFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDMG 349

Query: 350 FFDFDRNVAALRRSGGSVQGALDALLNGDV 379
           FF+FDRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 350 FFEFDRNVAALRRSGGSVQGALDALLNGDV 379

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  394 bits (1013), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 223/383 (58%), Positives = 260/383 (67%), Gaps = 21/383 (5%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MS+ +++KSGQ+KW+V+     ++   KE IS+ + IP  NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
            I++GHS+HLVKS     +                       P N++SGQ+ GFNPL DL
Sbjct: 61  HIQDGHSVHLVKSQPR-PQAGAATGAGGDAGASATNASVSATP-NMSSGQSAGFNPLADL 118

Query: 121 TSARYAGYLNMPSADMFGPDGGL--NSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFM 178
           TSARYAGYLNMPSADMFGPDGG   N   +QD++LRM+DNP+FQSQMNEMLSNPQM+DFM
Sbjct: 119 TSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDFM 178

Query: 179 IQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFP 238
           IQSNPQLQAMGPQARQMLQSPMFRQML NPDMIRQSMQFARMM+      + G   SAFP
Sbjct: 179 IQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGNGSAGGAASAFP 238

Query: 239 APG-EASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPFGAMSSN 297
           APG +A   T + +                              +L NPA NPF   ++ 
Sbjct: 239 APGGDAPEETTDTDAAPSSNAGANAAANPFA-------------SLLNPALNPFA--NAG 283

Query: 298 TNGSQPQQPAFDPALLASMLGMPQSQQTPAQ-QDNRPPEERYEAQLRQLNDMGFFDFDRN 356
            + +    PAFDPALLASM    Q+     Q +D RPPEERYE QLRQLNDMGFFDFDRN
Sbjct: 284 NSAAATGMPAFDPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMGFFDFDRN 343

Query: 357 VAALRRSGGSVQGALDALLNGDV 379
           VAALRRSGGSVQGALD+LLNGDV
Sbjct: 344 VAALRRSGGSVQGALDSLLNGDV 366

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  385 bits (989), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 222/399 (55%), Positives = 258/399 (64%), Gaps = 43/399 (10%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MSIT+HIKSGQNKWDV  + S +IA  K  I+  SEI   NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  KIEEGHSIHLVKSGGN-------VARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGG 113
           KI + HS+HLVKSGG+                                 P+N+++GQ  G
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNG 120

Query: 114 FNPLNDLTSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQ 173
           FNPL+DLTSARYAG+LN+PSAD FGPDGG+ S P+ DD+LRML+NPV QSQMNEMLSNPQ
Sbjct: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180

Query: 174 MIDFMIQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGND 233
           MIDF+IQ +PQLQ+MGPQAR +LQSP FRQM+ NPDMIRQSMQF+ M+ G     +    
Sbjct: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLGG----DSAAGG 236

Query: 234 PSAFPAPG---EASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFN----- 285
            S+FPAPG   EA A +                               PF +L       
Sbjct: 237 GSSFPAPGTPAEADAPSQPAA---------------NPSAAPSAGTANPFASLLGGQAGA 281

Query: 286 ----PAANPFGAMSSNTNGSQPQQPAFDPALLASML-GMPQSQQTPAQQDNRPPEERYEA 340
               PAANPF +M    +   P  PA DP +L+S+L G   + Q P  QD RPPEERYE 
Sbjct: 282 SGASPAANPFLSMLGGGSAGTP--PALDPMVLSSILGGAGAANQQP--QDTRPPEERYEH 337

Query: 341 QLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 379
           QLRQLNDMGFF+FDRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 338 QLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  382 bits (980), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 221/418 (52%), Positives = 264/418 (63%), Gaps = 51/418 (12%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           MSI++H+KSGQNKW V+ + S SI TLK+ I+++S IPA NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIEEGHSIHLVK------------SGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIAS 108
           KI +GHSIHLV+            +GG                          VP+NI +
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGG----ASGSVEAVGSGGRNSTAGSGSTVPNNITA 116

Query: 109 GQTGGFNPLNDLTSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEM 168
           GQ GGFNPL DLT ARYAGY N+PS DMFGPDGGLNS   Q+++L MLDNP+FQSQ+NEM
Sbjct: 117 GQMGGFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEM 176

Query: 169 LSNPQMIDFMIQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPA 228
           L+NPQMIDF+IQ +P LQAMGP AR+MLQSP FRQM+ NPD+IRQ  +F   M      A
Sbjct: 177 LANPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMG-----A 231

Query: 229 ATGNDPSAFPAPGEA--SASTNEQNXXXXXXXXXXXXXXXXXX--XXXXXXXXXPFDALF 284
           A G   + FPAPG A  SA+T+  N                             PF A+F
Sbjct: 232 ANGQSTNDFPAPGSANNSATTSGDNATLTSTGTGTNTNAAAANPLTSLFNAQSNPFAAMF 291

Query: 285 NPAANP-------FGAMSSNTN-----GSQPQQPA-------FDPALLASML--GMPQS- 322
            P AN         GA +S TN     G+  QQP+        DPA+L+++L  G   + 
Sbjct: 292 APPANSGPNPGTNAGATNSTTNPAAAFGADSQQPSRGFSLPPLDPAMLSALLSGGFTATG 351

Query: 323 -QQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 379
            QQT   +DNRPPEERY+ QL QLN+MGF DFDRNVAALRRSGGSVQGAL+ALLNGDV
Sbjct: 352 RQQT---EDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  380 bits (975), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 214/386 (55%), Positives = 246/386 (63%), Gaps = 27/386 (6%)

Query: 3   ITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKI 62
           I++H+KSGQN W V    + +I   KE IS +S +PA NQRLIYSGKILKD +TVESYKI
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  EEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDLTS 122
           ++GHS+H+VKS                             PSNI++GQTGGFNPL DLT 
Sbjct: 64  QDGHSVHMVKS---GGASAATTGSTTTGSAASPAATNSAAPSNISAGQTGGFNPLADLTG 120

Query: 123 ARYAGYLNMPSADMFGPDGGLNS--GPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ 180
           ARYAG  N+PSADMFGPDGGLNS  G + + ML+ML+NP+FQSQMNEMLSNPQM+DF+IQ
Sbjct: 121 ARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQ 180

Query: 181 SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFPAP 240
            NPQLQA+GP+AR MLQSP FRQM+ +P MIRQSMQ A  M    D AA     SAFPAP
Sbjct: 181 QNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSMGMSPDGAA-----SAFPAP 235

Query: 241 GEASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFN------PAANPFGAM 294
           G AS +                                PF  LF        AANPF  +
Sbjct: 236 GSASGAGGANE-----TSTNDADSAATGAAASSTGQANPFAGLFGATPGNAAAANPFAGL 290

Query: 295 SSNTNGSQPQQPAFDPALLASMLGMPQSQQTPA-QQDNRPPEERYEAQLRQLNDMGFFDF 353
                    QQP F+  LLASM G   +    A   DNRPPEERYE+QLRQLNDMGFFDF
Sbjct: 291 FPGG-----QQPQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDF 345

Query: 354 DRNVAALRRSGGSVQGALDALLNGDV 379
           DRNVAALRR+GGSVQGALDALLNGDV
Sbjct: 346 DRNVAALRRAGGSVQGALDALLNGDV 371

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  376 bits (966), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 207/385 (53%), Positives = 256/385 (66%), Gaps = 23/385 (5%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           M+I++HIKSGQN WDV    S +I   K++I+ +SEIPA NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
           KI++GHSIH+VKSG +                           S +++G+  GFNPL+DL
Sbjct: 61  KIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGS---SGMSTGRGSGFNPLSDL 117

Query: 121 TSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ 180
           TSARYAGY N+PSADMFGPDGG  +  SQDDML ML+NPVFQSQMNEMLSNP+++DF+I 
Sbjct: 118 TSARYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLIN 177

Query: 181 SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFPAP 240
           SNPQLQ++GPQAR M QSPMFRQML NPDMIRQSM+ A+MMNGG   A+     S+FPAP
Sbjct: 178 SNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASA----SSFPAP 233

Query: 241 GEASAST--------NEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPFG 292
           G+++ +T        ++ N                           PF ALF+P+ NP+ 
Sbjct: 234 GDSTTTTQPTSTNIDSDTNATNNTNNATNTPTDVPGTTNSGTAAANPFAALFDPSMNPYA 293

Query: 293 AMSSNTNGSQPQQPAFDP--ALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGF 350
           A+      +      F+P     A     P +Q+    +DNRPPEERYE QLRQLNDMGF
Sbjct: 294 ALGGGNGNANNM---FNPAAFAQALQAAAPHTQEP---EDNRPPEERYEHQLRQLNDMGF 347

Query: 351 FDFDRNVAALRRSGGSVQGALDALL 375
           FDFD+NVAALRRSGGSVQGA++ALL
Sbjct: 348 FDFDKNVAALRRSGGSVQGAVNALL 372

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  374 bits (961), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 209/379 (55%), Positives = 246/379 (64%), Gaps = 34/379 (8%)

Query: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
           M+I I +KSGQN+W+V+   S S+  LK+EI+K+SEIPA NQRLIYSGKILKDDQTVESY
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPLNDL 120
           KI +GH+IHLVKS                            VPS+I++GQ+GGFNPL DL
Sbjct: 61  KIADGHAIHLVKS---GGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGGFNPLADL 117

Query: 121 TSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ 180
           T ARYAGY N+PS DMFGPDGGLNS   Q++++ ML+NP+FQSQMNEML+NPQMIDF+IQ
Sbjct: 118 TGARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQ 177

Query: 181 SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFPAP 240
            +P LQAMGP AR+MLQSP FRQML NPD+IRQ  +    M G    A  G D   FPAP
Sbjct: 178 QHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLQMGMGGAG--AEQGTD---FPAP 232

Query: 241 GEASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFNPAANPFGAMSSNTNG 300
           G A+                                      L   AANP GA  ++   
Sbjct: 233 GSAATPDAAAPAPNPLAAIL---------------------GLQPGAANPLGAAPADRGL 271

Query: 301 SQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVAAL 360
           +    P  DPA+L+S+        +PA  DNRPPEERYE QLRQLNDMGFFDFDRNVAAL
Sbjct: 272 A---MPPLDPAMLSSLF--GAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAAL 326

Query: 361 RRSGGSVQGALDALLNGDV 379
           RR+GGSVQGALDALLNGDV
Sbjct: 327 RRAGGSVQGALDALLNGDV 345

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  330 bits (845), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 212/398 (53%), Positives = 250/398 (62%), Gaps = 50/398 (12%)

Query: 1   MSITIHIKSGQNKWDVNTNLS---DSIATLKEEISKISEIPATNQRLIYSGKILKDDQTV 57
           M IT+ +K GQN+WDV         ++A  KE ++ ++ +P  NQRLIYSGKILKD QT+
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  ESYKIEEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVPSNIASGQTGGFNPL 117
           E YKI +GH++HLVKSGG  +                         +++A+GQ  GFNPL
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAG-ASMAAGQQPGFNPL 119

Query: 118 NDLTSARYAGY-LNMPSADMFGPDGGLNSGPSQ------DDMLRMLDNPVFQSQMNEMLS 170
            DLTSARYAGY L MPSADMFGPDGGL SG         +++L ML+NP+FQSQMNEM S
Sbjct: 120 ADLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFS 179

Query: 171 NPQMIDFMIQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAAT 230
           NPQM+DF+IQSNPQLQAMGPQAR+MLQSPMFRQML NPDM+RQSMQF++MM G     A 
Sbjct: 180 NPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMMQGSGA-GAG 238

Query: 231 GNDPSAFPAPG--EASASTNEQNXXXXXXXXXXXXXXXXXXXXXXXXXXXPFDALFN--- 285
           G DP+AFPAPG  +  A TN                              PF +LF    
Sbjct: 239 GADPNAFPAPGGDDTGAPTN----------------TSTNASAAGPAGANPFSSLFGGAP 282

Query: 286 -PAANPFGAMSSNTNGSQPQQPAFDPALLASMLGMPQSQQT---PAQQDNRPPEERYEAQ 341
            PAA PF +            P FD A  A M  M ++  T    A QD RPPEERYE Q
Sbjct: 283 APAAQPFQSA-----------PGFDAA--AFMQAMSRNGATAPAAAPQDTRPPEERYEQQ 329

Query: 342 LRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 379
           LRQLNDMGF DFDRNVAALRR+GGS+QGALDALLNGDV
Sbjct: 330 LRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 71.2 bits (173), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 105/221 (47%), Gaps = 17/221 (7%)

Query: 3   ITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKI 62
           I+++IK  + K+ + + L + I+ +  +I    +IP  NQRLIYSG+IL  ++T++ Y  
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  EEGHSIHLVKSGGNVARXXXXXXXXXXXXXXXXXXXXXXVP-SNIASGQTGGFNPLNDLT 121
           ++GH I ++     + +                       P SN        F   N +T
Sbjct: 62  KDGHCIIVI-----IHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPINSPTPFGEGNIIT 116

Query: 122 SARYAGYLNMPSADMFGPDGGLNSGPS-QDDMLRMLDNPVFQSQMNEMLSNPQ-MIDFMI 179
                  +   S D +G        P  + ++L++LD+P    Q NEML N Q ++ F+I
Sbjct: 117 -------ITTTSPDPYGVRSNEVHDPEVERELLQVLDHP-RSFQENEMLLNNQNLLRFLI 168

Query: 180 QSNPQLQAMGPQ-ARQMLQSPMFRQMLINPDMIRQSMQFAR 219
           Q+NP L+ M    ARQ+L+ P  ++  ++ + + Q +   R
Sbjct: 169 QTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRR 209

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 48.9 bits (115), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 34/51 (66%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD +  +KE + +   IP + QRLI+ GK + D+QTV+S K+ +G  +HLV
Sbjct: 20 SDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAKLTDGMQLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query: 16 VNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          V  N  D I  +KE + +   IP + QRLI+ GK + D QTV S K+ +G  +HLV
Sbjct: 15 VELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDGMQLHLV 70

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 16 VNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLVKS-- 73
          V  +  D +  +KE + +   IPA+ QRLI+ GK + +D T+ + K+ +G  +HLV +  
Sbjct: 15 VEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAKLSDGMQLHLVLTLR 74

Query: 74 GGN 76
          GGN
Sbjct: 75 GGN 77

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 45.4 bits (106), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLVKS--GGN 76
          SD +  +K+ + +   IP + QRLI+ GK + D+QTVES  + +G  +HLV +  GGN
Sbjct: 20 SDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESANLIDGMQLHLVLTLRGGN 77

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 45.1 bits (105), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 17 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 17 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 16 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 6  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 32/50 (64%)

Query: 22 DSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          + +  +KE + +   IP + QRLI+ GK ++DDQTV+S  +  G  +HLV
Sbjct: 21 EKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSANLSSGMQLHLV 70

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60
          M +T+   +G+ +  V  +  D +  +KE + +   IP T QRLI+ GK + DD++V S 
Sbjct: 1  MKLTVKTLTGK-EIPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSA 59

Query: 61 KIEEGHSIHLV 71
           +  G  +HLV
Sbjct: 60 NLSSGMQLHLV 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 34/56 (60%)

Query: 16 VNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          V+   +D +  +KE + +   IP + QRLI+ GK + D+QTV S  + +G  +HLV
Sbjct: 15 VDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSANLIDGMQLHLV 70

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLVKS--GGN 76
          SD +  +KE + +   IP + QRLI+ GK + D  TV    + EG  +HLV +  GGN
Sbjct: 20 SDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLVLTLRGGN 77

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 31/48 (64%)

Query: 24 IATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          I  +K+ + +   IP + QRLI+ GK + D QT+E+ K+ +G  +HLV
Sbjct: 23 IYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAKLVDGMVLHLV 70

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 36 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 35/56 (62%)

Query: 16 VNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          V+   S+++  +KE + +   IP + Q+LI+ GK + D+ T+ S  +++G  +HLV
Sbjct: 15 VDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSADLQDGSLLHLV 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 32/51 (62%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          ++ +  +KE + +   IP + QRLI+ GK + D+Q+V S  + +G  +HLV
Sbjct: 20 NEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDGMQLHLV 70

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 35/53 (66%)

Query: 16 VNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSI 68
          +   LS ++   K+++++  E   +  +LIYSGKIL+DD+T+  YK+++G  +
Sbjct: 16 LELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
           similar to uniprot|P04838 Saccharomyces cerevisiae
           YLL039c UBI4 ubiquitin
          Length = 305

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV--KSGGN 76
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV    GGN
Sbjct: 248 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN 305

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 124 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 174

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 200 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 250

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 276 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 326

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 352 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 402

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%)

Query: 335 EERYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 374
           E  Y  Q+RQL +MGF D ++N+ AL++S G++  A+D L
Sbjct: 187 ESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 79  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 129

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
           381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV--KSGGN 76
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV    GGN
Sbjct: 324 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN 381

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 248 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
           UBI4Ubiquitin, becomes conjugated to proteins, marking
           them for selective degradation via the ubiquitin-26S
           proteasome system; essential for the cellular stress
           response; encoded as a polyubiquitin precursor comprised
           of 5 head-to-tail repeats
          Length = 381

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV--KSGGN 76
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV    GGN
Sbjct: 324 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN 381

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 248 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
           complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV--KSGGN 76
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV    GGN
Sbjct: 476 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN 533

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 248 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 324 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 400 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 248 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 324 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 248 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV--KSGGN 76
           SD+I  +K +I     IP   QRLI++ K L+D +T+  Y I++  ++HLV    GGN
Sbjct: 324 SDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDYNIQKESTLHLVLRLRGGN 381

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 248 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 324 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 1  MSITIHIKS-GQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVES 59
          M+ITIH K   + +  +  + S +IA  K+ +++  +   +  ++I+SGK+L+D  T+E 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YKIEEGHSI 68
           K+++G  +
Sbjct: 61 CKLKDGDQV 69

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 248 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 324 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 174 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 224

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 250 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 300

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 328 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 378

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 404 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 454

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 248 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 324 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 400 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
          SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 20 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 96  SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 172 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 248 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 324 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 400 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 21  SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLV 71
           SD+I  +K +I     IP   QRLI++GK L+D +T+  Y I++  ++HLV
Sbjct: 476 SDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%)

Query: 11 QNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHL 70
          + K+ ++   S SI  +KE +S+      +  +LI+SGK+LKD  +VES   ++G+ +  
Sbjct: 11 KEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCNFKDGNEVIF 70

Query: 71 VKSG 74
          + S 
Sbjct: 71 MVSA 74

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 34/53 (64%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLVKS 73
          S++I  +K ++++      +  ++IYSGK+L+D QTVE  +++EG  I  + S
Sbjct: 21 SNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQIIFMIS 73

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 31/46 (67%)

Query: 23 SIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSI 68
          +I+  K+ +++  +   +  +LIYSGKIL+DD+T+  YK+ +G  +
Sbjct: 23 TISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 337 RYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALL--NGD 378
           +Y  +LR+L +MGF D D N  AL  + G + GA+D L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 337 RYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGD 378
           +Y  QLR L DMGF D D NV AL    G++   ++ L + +
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 337 RYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 374
           +Y  QL++LNDMGF + D N  AL  S G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 337 RYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 374
           +Y  +LRQL ++GF +  +N+ A+  S G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 1  MSITIHIKS-GQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVES 59
          M ITI+ K   + K  +  + + +IA  K+ ++K  +   +  ++I+SGK+L+D  T+++
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YKIEEGHSI 68
           K+++G  +
Sbjct: 61 CKLKDGDQV 69

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%)

Query: 11 QNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHL 70
          + K  V    S +I   K +++ I        +LI+SGK+LKDDQTV S  +++   + +
Sbjct: 10 KEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIM 69

Query: 71 VKS 73
          + S
Sbjct: 70 MIS 72

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 337 RYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 379
           R+  QLR L ++G+ D D NV AL  + G +  ALD +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%)

Query: 23 SIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSI 68
          +I+  KE I++  +  A+  +LIY+GKIL+D +TV    ++EG  +
Sbjct: 22 TISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQV 67

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 337 RYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 374
           RY  +LR L +MG+ D D N  AL  + G +  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 337 RYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 374
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 337 RYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 374
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 11 QNKWDVNTNLSDSIATLKEEISKISEIPATNQR--LIYSGKILKDDQTVESYKIEEGHSI 68
          ++K+ +N  ++D++  LK  I K  ++        LIYSGK+L+DD T+ S  +++   I
Sbjct: 11 RSKFQLNGTVNDTVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLNSLHLKDNAQI 70

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 3  ITIHIKS-GQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYK 61
          ITI+ K   + K  +  + + ++   K++++          +LI+SGK+L+D +T+E  K
Sbjct: 2  ITINFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECK 61

Query: 62 IEEGHSI 68
          +++G  +
Sbjct: 62 LKDGDQV 68

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 3  ITIHIKS-GQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYK 61
          ++I  K   + K  ++ +LS S+   K ++++  E      +LIYSGK+L+D ++++   
Sbjct: 2  VSITFKDFKKEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESG 61

Query: 62 IEEGHSI 68
          +++G  +
Sbjct: 62 LKDGDQV 68

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 337 RYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 374
           RY  QL +L DMGF D ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>Kwal_55.19849 s55 (152277..152579) [303 bp, 100 aa] {OFF} [contig
          159] FULL
          Length = 100

 Score = 32.0 bits (71), Expect = 0.58,   Method: Composition-based stats.
 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%)

Query: 9  SGQNKWDVNTNLSDSIATLKEEISKISEI 37
          SG+N W VN++LSDSIA+  E  S  SEI
Sbjct: 57 SGRNCWSVNSDLSDSIASSHESTSA-SEI 84

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 11/66 (16%)

Query: 14 WDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLVKS 73
          ++V + L+ SI+  + +I           +LIYSGK+L+D +TV    +++G  +  + S
Sbjct: 25 FEVKSKLAQSISCEESQI-----------KLIYSGKVLQDSKTVSECGLKDGDQVVFMVS 73

Query: 74 GGNVAR 79
              A+
Sbjct: 74 QKKSAK 79

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 32/53 (60%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLVKS 73
          S++I   K ++++ S    +  +LIYSGK+L+D +TV    +++G  +  + S
Sbjct: 21 SNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMIS 73

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 36/63 (57%)

Query: 11 QNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHL 70
          + K  ++   S++I   K ++++ +    +  +LIYSGK+L+D +TV    +++G  +  
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 71 VKS 73
          + S
Sbjct: 71 MIS 73

>KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}
          Anc_1.480 YEL037C
          Length = 375

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 11 QNKWDVNTNLS-DSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEG-HSI 68
          +NK  ++ +L  +S+  +KE+++   +  A   +LI+SGK+L+D +      ++E  H I
Sbjct: 11 KNKETLDVDLEHESVKDVKEKLAAARDCDAEQIKLIFSGKVLQDAKPFAETGLKENDHVI 70

Query: 69 HLVKSGGNV 77
           +V    +V
Sbjct: 71 MMVSKKKSV 79

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 34/58 (58%)

Query: 11 QNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSI 68
          + K  ++   S ++   K+++++  E   +  +LIYSGK+L+D  ++E   +++G  +
Sbjct: 11 KQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQV 68

>SAKL0G19426g Chr7 complement(1670664..1671386) [723 bp, 240 aa]
           {ON} similar to uniprot|P40576 Saccharomyces cerevisiae
           YIR024C (putative) involved in cell cycle control
          Length = 240

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 5/74 (6%)

Query: 280 FDALFNPAANPFGAMSSNTNGSQPQQPAFD-----PALLASMLGMPQSQQTPAQQDNRPP 334
             A++ P  +     S N +  +P++  FD     PA++  + G   +     Q+ N   
Sbjct: 2   LKAIYKPTISCVRLYSQNLSAQRPKKSRFDKSMIKPAIVLIVFGSMLTNVMEQQKKNSEL 61

Query: 335 EERYEAQLRQLNDM 348
           E RY  +L+ L D+
Sbjct: 62  ERRYSLKLKILRDL 75

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 31/53 (58%)

Query: 21 SDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSIHLVKS 73
          S++I   K ++++      +  +LIYSGK+L+D +TV    +++G  +  + S
Sbjct: 21 SNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVS 73

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
           complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score = 32.3 bits (72), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 320 PQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALD 372
           P+   T   ++N  P E    +L +LND+ F   D    +LRR   S  G++D
Sbjct: 874 PKESSTSLNRENTVPVETELKELDKLNDLKF--LDDETGSLRRGSMSTLGSID 924

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 337 RYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 374
           RY  QL +L DMG+ D  +N+ AL  + G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 20/26 (76%)

Query: 43 RLIYSGKILKDDQTVESYKIEEGHSI 68
          +LIYSGK+L+D +T+E   +++G  +
Sbjct: 43 KLIYSGKVLQDAKTLEDCGLKDGDQV 68

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 337 RYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 374
           +Y   ++ L  MG+ D D N  AL  + G +  A+D L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 337 RYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDAL 374
           RY  +L +L +MGF D D N  A+  + G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 13 KWDVNTNLSDSIATL--KEEISKISEIPATNQRLIYSGKILKDDQTVESYKIEEGHSI 68
          K  +  +L  S+  L  K++I+   +   +  +LIYSGK+L++D T+    +++G  +
Sbjct: 11 KEKIPLDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQV 68

>NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142
          Length = 396

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 329 QDNRPPEERYEAQLRQLNDMGF-FDFDRNVAALRRSGGSVQGALDAL 374
            D+R    +Y  QL +L DMG+  D  R   AL R+ G +  +LD +
Sbjct: 190 HDSRHGRFKYSRQLNELRDMGYSTDTQRIKDALERTHGDINRSLDII 236

>KLLA0A08316g Chr1 (733200..735302) [2103 bp, 700 aa] {ON} similar
           to uniprot|P32340 Saccharomyces cerevisiae YML120C NDI1
           NADH:ubiquinone oxidoreductase transfers electrons from
           NADH to ubiquinone in the respiratory chain but does not
           pump protons in contrast to the higher eukaryotic
           multisubunit respiratory complex I which is absent in S.
           cerevisiae
          Length = 700

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 5   IHIKSGQNKWDVNTNLS---DSIATLKEEI-SKISEIPATNQRLIYSGKIL 51
           IH++    K+DVN +     D I+TL  E+ +K++ +PAT QR    GK L
Sbjct: 550 IHLEDDLPKYDVNKSGQLNFDQISTLLREVETKVTSLPATAQRAHQQGKYL 600

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,352,783
Number of extensions: 1427002
Number of successful extensions: 4347
Number of sequences better than 10.0: 177
Number of HSP's gapped: 4383
Number of HSP's successfully gapped: 251
Length of query: 379
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 268
Effective length of database: 40,753,473
Effective search space: 10921930764
Effective search space used: 10921930764
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)