Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B038508.829ON37737719170.0
NCAS0C004708.829ON42637813160.0
YMR272C (SCS7)8.829ON38438312881e-178
Smik_13.4858.829ON38438312841e-177
Skud_13.4448.829ON38438312731e-175
CAGL0F03399g8.829ON38038212621e-174
SAKL0D01760g8.829ON38138312611e-173
TDEL0B006808.829ON38337912561e-173
KLLA0D01639g8.829ON38138212361e-170
NDAI0K004708.829ON38638512321e-169
KLTH0C04114g8.829ON37837812251e-168
ZYRO0G13948g8.829ON38438412191e-167
Kwal_27.103328.829ON37837812071e-165
KNAG0J003208.829ON37337811991e-164
Suva_13.4608.829ON38438111991e-164
AAL183W8.829ON37737411861e-162
Ecym_27128.829ON38138011761e-161
Kpol_541.98.829ON37437411671e-159
TBLA0D031808.829ON40038411211e-152
TPHA0C047108.829ON37737510651e-144
Kpol_1069.48.829ON2772667801e-102
Suva_14.2282.166ON1201121361e-09
Kpol_505.142.166ON123681343e-09
CAGL0L03828g2.166ON121681325e-09
Skud_14.2212.166ON120701291e-08
KNAG0I020402.166ON119911246e-08
NCAS0G025702.166ON121681221e-07
KLTH0D09284g2.166ON123701212e-07
Smik_14.2162.166ON120681202e-07
YNL111C (CYB5)2.166ON1201121193e-07
TDEL0F012102.166ON126681203e-07
NDAI0F027302.166ON121681185e-07
Kwal_26.84612.166ON123681176e-07
TBLA0B013102.166ON123551168e-07
TPHA0F017902.166ON182681181e-06
Ecym_54202.166ON145841161e-06
AFL223W2.166ON165701153e-06
SAKL0E10626g2.166ON123691114e-06
KLLA0F23672g2.166ON123691096e-06
KAFR0B045502.166ON126681097e-06
Kwal_47.18167na 1ON227571138e-06
KLLA0F27577gna 1ON172511119e-06
ADL085Cna 1ON273531122e-05
ZYRO0B09812g2.166ON183531074e-05
KLTH0A04026gna 1ON233531084e-05
TPHA0B018204.304ON576551033e-04
KLLA0B14795gna 2ON556731034e-04
SAKL0F08316gna 1ON17855985e-04
KLTH0C11770gsingletonON61850960.003
TDEL0H02180na 1ON20346920.004
Kpol_1014.54.304ON59658920.008
Ecym_4346na 1ON20950890.009
KLTH0C11858gsingletonON55546880.022
ZYRO0C18524gsingletonON55447870.031
YML054C (CYB2)4.304ON59150870.031
TDEL0D00190singletonON55294870.032
Smik_13.924.304ON59150870.038
NDAI0D047104.304ON61652860.047
Skud_13.924.304ON59150850.059
KAFR0I005204.304ON58656840.068
Kwal_26.80462.536ON19852800.11
Kwal_23.2823na 2ON56048810.16
NDAI0D04700na 3ON62546800.24
KLLA0D02640g4.304ON58950800.24
Kwal_14.807singletonON57852800.25
Smik_16.2923.330ON1181144800.27
Suva_13.1054.304ON59150790.29
SAKL0G16852g4.304ON58047780.41
NCAS0A02770na 3ON60956760.74
TPHA0G035502.536ON21853740.75
CAGL0K03069g2.536ON19447740.77
SAKL0F16610gsingletonON56448760.80
KNAG0E038604.304ON60450750.86
ZYRO0B13728g4.304ON59850751.1
ZYRO0D16654gna 1ON19055721.1
CAGL0K10736g4.304ON59350741.1
CAGL0H09966g3.254ON18390721.2
TBLA0D045807.182ON39590741.2
Kpol_1024.188.384ON83478741.3
NCAS0A027804.304ON60246722.0
CAGL0L07216g2.362ON85848713.1
TDEL0D011404.304ON58447703.3
Kpol_348.122.536ON21752693.7
TBLA0C058001.180ON98175703.8
NCAS0A067105.322ON76975694.9
CAGL0M13101g2.589ON34151676.7
NCAS0G03820singletonON34564677.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B03850
         (377 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   743   0.0  
NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      511   0.0  
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   500   e-178
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   499   e-177
Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   494   e-175
CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   490   e-174
SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   490   e-173
TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   488   e-173
KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   480   e-170
NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   479   e-169
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   476   e-168
ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   474   e-167
Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   469   e-165
KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   466   e-164
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   466   e-164
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   461   e-162
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   457   e-161
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   454   e-159
TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   436   e-152
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   414   e-144
Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   305   e-102
Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {O...    57   1e-09
Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON} (37085..37...    56   3e-09
CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} simila...    55   5e-09
Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {O...    54   1e-08
KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.16...    52   6e-08
NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON...    52   1e-07
KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar...    51   2e-07
Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {O...    51   2e-07
YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}  ...    50   3e-07
TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON...    51   3e-07
NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166      50   5e-07
Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C ...    50   6e-07
TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.16...    49   8e-07
TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.16...    50   1e-06
Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to...    49   1e-06
AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homol...    49   3e-06
SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar...    47   4e-06
KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} simil...    47   6e-06
KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.16...    47   7e-06
Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {O...    48   8e-06
KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some ...    47   9e-06
ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON} NO...    48   2e-05
ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar...    46   4e-05
KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {O...    46   4e-05
TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {O...    44   3e-04
KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} simi...    44   4e-04
SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {O...    42   5e-04
KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} simila...    42   0.003
TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON}                40   0.004
Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON} ...    40   0.008
Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to...    39   0.009
KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} simila...    39   0.022
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    38   0.031
YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON} ...    38   0.031
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 38   0.032
Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {O...    38   0.038
NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON} Anc_4...    38   0.047
Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {O...    37   0.059
KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {O...    37   0.068
Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON...    35   0.11 
Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C (...    36   0.16 
NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON}             35   0.24 
KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {...    35   0.24 
Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON} ...    35   0.25 
Smik_16.292 Chr16 complement(537812..541357) [3546 bp, 1181 aa] ...    35   0.27 
Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {...    35   0.29 
SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} simi...    35   0.41 
NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON}               34   0.74 
TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON...    33   0.75 
CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {...    33   0.77 
SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} simi...    34   0.80 
KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.3...    33   0.86 
ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} simi...    33   1.1  
ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa] ...    32   1.1  
CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} hig...    33   1.1  
CAGL0H09966g Chr8 (973025..973576) [552 bp, 183 aa] {ON} some si...    32   1.2  
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...    33   1.2  
Kpol_1024.18 s1024 (60564..63068) [2505 bp, 834 aa] {ON} (60564....    33   1.3  
NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304     32   2.0  
CAGL0L07216g Chr12 complement(801526..804102) [2577 bp, 858 aa] ...    32   3.1  
TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {O...    32   3.3  
Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON} ...    31   3.7  
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    32   3.8  
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    31   4.9  
CAGL0M13101g Chr13 (1288111..1289136) [1026 bp, 341 aa] {ON} sim...    30   6.7  
NCAS0G03820 Chr7 complement(706134..707171) [1038 bp, 345 aa] {O...    30   7.1  

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/377 (96%), Positives = 363/377 (96%)

Query: 1   MTTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITD 60
           MTTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITD
Sbjct: 1   MTTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITD 60

Query: 61  ELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFDLATLVVELPP 120
           ELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFDLATLVVELPP
Sbjct: 61  ELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFDLATLVVELPP 120

Query: 121 EEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFGN 180
           EEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFGN
Sbjct: 121 EEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFGN 180

Query: 181 AFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRFL 240
           AFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRFL
Sbjct: 181 AFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRFL 240

Query: 241 FHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLLLPYYW 300
           FHFDNYLPENNIA              PMDPYRLVVPPALFIILCAPIYKTVFLLLPYYW
Sbjct: 241 FHFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVFLLLPYYW 300

Query: 301 ACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDKV 360
           ACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDKV
Sbjct: 301 ACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDKV 360

Query: 361 FGTYLSKDAPASVMKFD 377
           FGTYLSKDAPASVMKFD
Sbjct: 361 FGTYLSKDAPASVMKFD 377

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  511 bits (1316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/378 (64%), Positives = 296/378 (78%), Gaps = 5/378 (1%)

Query: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61
             +KTLELFSK +VA H   EDCWVT++ RKIYDV+KFL ++ D D  +L +AG DIT+ 
Sbjct: 50  NVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109

Query: 62  LVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD---FDLATLVVEL 118
           L + K+D++   LD D YL+GY+AT  EE+KLLTNKDHKVEV L +    FD  T V +L
Sbjct: 110 LKDEKIDQQTDLLD-DQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKDL 168

Query: 119 PPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLF 178
           P E+KL+IAT+Y++D KKH FLDLNKPLL QIL G FT++FY+DQI+RPRHYGQ+SAPLF
Sbjct: 169 PTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPLF 228

Query: 179 GNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHR 238
           GN FLEPF+KTAW++VP  WLPVVF+   +A KN+N   A+ LFC+GV+VWT +EYC+HR
Sbjct: 229 GN-FLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHR 287

Query: 239 FLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLLLPY 298
           FLFHFD  LPE+N A              PMD YRLVVPP LFI LCAP YK VF LLPY
Sbjct: 288 FLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPY 347

Query: 299 YWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWD 358
           YWACAGFAGG+FGY+ YD+CHY LHHSKLPPFMR+LK+YHLEHHYKNY+LGYG+TSW+WD
Sbjct: 348 YWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSWYWD 407

Query: 359 KVFGTYLSKDAPASVMKF 376
           K FGTYLS D+P S MK+
Sbjct: 408 KKFGTYLSPDSPLSKMKY 425

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  500 bits (1288), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 251/383 (65%), Positives = 290/383 (75%), Gaps = 9/383 (2%)

Query: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT-- 59
            T+KTLELFSKK V  H    DCWVT  +RKIYDVT+FL E+   D  +LDYAG DIT  
Sbjct: 4   NTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDITEI 63

Query: 60  --DELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD---FDLATL 114
             D  V+   D  Y+ L+ D YL+GY+AT +E  +LLTNK+HKVEV L  D   FD  T 
Sbjct: 64  MKDSDVHEHSDSAYEILE-DEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDSTTF 122

Query: 115 VVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKS 174
           V ELP EEKL+IAT+Y  D+KKHKFLDLN+PLL QIL+  F ++FYVDQI+RPRHYG+ S
Sbjct: 123 VKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGS 182

Query: 175 APLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEY 234
           APLFGN FLEP +KTAWWVVP  WLPVV +   VALKNMN   A FLFCVGVFVWTL+EY
Sbjct: 183 APLFGN-FLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEY 241

Query: 235 CLHRFLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFL 294
            LHRFLFHFD++LPE+NIA              PMD YRLV+PP LF+ILCAP YK VF 
Sbjct: 242 GLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFA 301

Query: 295 LLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITS 354
           LLP YWA AGFAGGLFGYV YD CH+ LHHSKLPPFMR+LK+YHLEHHYKNY+LG+G+TS
Sbjct: 302 LLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTS 361

Query: 355 WFWDKVFGTYLSKDAPASVMKFD 377
           WFWD+VFGTYL  DAP S MK++
Sbjct: 362 WFWDEVFGTYLGPDAPLSKMKYE 384

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  499 bits (1284), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 251/383 (65%), Positives = 292/383 (76%), Gaps = 9/383 (2%)

Query: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61
            T+KTLELFSKK V  H   +DCWVT  +RKIYDVTKFL E+   D  +LDYAG DIT+ 
Sbjct: 4   NTSKTLELFSKKTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPGGDESILDYAGKDITEV 63

Query: 62  L----VNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD---FDLATL 114
           +    V+   D  Y+ L+ D YL+GY+AT +E  +LLTNK+HKVEV L  D   FD  T 
Sbjct: 64  MKDTDVHEHSDSAYEILE-DEYLIGYLATDEEAARLLTNKNHKVEVQLSSDGTEFDSTTF 122

Query: 115 VVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKS 174
           V +LP EEKL+IAT+Y  D+KKHKFLDLN+PLL QIL   F ++FYVDQI+RPRHYG+ S
Sbjct: 123 VKDLPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYGKGS 182

Query: 175 APLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEY 234
           APLFGN FLEP +KTAWWVVPT WLPVV +   VALKNMN   A FLFCVGVFVWTL+EY
Sbjct: 183 APLFGN-FLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEY 241

Query: 235 CLHRFLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFL 294
            LHRFLFHFD++LPE+NIA              PMD YRLV+PP LF+ILCAP YK VF 
Sbjct: 242 GLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFA 301

Query: 295 LLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITS 354
           LLP YWA AGFAGGLFGYV YD CH+ LHHSKLPPFMR+LK+YHLEHHYKNY+LG+G+TS
Sbjct: 302 LLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTS 361

Query: 355 WFWDKVFGTYLSKDAPASVMKFD 377
           WFWD+VFGTYL  DAP S MK++
Sbjct: 362 WFWDEVFGTYLGPDAPLSKMKYE 384

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  494 bits (1273), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 248/383 (64%), Positives = 289/383 (75%), Gaps = 9/383 (2%)

Query: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT-- 59
            T+KTLELFS+K V  H   +DCWVT  +RKIYDVTKFL E+   D  +LDYAG D+T  
Sbjct: 4   NTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVTEI 63

Query: 60  --DELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD---FDLATL 114
             D  V+   D  Y+ L+ D YL+GY+AT +E  +LLTNK HKVEV L  D   FD  T 
Sbjct: 64  MKDSDVHEHSDSAYEILE-DEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDSTTF 122

Query: 115 VVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKS 174
           V  LP EEKL+IAT+Y  D+KKHKFLDLN+PLL QIL+  F ++FYVDQI+RPRHYG+ S
Sbjct: 123 VKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGS 182

Query: 175 APLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEY 234
           APLFGN FLEP +KTAWWVVP  WLPVV +   VALKNMN   A FLFCVGVFVWTL+EY
Sbjct: 183 APLFGN-FLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEY 241

Query: 235 CLHRFLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFL 294
            LHRFLFHFD++LPE+N+A              PMD YRLV+PP LF+ILCAP YK VF 
Sbjct: 242 GLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFA 301

Query: 295 LLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITS 354
           LLP YWA AGFAGGLFGYV YD CH+ LHHSKLPPFMR+LK+YHLEHHYKNY+LG+G+TS
Sbjct: 302 LLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTS 361

Query: 355 WFWDKVFGTYLSKDAPASVMKFD 377
           WFWD+VFGTYL  DAP S MK++
Sbjct: 362 WFWDEVFGTYLGPDAPLSKMKYE 384

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  490 bits (1262), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 243/382 (63%), Positives = 293/382 (76%), Gaps = 15/382 (3%)

Query: 3   TAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFL-DENRDFDSL---LLDYAGTDI 58
           ++KTLELF +  +A H  ++DCWV+   RKIYDV+K+L D   + D++   L    GTDI
Sbjct: 7   SSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGTDI 66

Query: 59  TD-ELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD--FDLATLV 115
           +  EL   K          D+YLVGY+AT+DEE+KLLTNK HKVEV L  D  FD  T V
Sbjct: 67  SQMELTTLKFV-------TDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFV 119

Query: 116 VELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSA 175
            +LP E+KL+I T+Y+RD+KKHKFLDLNKPLL QIL G FT++FY+DQI+RPRHYG+ SA
Sbjct: 120 KDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSA 179

Query: 176 PLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYC 235
           PLFGN FLE F+KTAWWVVPT W PVV +F   AL NMNNPLALFLF +G+FVWTL+EYC
Sbjct: 180 PLFGN-FLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEYC 238

Query: 236 LHRFLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLL 295
           LHRFLFHFD +LPE+++               PMD YRLVVPPALF++LCAPIYK VF  
Sbjct: 239 LHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAA 298

Query: 296 LPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSW 355
           LPYYWACAGFAGG+ GY+ YD+CHY LHHSK+PPFMR+LK+YHLEHHYKNY+LG+G+TSW
Sbjct: 299 LPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTSW 358

Query: 356 FWDKVFGTYLSKDAPASVMKFD 377
           FWDKVFGTYL  DAP S MK++
Sbjct: 359 FWDKVFGTYLGPDAPLSKMKYE 380

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  490 bits (1261), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 234/383 (61%), Positives = 292/383 (76%), Gaps = 8/383 (2%)

Query: 1   MTTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT- 59
           M+ +KTL L SK +++ H  +EDCWV++++RK+Y+VT FL+E+   D  +LD+AG DIT 
Sbjct: 1   MSESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITE 60

Query: 60  ---DELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD--FDLATL 114
              D+LV+   +  Y+ + ND YLVGY+A  +EE+KLLTN+DH VEV L +   FD  T 
Sbjct: 61  IMKDKLVHEHSESAYEIM-NDMYLVGYLANEEEEKKLLTNEDHTVEVKLNESTQFDSTTF 119

Query: 115 VVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKS 174
           V ELP E+KL+IAT+Y  D+KKHKFLDL+KPLL Q++ G FT++FY+DQ++RPRHYG+ S
Sbjct: 120 VKELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGS 179

Query: 175 APLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEY 234
           APLFGN FLEP SKT W+ +P  WLPVVF+   VAL NMN P ALFLF +GVFVWTL+EY
Sbjct: 180 APLFGN-FLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEY 238

Query: 235 CLHRFLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFL 294
           CLHRFLFH D YLPE  +A              PMD YRLV+PP LF++LC P YK VF 
Sbjct: 239 CLHRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFS 298

Query: 295 LLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITS 354
           LLPYYWACAGFAGG+ GY  YD+ HY LHH+KLPP+MR+LK+YHLEHHYKNYELG+G+TS
Sbjct: 299 LLPYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTS 358

Query: 355 WFWDKVFGTYLSKDAPASVMKFD 377
           WFWDKVFGTYL  DAP S MK++
Sbjct: 359 WFWDKVFGTYLGSDAPLSKMKYE 381

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  488 bits (1256), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 238/379 (62%), Positives = 288/379 (75%), Gaps = 6/379 (1%)

Query: 4   AKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELV 63
           +KTLELFS+K+V+ H    DCWVT+ +RKIYDVTKFLDE+      +LDYAG DIT+ L 
Sbjct: 6   SKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLK 65

Query: 64  NGKLDE----KYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQ-DFDLATLVVEL 118
           +  + E     Y+ L++ +YLVGY+AT  EE++LLTN  HKVEV L   DFD  T V +L
Sbjct: 66  DSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLDFDSTTFVKDL 125

Query: 119 PPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLF 178
           P EEKL+IAT+Y RD+K+H FLDL KPLLPQ++ GKFT++FYVDQI+RPRHYG+ SAPLF
Sbjct: 126 PTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAPLF 185

Query: 179 GNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHR 238
           GN FLEP SKT+W+V+P  WLPVV +   VA KNMN    +F FC+G FVWTL+EY LHR
Sbjct: 186 GN-FLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLHR 244

Query: 239 FLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLLLPY 298
           FLFHFD++LPE+N+               PMD YRLV+PP LF+ILC P YK VF LLP 
Sbjct: 245 FLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLPL 304

Query: 299 YWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWD 358
           Y A AGFAGGLFGYV YD+ HY LHHSKLP FMR+LK+YHLEHHYKNY+LG+G+TSWFWD
Sbjct: 305 YVAYAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGVTSWFWD 364

Query: 359 KVFGTYLSKDAPASVMKFD 377
           KVFGTYLS  +P S MK+D
Sbjct: 365 KVFGTYLSPTSPISQMKYD 383

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  480 bits (1236), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 231/382 (60%), Positives = 290/382 (75%), Gaps = 6/382 (1%)

Query: 1   MTTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITD 60
           M++++ L L+SK ++  H  + DCWV+++ RKIY+VT+FLDE+      +LDYAGTDITD
Sbjct: 1   MSSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITD 60

Query: 61  ---ELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLE--QDFDLATLV 115
              +++  +  E    + +++YLVGY+AT +EE+KLLTNKDH VEV L+   +FD    V
Sbjct: 61  VMKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNLKGNNEFDSTVFV 120

Query: 116 VELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSA 175
            ELP E+KL+IAT+Y  D+KKHKFLDLNKPLL Q+L GKFT++FY+DQ++RPRHYG+ SA
Sbjct: 121 KELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSA 180

Query: 176 PLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYC 235
           PLFGN FLEP SKT WW+VP  WLPVV +    AL NMN   A+FLF VGVFVWTL+EY 
Sbjct: 181 PLFGN-FLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYG 239

Query: 236 LHRFLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLL 295
           LHRFLFH D+ LPE   A              PMD +RLV+PP LF++LC P YK VF L
Sbjct: 240 LHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFAL 299

Query: 296 LPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSW 355
           LPYYWACAGFAGG+ GYV YD+ HY LHHS+LPP+MR+LK+YHLEHHYKNYELG+G+TSW
Sbjct: 300 LPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSW 359

Query: 356 FWDKVFGTYLSKDAPASVMKFD 377
           FWDKVFGTYL ++AP S MK+D
Sbjct: 360 FWDKVFGTYLGENAPLSNMKYD 381

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  479 bits (1232), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 237/385 (61%), Positives = 290/385 (75%), Gaps = 9/385 (2%)

Query: 1   MTTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRD--FDSLLLDYAGTDI 58
           + T+KTLELFSK +VA H   +DCW+T   RKIYDVTKFL++N +     LLL++AG DI
Sbjct: 3   INTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDI 62

Query: 59  TDEL---VNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQ---DFDLA 112
           TDEL   ++   +  +  L  D YL+GY+AT  EE+ LLTNKDHKVEV L +    FD  
Sbjct: 63  TDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDST 122

Query: 113 TLVVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQ 172
           T V +LP E+KL+IAT+  +D +KHKFLDL+KPLL QIL G FT++FY+DQI+RPRHYG 
Sbjct: 123 TFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGD 182

Query: 173 KSAPLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLL 232
           KSAPLFGN  LEP +KT+W++VP FWLPVVF+   VAL NMN   A+ LF +G++VWTL+
Sbjct: 183 KSAPLFGN-ILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLI 241

Query: 233 EYCLHRFLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTV 292
           EYC+HRFLFHFD  LPE+NI               PMD YRLVVPP LFI LC P YK V
Sbjct: 242 EYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVV 301

Query: 293 FLLLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGI 352
           F LLP YWA AGFAGGLFGYV YD+CHY LHHSK+PP +R+LK+YHLEHHYKNY+LGYG+
Sbjct: 302 FKLLPLYWAYAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYGV 361

Query: 353 TSWFWDKVFGTYLSKDAPASVMKFD 377
           TSW+WDK+FGTYLS D+P S MK++
Sbjct: 362 TSWYWDKIFGTYLSPDSPMSKMKYE 386

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  476 bits (1225), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 225/378 (59%), Positives = 284/378 (75%), Gaps = 6/378 (1%)

Query: 4   AKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELV 63
            KTL L+S+ ++  H  R+DCWV++  RKIY+VT FLDE+     L+ +YAG D+T+ + 
Sbjct: 3   TKTLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPGGAELIEEYAGKDVTEIMK 62

Query: 64  NGKLDE----KYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFDLATLVVELP 119
           +G   E     Y+ LD + Y VGY+AT +EE+KLL N +H VEV LE+D+D    V E+P
Sbjct: 63  DGPTHEHSYVAYEVLDEE-YHVGYLATPEEEKKLLGNPEHPVEVKLEEDYDSTVFVPEVP 121

Query: 120 PEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFG 179
           PEEKL+I T+Y +D+ +HKFLDLN+PLL Q+L   F++EFY+DQ++RPRHYG+ SAPLFG
Sbjct: 122 PEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAPLFG 181

Query: 180 NAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRF 239
           N FLEP SKTAW+V+P  W PVV +    AL+NMNN LA+FLFC+GVFVWTL+EY LHRF
Sbjct: 182 N-FLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLHRF 240

Query: 240 LFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLLLPYY 299
           LFH D YLP N +A              PMD YRLV+PP LF++LC P YK VF LLP Y
Sbjct: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLPKY 300

Query: 300 WACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDK 359
           WACAGFAGG+FGY+ YD+ HY LHH+KLP +MR+LK+YH+EHHYKNYELG+G+TSWFWDK
Sbjct: 301 WACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFWDK 360

Query: 360 VFGTYLSKDAPASVMKFD 377
           VFGTYL  +AP S MKFD
Sbjct: 361 VFGTYLGDNAPLSQMKFD 378

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  474 bits (1219), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 230/384 (59%), Positives = 285/384 (74%), Gaps = 10/384 (2%)

Query: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61
           T + TL+LFS+++++ H   +DCWV+++ RKIY+VT+FLDE+      +L YAG DIT+ 
Sbjct: 3   TKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITEV 62

Query: 62  L----VNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTL----EQDFDLAT 113
           L    V+   +  Y+ LD DNYLVGY+AT +E  KLLTNK H+VEV L      DFD  T
Sbjct: 63  LKDRDVHEHSESAYEILD-DNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTT 121

Query: 114 LVVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQK 173
            V ELP EEKL IAT+Y RD+KKHKFLDLN+ LLPQ++ G F+++FY+DQ++RPRHYG+ 
Sbjct: 122 FVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKG 181

Query: 174 SAPLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLE 233
           SAPLFGN FLEP SKT WW +P  W+PVV   F V   NMN   + FLFC+G+FVWTL+E
Sbjct: 182 SAPLFGN-FLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE 240

Query: 234 YCLHRFLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVF 293
           YCLHRFLFH D +LP+NN A              PMD YRLV+PP L I+L APIYKTVF
Sbjct: 241 YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF 300

Query: 294 LLLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGIT 353
            LLP YWA +GFAGGLFGYV YD+ HY LHH+KLP +MR+LK+YHLEHHYKNY+LG+G+T
Sbjct: 301 GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 354 SWFWDKVFGTYLSKDAPASVMKFD 377
           SWFWD VFGTYL  DAP + MK+D
Sbjct: 361 SWFWDNVFGTYLGPDAPLAHMKYD 384

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  469 bits (1207), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/378 (58%), Positives = 282/378 (74%), Gaps = 6/378 (1%)

Query: 4   AKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELV 63
            KTL L+S  +V  H   +DCWVT+ +RKIYDVTKFL+++     L+++YAG DIT+ + 
Sbjct: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62

Query: 64  NGKLDE----KYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFDLATLVVELP 119
           +G L       Y+ LD + Y VGY+ATA+EEQKLL N  HKVEV LE ++D    V E+P
Sbjct: 63  DGPLHSHSFVAYEVLDEE-YHVGYLATAEEEQKLLGNSKHKVEVKLEDEYDSTVFVPEVP 121

Query: 120 PEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFG 179
            EEKL+I T+Y RD+ +HKFLDLN+PLL Q+L   FT+EFY+DQ++RPRHYG+ SAPLFG
Sbjct: 122 AEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLFG 181

Query: 180 NAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRF 239
           N FLEP SKT+W+V+P  WLPVV +    A++NMN   A+FLF VG+FVWTL+EY +HRF
Sbjct: 182 N-FLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRF 240

Query: 240 LFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLLLPYY 299
           LFH D YLP N +A              PMD YRLV+PP LF++LC P YK VF LLPYY
Sbjct: 241 LFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPYY 300

Query: 300 WACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDK 359
           WACAGFAGG+ GYV YD+ HY LHH+KLP  +++LK+YH+EHHYKNYELG+G+TSW WDK
Sbjct: 301 WACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDK 360

Query: 360 VFGTYLSKDAPASVMKFD 377
           VFGTYL+++AP S MKFD
Sbjct: 361 VFGTYLAENAPLSQMKFD 378

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  466 bits (1199), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 223/378 (58%), Positives = 285/378 (75%), Gaps = 9/378 (2%)

Query: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61
           + ++TLEL SK  VA+H ++ D WV +  RK+ D++ ++ E  + + LLL  AG DITD 
Sbjct: 3   SNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDR 62

Query: 62  LVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLE--QDFDLATLVVELP 119
                   ++  L+ D++LVGY+AT  EE++LL+NKDHKVEV LE  + FD +T V +LP
Sbjct: 63  ------SHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKDLP 116

Query: 120 PEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFG 179
            E+KL+IAT+  RD++KH FLDL KPL+PQ+L G FT++FYVDQI+RPRHYG+ SAPLFG
Sbjct: 117 TEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLFG 176

Query: 180 NAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRF 239
           N FLEP SKTAW+VVP  W PVV +F   +LK ++   AL LF +G FVWTL+EYC+HRF
Sbjct: 177 N-FLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRF 235

Query: 240 LFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLLLPYY 299
           LFHFD++LPENN+A              PMD YRLVVPPALF++LC P YK VF LLP+Y
Sbjct: 236 LFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHY 295

Query: 300 WACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDK 359
            ACAGFAGG+FGY+ YD+ HY LHHSK+P FMR+LKQYHLEHHYKNY+LG+G+++WFWDK
Sbjct: 296 VACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDK 355

Query: 360 VFGTYLSKDAPASVMKFD 377
           VF TYL KDAP S MK+D
Sbjct: 356 VFDTYLGKDAPISPMKYD 373

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  466 bits (1199), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 247/381 (64%), Positives = 291/381 (76%), Gaps = 7/381 (1%)

Query: 3   TAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDEL 62
           T+KTLELFSKK V  H   +DCWVT  +RKIYDVTKFL E+   +  +LDYAG DIT+ +
Sbjct: 5   TSKTLELFSKKTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPGGEESILDYAGKDITEVM 64

Query: 63  VNGKLDEKYKA---LDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD---FDLATLVV 116
            +  + E  ++   +  D YLVGY+AT +E  +LLTNK+HKVEV L  D   FD  T V 
Sbjct: 65  KDSDVHEHSESAYEILEDEYLVGYLATDEEATRLLTNKNHKVEVQLSADGTEFDSTTFVK 124

Query: 117 ELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAP 176
           +LP EEKL+IAT+Y  D+KKHKFLDLNKPLL QIL+  FTR+FYVDQI+RPRHYG+ SAP
Sbjct: 125 DLPTEEKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYGKGSAP 184

Query: 177 LFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCL 236
           LFGN FLEP +KTAWWVVP  W+PVV +   VALKNMN   A FLF VG+FVWTL+EY L
Sbjct: 185 LFGN-FLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLIEYSL 243

Query: 237 HRFLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLLL 296
           HRFLFHFD++LPE+NIA              PMD YRLV+PP+LF+ILCAP YK VF LL
Sbjct: 244 HRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLVFALL 303

Query: 297 PYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWF 356
           P YWA AGFAGGLFGYV YD CHY +HHSKLPPFMR+LK+YHLEHHYKNY+LG+G+TSWF
Sbjct: 304 PLYWAYAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWF 363

Query: 357 WDKVFGTYLSKDAPASVMKFD 377
           WD VFGTYL  DAP S MK++
Sbjct: 364 WDDVFGTYLGPDAPLSKMKYE 384

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  461 bits (1186), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 225/374 (60%), Positives = 279/374 (74%), Gaps = 7/374 (1%)

Query: 3   TAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT--- 59
            +KTL L+SK  +  HT R  CWV++ +RKIYDV++FLDE+   D  +LDYAG DIT   
Sbjct: 2   VSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVL 61

Query: 60  -DELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFDLATLVVEL 118
            D+L++   +  Y+ LD ++YLVGY+AT +EE KLLTN+ H +EVT E + D  T V EL
Sbjct: 62  KDKLIHEHTEAAYEILD-ESYLVGYLATEEEEIKLLTNEKHVMEVTPE-NLDTTTFVKEL 119

Query: 119 PPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLF 178
           P EE L++AT++  D+ KH FLDLNKPLL Q+L+G FTR+FY+DQI+RPRHYG+ SAPLF
Sbjct: 120 PAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLF 179

Query: 179 GNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHR 238
           GN FLEP SKT WWVVP  W PVV ++   AL+NM   LAL  F  GVFVWTL+EY LHR
Sbjct: 180 GN-FLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHR 238

Query: 239 FLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLLLPY 298
           FLFHFD+ +PE+NIA              PMD YRLV+PPALF++LCAP Y+ VF + P 
Sbjct: 239 FLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPE 298

Query: 299 YWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWD 358
           Y AC  FAGGLFGYV YD+ HY LHH KLPPFMR+LK+YHLEHHYKNYELG+G+TSW+WD
Sbjct: 299 YCACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWD 358

Query: 359 KVFGTYLSKDAPAS 372
           KVFGTYL+ ++P S
Sbjct: 359 KVFGTYLASNSPVS 372

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  457 bits (1176), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 226/380 (59%), Positives = 280/380 (73%), Gaps = 5/380 (1%)

Query: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61
           ++ KTL L+SK E   H K   CWV+I  RKIY+V+KFLDEN +    +LD+AG D+T  
Sbjct: 3   SSCKTLPLYSKSEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPEGYQYVLDHAGQDVTQL 62

Query: 62  LVNGKLDEKY---KALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFDL-ATLVVE 117
           L + + DE       L +D YL+GY+AT++EE+KLLTN +H VEV       + +  V +
Sbjct: 63  LKDMQTDEPTDLAHQLLSDAYLIGYLATSEEERKLLTNANHVVEVKPANGNRVDSGFVKK 122

Query: 118 LPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPL 177
           LP EEKL IAT++  D++KH FLDL+KPL  Q+L G FT+EFY+DQ++RPRHYG++SAPL
Sbjct: 123 LPTEEKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGKESAPL 182

Query: 178 FGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLH 237
           FGN FLEP SKT+WWV+P  W P V ++ R AL N++ PLALFLF VGVFVWTL+EY LH
Sbjct: 183 FGN-FLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIEYGLH 241

Query: 238 RFLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLLLP 297
           RFLFHFD+ +PE+NI               PMD YRLV+PPALF+ LC P YK VF +LP
Sbjct: 242 RFLFHFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVFSILP 301

Query: 298 YYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFW 357
           YY ACAGFAGGLFGYV YD+ HY LHH KLPPFMR+LK+YHLEHHYKNYELG+G+TSW+W
Sbjct: 302 YYCACAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYW 361

Query: 358 DKVFGTYLSKDAPASVMKFD 377
           DKVF TYLS  AP S  K+D
Sbjct: 362 DKVFNTYLSPTAPLSRAKYD 381

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  454 bits (1167), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 218/374 (58%), Positives = 280/374 (74%), Gaps = 7/374 (1%)

Query: 4   AKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELV 63
           +KTLELF+K     H    DCWV++  R IYDV+ +L +N D DS +L++AG DIT +L 
Sbjct: 6   SKTLELFAKSRFEEHNTEADCWVSVKERLIYDVSSYLKDNADADSSILEHAGKDIT-KLT 64

Query: 64  NGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD-FDLATLVVELPPEE 122
             +   ++K + +D YLVGY+AT +EE +LLTNKDHKVEV L+   +D    V ELP EE
Sbjct: 65  KTR---EFKFI-SDEYLVGYLATEEEEVRLLTNKDHKVEVNLQDGTYDSTVFVKELPAEE 120

Query: 123 KLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFGNAF 182
           K T+AT+  +DF+ H FLDLNKP+L Q+L G FTR+FY+DQ++RPRHYG+ SAPLFGN F
Sbjct: 121 KFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGKGSAPLFGN-F 179

Query: 183 LEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRFLFH 242
           LEP S T WW++P  W PVV +   VAL NMNN  A FLFC+G+FVWTL+EYCLHRFLFH
Sbjct: 180 LEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIEYCLHRFLFH 239

Query: 243 FDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLLLPYYWAC 302
            D+++P++NI               PMD YRLVVPPALF++LC PIYK VF LLP YWA 
Sbjct: 240 LDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVFGLLPLYWAY 299

Query: 303 AGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDKVFG 362
           AGFAGGL GY+ YD+ HY +HH KLP FMR++K++HLEHHYKNY+LG+G++++FWDKVFG
Sbjct: 300 AGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVSNYFWDKVFG 359

Query: 363 TYLSKDAPASVMKF 376
           TYL  D+PAS+M++
Sbjct: 360 TYLGPDSPASIMRY 373

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  436 bits (1121), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 215/384 (55%), Positives = 270/384 (70%), Gaps = 9/384 (2%)

Query: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61
           ++  T ELFS + V  H  ++DCWV   +RKIYDV+++L +    +S ++D+AG DIT  
Sbjct: 18  SSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSS 77

Query: 62  LVNGKL----DEKYKALD-NDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD---FDLAT 113
             N +      E Y  +  ND YLVGY+A  +E  KLL+N  HKVEV L +    +D  T
Sbjct: 78  FKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTT 137

Query: 114 LVVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQK 173
            V ELP E+   IAT+Y +DF +H FLDL KPL+PQ+ + KF R FY+DQI+RPRH+G K
Sbjct: 138 FVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNK 197

Query: 174 SAPLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLE 233
           SAPLFGN FLEP +KTAWWV+P  WLPVVF+  +VA  NMNN  A FLFCVGVFVWTL+E
Sbjct: 198 SAPLFGN-FLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFVWTLIE 256

Query: 234 YCLHRFLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVF 293
           Y LHRFLFH DN +P++ +               PMDPYRLV+PP LF+ILC P YK VF
Sbjct: 257 YSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVF 316

Query: 294 LLLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGIT 353
            +LP YWA AGFAGGLFGYV YD  HY LHHS++P FMR LK+ HLEHHYKNY+L +G++
Sbjct: 317 SVLPLYWAYAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQLAFGVS 376

Query: 354 SWFWDKVFGTYLSKDAPASVMKFD 377
           ++FWDKVFGTYL  D+P S MK++
Sbjct: 377 NYFWDKVFGTYLYPDSPLSPMKYE 400

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  414 bits (1065), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 203/375 (54%), Positives = 266/375 (70%), Gaps = 9/375 (2%)

Query: 4   AKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDF--DSLLLDYAGTDITDE 61
           +KTLELFS ++  +H   +DCWV++  R IYDV+KF+ EN+D   +  +L  AG DI+D 
Sbjct: 7   SKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDAVLKRAGKDISDL 66

Query: 62  LVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD-FDLATLVVELPP 120
           L      + +K +D D YLVGY+A + EE +LLTNKDHKVEV L+   +D    V ELP 
Sbjct: 67  LET----KSFKFVD-DKYLVGYLANSTEEARLLTNKDHKVEVNLKDGTYDSTVFVKELPS 121

Query: 121 EEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFGN 180
           EE  TI+T+Y +DF  H FLDL KPLL Q+L G FTREFY+DQI+RPRHYG+ SA LFGN
Sbjct: 122 EEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGKGSAKLFGN 181

Query: 181 AFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRFL 240
            +LEP S T WW++P  W PVV + F V  ++M+   A+F + +G+FVWT +EYCLHRFL
Sbjct: 182 -WLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIEYCLHRFL 240

Query: 241 FHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPALFIILCAPIYKTVFLLLPYYW 300
           FH D+++P++N                PMD YRLVVPPALF++LC P YK VF LLP Y 
Sbjct: 241 FHLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVFALLPLYV 300

Query: 301 ACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDKV 360
           A  GFAGGL GY+ YD+ HY +HH KLP   R++K++HLEHHYKNY+LG+G++++FWD V
Sbjct: 301 AYVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVSNYFWDLV 360

Query: 361 FGTYLSKDAPASVMK 375
           FGTYL  D+PAS+M+
Sbjct: 361 FGTYLGPDSPASIMR 375

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  305 bits (780), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 193/266 (72%), Gaps = 4/266 (1%)

Query: 100 KVEVTLEQDFDLATLVVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREF 159
           K+E ++E    +    +    EEKL + T+Y++DF ++ FL L++PL  Q+L   FTR+F
Sbjct: 2   KIEESIETYIHIRKTTLT---EEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDF 58

Query: 160 YVDQINRPRHYGQKSAPLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLAL 219
           Y+DQ+++PRHYG +SAP+FGN FLEPF+KT W++VP  W PVV + F V+L+ ++  LA+
Sbjct: 59  YIDQVHKPRHYGIESAPIFGN-FLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAI 117

Query: 220 FLFCVGVFVWTLLEYCLHRFLFHFDNYLPENNIAXXXXXXXXXXXXXXPMDPYRLVVPPA 279
            LF +GVFVWTL+EYC+HR+LFH D+ +PE  +               PMD YRLV+PPA
Sbjct: 118 TLFSIGVFVWTLIEYCMHRYLFHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPA 177

Query: 280 LFIILCAPIYKTVFLLLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHL 339
           LF ILC P Y   F + P YWA AGFAGGLFGYV YD+ HY LHH K+P FMR++K+YHL
Sbjct: 178 LFSILCYPFYLLTFAIFPRYWAHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHL 237

Query: 340 EHHYKNYELGYGITSWFWDKVFGTYL 365
           EHHYKN++LG+G+TS FWD+VFGTYL
Sbjct: 238 EHHYKNFQLGFGVTSSFWDRVFGTYL 263

>Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {ON}
           YNL111C (REAL)
          Length = 120

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 38/112 (33%), Positives = 58/112 (51%), Gaps = 9/112 (8%)

Query: 8   ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
           +++S +EVA H   E+CW+ I   K+YDV++F DE+   D +++D  G D TD  V+ G 
Sbjct: 3   KVYSYQEVAEHNGPENCWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATDSFVDIGH 61

Query: 67  LDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFDLATLVVEL 118
            DE  K L        Y+   D+  + +  K  K   +  Q    ATLV+ L
Sbjct: 62  SDEALKLLKTL-----YIGDVDKTSEPVVVK--KAATSESQSQGSATLVMIL 106

>Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON}
          (37085..37456) [372 nt, 124 aa]
          Length = 123

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
          ++++ +E+A H   E CW+ I   K+YD TKFLDE+   D ++LD AG D T+   + G 
Sbjct: 3  KVYTYQEIAEHNTTESCWIVI-DGKVYDTTKFLDEHPGGDEIILDLAGQDATESFEDIGH 61

Query: 67 LDEKYKAL 74
           DE  K L
Sbjct: 62 SDEALKIL 69

>CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111c CYB5
          Length = 121

 Score = 55.5 bits (132), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 2/68 (2%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
          ++++ K+V+ H K  DCW+ I    +YDV+KFLDE+   D ++ ++ GTD T + V+ G 
Sbjct: 3  KVYTYKQVSEHNKEGDCWI-IIDGSVYDVSKFLDEHPGGDEIIFEHRGTDATGDFVDIGH 61

Query: 67 LDEKYKAL 74
           D+  K L
Sbjct: 62 SDDALKIL 69

>Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 54.3 bits (129), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 2/70 (2%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
          +++S +EVA H   E+CW+ I   K+YDV++F DE+   D +++D  G D T+  V+ G 
Sbjct: 3  KVYSYQEVAEHNGPENCWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIGH 61

Query: 67 LDEKYKALDN 76
           DE  + L +
Sbjct: 62 SDEALRLLKD 71

>KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.166
          YNL111C
          Length = 119

 Score = 52.4 bits (124), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 30/91 (32%), Positives = 50/91 (54%), Gaps = 7/91 (7%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
          ++++ ++VA H+  ED W+ I +R +Y+VTKFLDE+   + +LL+ AG D T   ++ G 
Sbjct: 3  KIYTYEDVAQHSTSEDAWIVIDNR-VYEVTKFLDEHPGGEEILLEMAGADATTNFLDIGH 61

Query: 67 LDEKYKALDNDNYLVGYVATADEEQKLLTNK 97
           D+  K L        Y+   D   K +  K
Sbjct: 62 SDDAMKILKTR-----YIGDIDPSSKPIPKK 87

>NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON}
          Anc_2.536 YMR073C
          Length = 121

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 43/68 (63%), Gaps = 2/68 (2%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
          +++S +++A H K +D W+ I   K+YDV+KFLDE+   D ++ + AG D T+  ++ G 
Sbjct: 3  QVYSYQQIAEHNKPDDAWI-IIEGKVYDVSKFLDEHPGGDEIIFELAGQDATEHFLDIGH 61

Query: 67 LDEKYKAL 74
           D+  + L
Sbjct: 62 SDDALQIL 69

>KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
          +L+S KE+A H    D W+ I   K+YD TKF+DE+   + +LLD  G D T    + G 
Sbjct: 3  KLYSYKEIAEHNTENDLWM-IIDGKVYDCTKFMDEHPGGEEVLLDLGGQDATGPFADIGH 61

Query: 67 LDEKYKALDN 76
           D+  K L++
Sbjct: 62 SDDAVKMLED 71

>Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
          +++S +EVA H   E+ W+ I   K+YDV+KF DE+   D +++D  G D T+  V+ G 
Sbjct: 3  KVYSYQEVAEHNGPENFWI-IIDDKVYDVSKFKDEHPGGDEIIMDLGGQDATESFVDIGH 61

Query: 67 LDEKYKAL 74
           DE  + L
Sbjct: 62 SDEALRLL 69

>YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}
           CYB5Cytochrome b5, involved in the sterol and lipid
           biosynthesis pathways; acts as an electron donor to
           support sterol C5-6 desaturation
          Length = 120

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 58/112 (51%), Gaps = 9/112 (8%)

Query: 8   ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
           +++S +EVA H   E+ W+ I   K+YDV++F DE+   D +++D  G D T+  V+ G 
Sbjct: 3   KVYSYQEVAEHNGPENFWI-IIDDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVDIGH 61

Query: 67  LDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFDLATLVVEL 118
            DE  + L        Y+   D+  + ++ +  KV  +  Q     TLVV L
Sbjct: 62  SDEALRLLKGL-----YIGDVDKTSERVSVE--KVSTSENQSKGSGTLVVIL 106

>TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON}
          Anc_2.166 YNL111C
          Length = 126

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 9  LFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GKL 67
          ++S +++A H   ED W+ +   K+YDVTKF+DE+   D ++LD AG D ++   + G  
Sbjct: 4  VYSYQQIAEHNSAEDIWI-VVDGKVYDVTKFMDEHPGGDEIILDLAGQDASEPFRDIGHS 62

Query: 68 DEKYKALD 75
          +E  K L+
Sbjct: 63 EEALKILN 70

>NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166
          Length = 121

 Score = 50.1 bits (118), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
          ++++ +E+A H   +D W+ I   K+YDV+KFLDE+   + ++ + AGTD T+   + G 
Sbjct: 3  QIYTYEEIAKHNSPDDTWIVI-EGKVYDVSKFLDEHPGGEEIIFELAGTDATENFEDIGH 61

Query: 67 LDEKYKAL 74
           D+  K L
Sbjct: 62 SDDALKIL 69

>Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C
          (CYB5) - 1:1 [contig 61] FULL
          Length = 123

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
          +L+S KE+A H   +D W+ I   K+YD TKF+DE+   + +L+D  G D T    + G 
Sbjct: 3  KLYSYKEIAEHNTEKDLWM-IIDGKVYDCTKFMDEHPGGEEVLVDLGGQDATGPFADIGH 61

Query: 67 LDEKYKAL 74
           D+  K L
Sbjct: 62 SDDAVKML 69

>TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.166
          YNL111C
          Length = 123

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDEL 62
          +L+S +E+A H   E  W+ I   K+YDVTKFLD +   D ++L+ AG D T + 
Sbjct: 3  KLYSYEEIAAHNTTESAWI-IIKDKVYDVTKFLDSHPGGDEIILELAGQDATQDF 56

>TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.166
           YNL111C
          Length = 182

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 8   ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
           ++++ +E+A H   E  W+ I   K+Y+VTKFLDE+   D ++ D AGTD T+   + G 
Sbjct: 61  KIYTYEEIAEHNTTESSWIVI-EGKVYNVTKFLDEHPGGDEIIFDLAGTDATENFEDIGH 119

Query: 67  LDEKYKAL 74
            D+  K L
Sbjct: 120 SDQALKVL 127

>Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to
          Ashbya gossypii AFL223W
          Length = 145

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 46/84 (54%), Gaps = 7/84 (8%)

Query: 10 FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GKLD 68
          F+ +E+A+H   +D W+ I + K+YD +KF DE+   D +LLD  G D T   ++ G  D
Sbjct: 5  FTYQEIADHNSEQDLWL-IINGKVYDCSKFADEHPGGDEVLLDLGGQDATIPFLDIGHTD 63

Query: 69 EKYKALDNDNYLVGYVATADEEQK 92
          +  K LD+      Y+   DE  +
Sbjct: 64 DAVKLLDH-----MYIGDVDETSE 82

>AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL111C (CYB5)
          Length = 165

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 8   ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
           +L++ +E+A H    D W+ I + K+YD TKF +E+   D +L+D AG D T+   + G 
Sbjct: 42  KLYTYQEIAEHNSENDLWL-IINGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFADIGH 100

Query: 67  LDEKYKALDN 76
            D+  K L+ 
Sbjct: 101 SDDAVKMLEG 110

>SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
          +LF+ +E+A H    D W+ I   K+YD TKF+DE+   + +L+D  G D T    + G 
Sbjct: 3  KLFTYQEIAEHNTEGDLWM-IIDGKVYDCTKFIDEHPGGEEVLVDLGGQDATGPFADIGH 61

Query: 67 LDEKYKALD 75
           D+  K L+
Sbjct: 62 SDDAIKLLE 70

>KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON}
          similar to uniprot|P40312 Saccharomyces cerevisiae
          YNL111C CYB5 Cytochrome b5 involved in the sterol and
          lipid biosynthesis pathways required for sterol C5-6
          and fatty acid desaturation
          Length = 123

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
          +L + KEV+ H   +D W+ I   K+YD TKF+DE+   D +L+D  G D T    + G 
Sbjct: 3  KLLTYKEVSEHKTVDDLWM-IIDGKVYDCTKFVDEHPGGDEILVDLGGQDATGPFEDIGH 61

Query: 67 LDEKYKALD 75
           D+  K L+
Sbjct: 62 SDDAIKLLE 70

>KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.166
          YNL111C
          Length = 126

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 43/68 (63%), Gaps = 2/68 (2%)

Query: 8  ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVN-GK 66
          ++++  +VA H   +DCW+ I   K+Y+V+KFLDE+   D ++ + AG+D T+  ++ G 
Sbjct: 3  QVYTYADVAEHVLPDDCWIAI-DGKVYNVSKFLDEHPGGDEIIYELAGSDATEYFLDIGH 61

Query: 67 LDEKYKAL 74
           D+  K L
Sbjct: 62 SDDALKIL 69

>Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa]
          {ON} YNL111C (CYB5) - cytochrome b5 [contig 197] FULL
          Length = 227

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 3  TAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
          T+  L   S  EVA HT  +DCW++I   K+YDV+ +L ++     ++L  AG D T
Sbjct: 27 TSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDAT 82

>KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some
          similarities with uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5
          Length = 172

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 9  LFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
          L +  EVA H+ R DCW T+   K+YD+T FL ++     +LL YAG D T
Sbjct: 5  LITMDEVARHSSRSDCW-TVIHGKVYDITSFLHKHPGGAQVLLKYAGKDST 54

>ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON}
           NOHBY406; No homolog in Saccharomyces cerevisiae
          Length = 273

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 7   LELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
           L   S +EV+ HT R+DCW  I  R +YD+T  L+ +     +LL YAG D T
Sbjct: 90  LRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDAT 141

>ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 183

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 8   ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITD 60
           ++++ ++VA H   ED W+ I   K+YDVTKF++++   D ++LD AG D T+
Sbjct: 59  KVYTFEQVAEHNTPEDAWL-IVDGKVYDVTKFVEDHPGGDEIILDLAGQDGTE 110

>KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa]
          {ON} weakly similar to uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
          sterol and lipid biosynthesis pathways
          Length = 233

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 9  LFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61
          + S++E+A HT  EDCW+ I    +YDV+++L ++     ++L  AG D T +
Sbjct: 33 VISREELATHTSAEDCWLAIHG-AVYDVSRYLTQHPGGAQVMLKLAGKDATAQ 84

>TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {ON}
           Anc_4.304 YML054C
          Length = 576

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 5   KTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
           K  ++ + +EVA H KR+DCWV I +  +Y++T F+D +    ++++  +G D+T
Sbjct: 68  KNSKVITPEEVARHNKRDDCWVVI-NDSVYNLTDFIDSHPGGKNVIVANSGKDVT 121

>KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 556

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%), Gaps = 14/73 (19%)

Query: 1   MTTAKTLELF-------------SKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFD 47
           +T A +L LF             S KEV  H + +DCW+ I   ++YD+TKFL ++    
Sbjct: 59  LTGASSLTLFLSYFLSDNDKDGVSVKEVKMHNRIDDCWIVI-DNEVYDITKFLSQHPGGV 117

Query: 48  SLLLDYAGTDITD 60
           + L+++AG D T+
Sbjct: 118 ARLMEFAGRDATE 130

>SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa]
          {ON} some similarities with uniprot|P00175
          Saccharomyces cerevisiae YML054C CYB2 Cytochrome b2
          (L-lactate cytochrome-c oxidoreductase), component of
          the mitochondrial intermembrane space, required for
          lactate utilization; expression is repressed by glucose
          and anaerobic conditions
          Length = 178

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 7  LELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61
          + + S  EV  H + +DCW+ I   K+Y++T FL ++     ++L Y G D T +
Sbjct: 1  MHVISPSEVVKHNRPDDCWMIIHG-KVYNLTSFLSQHPGGAHVILQYGGRDATKQ 54

>KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 618

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 10  FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
            S  EV  H K +DCWV I    +YDVT F+D++    +++   AG D++
Sbjct: 119 VSATEVIRHNKEDDCWVVIDG-YVYDVTAFIDQHPGGSAVIRGNAGKDVS 167

>TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 14 EVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
          EV  H    DCW+ I  R +YDVT  L ++     +LL YAG D T
Sbjct: 29 EVREHNTAHDCWMAIHGR-VYDVTPILSKHPGGCQILLKYAGMDAT 73

>Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON}
           complement(3107..4897) [1791 nt, 597 aa]
          Length = 596

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 3   TAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITD 60
           + K+L++ + +EV  H  ++DCWV I +  +YD+T F+ ++     +++  AG D+++
Sbjct: 84  SKKSLKIITPQEVIKHNSKDDCWVVI-NDIVYDLTFFIKKHPGGQDVIVGNAGKDVSN 140

>Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to
          Ashbya gossypii ADL085C
          Length = 209

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 10 FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
           S  EV  HT  +DCW  I + K+YD+T  L  +      LL YAG D T
Sbjct: 6  ISLSEVRRHTSADDCWFIIHN-KVYDITNLLSTHPGGAKTLLKYAGRDAT 54

>KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 555

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 14  EVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
           EV  H K +DCW+ + + ++YDVT FL  +    + +++ AG D T
Sbjct: 80  EVMQHNKPDDCWI-VLNGEVYDVTSFLQMHPGGAARIMEVAGNDAT 124

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 13  KEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
           KEV  H    DCW+ + + +IYDVT F+ ++    + LL+ AG D T
Sbjct: 79  KEVMLHNNVNDCWI-VLNGEIYDVTSFIGKHPGGAARLLEVAGRDAT 124

>YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON}
           CYB2Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase), component of the mitochondrial
           intermembrane space, required for lactate utilization;
           expression is repressed by glucose and anaerobic
           conditions
          Length = 591

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 10  FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
            S  EVA H K +DCWV I    +YD+T+FL  +     ++   AG D+T
Sbjct: 91  ISPAEVAKHNKPDDCWVVINGY-VYDLTRFLPNHPGGQDVIKFNAGKDVT 139

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 7/94 (7%)

Query: 10  FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDELVNGKLDE 69
            S  E+  H    DCW+ + + ++YDVT FL  +    + L++ AG D T++      D 
Sbjct: 75  ISASELRKHNTVHDCWIAL-NGEVYDVTAFLQMHPGGVARLMEVAGGDATEKFYQIHSDS 133

Query: 70  KYKALDNDNYLVGYVATA------DEEQKLLTNK 97
            ++ + N+   +G +  +      DEE +++  K
Sbjct: 134 VFEKMKNNFIYIGKLKGSIDKTYTDEELRIIEMK 167

>Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 10  FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
            S  EVA H K +DCWV I    +YD+T+FL  +     ++   AG D+T
Sbjct: 91  ISPAEVAKHNKPDDCWVVINGY-VYDLTRFLPNHPGGQDVIKFNAGKDVT 139

>NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON}
           Anc_4.304
          Length = 616

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 9   LFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITD 60
           L S  EVA H    DCWV I   K+YD+T F+  +     ++   AG D+T+
Sbjct: 95  LISPDEVAKHHTPADCWVVIHD-KVYDLTSFIPIHPGGPDIIKSNAGKDVTN 145

>Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 10  FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
            S  EVA H K +DCWV I +  +YD+T+F+  +     ++   AG D+T
Sbjct: 91  ISPAEVAKHNKADDCWVVI-NGYVYDLTRFMPNHPGGPDVIKFNAGRDVT 139

>KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {ON}
           Anc_4.304 YML054C
          Length = 586

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 4   AKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
           A T  L   +EVA H   +DCWV I +  +YD+T F+  +     +L   AG D+T
Sbjct: 77  AITTRLILPEEVAKHKTPDDCWVVI-NGYVYDITSFIMSHPGGPDVLETNAGKDVT 131

>Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON}
           YMR073C - Hypothetical ORF [contig 55] FULL
          Length = 198

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 10  FSKKEVANHTKREDCWVTIFSRKIYDVTKFLD-ENRDFDSLLLDYAGTDITD 60
            +K ++A H   EDCW  I ++K+Y ++ +LD      D L+   AG D T 
Sbjct: 123 INKAQLAQHKAPEDCWCVI-NQKVYCISSYLDFHPGGVDILMKGAAGKDCTS 173

>Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C
           (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 246] FULL
          Length = 560

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 14  EVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61
           EV  H K  DCW+ + + ++YDVT F+  +      +L+ AG+D T++
Sbjct: 85  EVMLHNKLNDCWI-VLNDEVYDVTSFIAAHPGGVQRILEVAGSDATEK 131

>NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON} 
          Length = 625

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 14  EVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
           E+  H   EDCWV I + ++YD+T F+  +    +++   AG D+T
Sbjct: 109 ELMKHNTPEDCWVVI-NNQVYDLTTFIQVHPGGPNIIRSNAGKDVT 153

>KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {ON}
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase) component of the mitochondrial
           intermembrane space required for lactate utilization
           expression is repressed by glucose and anaerobic
           conditions
          Length = 589

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 10  FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
            S  EVA H+  +DCWV I    +Y++T F+  +    +++ + AG D+T
Sbjct: 90  VSPTEVAKHSSPKDCWVVIEGY-VYNLTDFISAHPGGPAIIENNAGKDVT 138

>Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON}
           YML054C (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 245] FULL
          Length = 578

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 8   ELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
           E    +EVA H+K +DCWV I +  +YD++ F+  +    +++   AG D++
Sbjct: 77  ESIRPQEVAKHSKPDDCWVVI-NGYVYDLSDFIAVHPGGPAIIKANAGKDVS 127

>Smik_16.292 Chr16 complement(537812..541357) [3546 bp, 1181 aa]
           {ON} YPR049C (REAL)
          Length = 1181

 Score = 35.4 bits (80), Expect = 0.27,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 63/144 (43%), Gaps = 6/144 (4%)

Query: 25  WVTIFSRKIYDVTKFLDENR----DFDSLLLDYAGTDITDELVNGKLDEKYKALD-NDNY 79
           W   F+  +  +T   D++     + +SLL +     I +  +NGKL++  + +D N N+
Sbjct: 249 WEKCFNETLSKLTGLEDDSLQKFINIESLLENEKSVKILNHSINGKLNKIKREIDENSNF 308

Query: 80  LVGYVATADEEQKLLTNKDHKVEVTLEQDFDLATLVVELPPEEKLTIATNYDRDFKKHKF 139
                   ++ +++ T  + K E+  +       LV E+    +  +A   D +FK  +F
Sbjct: 309 RETITLNINKLREIFTPDESKYELENKMAESFEVLVSEMRSRSRNVLAKEVD-EFKSKEF 367

Query: 140 LDLNKPLLPQILKGKFTREFYVDQ 163
           L+    +L +  K      F + Q
Sbjct: 368 LESMNEMLEKDKKNSVKSLFTISQ 391

>Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 10  FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
            S  EVA H   +DCWV I    +YD+T+F+  +     ++   AG D+T
Sbjct: 91  ISPAEVAKHNSADDCWVVINGY-VYDLTRFVPNHPGGPDVIKYNAGRDVT 139

>SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 580

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 13  KEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
           ++VA H   +DCWV I    +YD+T+F+  +    +++ + AG D+T
Sbjct: 84  QDVAKHNDPKDCWVVIDGY-VYDLTEFIHSHPGGPTIIENNAGKDVT 129

>NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON} 
          Length = 609

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 4   AKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
           + T    S  EV  H    DCW+ I + ++YD+T F+  +     ++   AG D++
Sbjct: 89  SSTKSPISTDEVTKHNSENDCWIVI-NGQVYDLTSFMSIHPGGSDIIKLNAGKDVS 143

>TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON}
           Anc_2.536 YMR073C
          Length = 218

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 10  FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDY-AGTDITDE 61
            S+K VA H   +DCW  I   K+Y +T + + +   D +L ++ +G D T++
Sbjct: 143 ISEKMVAEHNTVDDCWC-IIKGKVYCITNYFEYHPGGDKILKNFCSGVDATEQ 194

>CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073c
          Length = 194

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 14  EVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLD-YAGTDIT 59
           E+A H   EDCW T+ + K+Y ++ +L  +     +L+D  +G D T
Sbjct: 123 ELARHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDST 168

>SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 564

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 14  EVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61
           EV  H   +DCW+ + +  +YD+T+F+  +    + L++ AG D T++
Sbjct: 92  EVKLHNNIDDCWI-VLNGDVYDITEFIKIHPGGAARLMEVAGRDATEK 138

>KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.304
           YML054C
          Length = 604

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 10  FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
            S  EVA H   +DCWV I    +Y++T+F+  +     ++   AG D+T
Sbjct: 92  ISPSEVAKHNTPDDCWVVIEGY-VYNLTEFIPTHPGGPMVIKSNAGKDVT 140

>ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 598

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 10  FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
            S  EVA H   +DCWV I    +YD+T+F   +    +++   AG D++
Sbjct: 84  ISPDEVAKHNSPDDCWVVIDGY-VYDLTEFAPVHPGGPTVIKSNAGKDVS 132

>ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa]
          {ON} conserved hypothetical protein
          Length = 190

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 1/55 (1%)

Query: 5  KTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
          + L   S  E+  H    DCW+ I  R +Y+V   L  +     +LL Y G D T
Sbjct: 25 EDLPSLSWDEIRKHMTPPDCWMVIHGR-VYNVAPVLASHPGGSQILLHYVGRDAT 78

>CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054c CYB2 lactate dehydrogenase cytochrome b2
          Length = 593

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 10  FSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
            S  EV  H   EDCWV I    +YD+T F+  +     ++   AG D+T
Sbjct: 90  ISPSEVIKHNTPEDCWVVIDGY-VYDLTNFIALHPGGPDIIKTNAGKDVT 138

>CAGL0H09966g Chr8 (973025..973576) [552 bp, 183 aa] {ON} some
           similarities with uniprot|P38231 Saccharomyces
           cerevisiae YBR047w
          Length = 183

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 51  LDYAGTDITDELVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFD 110
           L+YAG  +T +  N  + E  +  D+ NY+  Y A  D   + L  + HK  V  E D D
Sbjct: 48  LNYAGAVVTKK-SNIPMHEYRQLPDDSNYIEKYYAELDVFLQYLQTQLHKSYVDFENDPD 106

Query: 111 LATLVVELPPEEKLTIATNYDRDFKKHKFL 140
              LV +L    +L + +NYD +    K +
Sbjct: 107 --ELVFQLEKYIELQVRSNYDANKAGEKLV 134

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 38/90 (42%), Gaps = 13/90 (14%)

Query: 67  LDEKYKALDN---DNYLVG----YVATADEEQKLLTNKDH---KVEVTLEQDFDLATLVV 116
           LD  Y ++DN   DN  +     Y    D    LL+  DH   K+   L   FD  T + 
Sbjct: 241 LDSMYISMDNNQSDNIYISNDEKYSVVLDSGTSLLSAPDHYVSKIAGLLNATFDNTTHMY 300

Query: 117 ELPPEEKLTIATNYDRDFKKHKFLDLNKPL 146
            LP E  LT+   Y       KF+D N P+
Sbjct: 301 LLPSETDLTL---YKDMIINFKFMDFNVPI 327

>Kpol_1024.18 s1024 (60564..63068) [2505 bp, 834 aa] {ON}
           (60564..63068) [2505 nt, 835 aa]
          Length = 834

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 8/78 (10%)

Query: 22  EDCWVTIFSRKIYDVTKFLD-ENRDFDSLLLDYAGT-------DITDELVNGKLDEKYKA 73
           E C+  +FS+ +YD +K+ D E R  +S+L++   T       +  D  +N K + K + 
Sbjct: 405 EQCYSDLFSKYLYDRSKYFDIERRSLESILIEKTSTFNISHEKETRDRSLNNKFNNKLET 464

Query: 74  LDNDNYLVGYVATADEEQ 91
              DN   G ++ +   Q
Sbjct: 465 GVVDNNEFGSISKSKLSQ 482

>NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304
          Length = 602

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 14  EVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
           EVA H    DCW+ I +  +YD+T F+  +     ++   AG D+T
Sbjct: 93  EVARHNTPADCWIVI-NGVVYDLTSFIPVHPGGADIIKSNAGKDVT 137

>CAGL0L07216g Chr12 complement(801526..804102) [2577 bp, 858 aa]
           {ON} similar to uniprot|P33775 Saccharomyces cerevisiae
           YDL095w PMT1 mannosyltransferase or uniprot|P52867
           Saccharomyces cerevisiae YDL093w
          Length = 858

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 6/48 (12%)

Query: 308 GLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSW 355
           GL G  YY+   Y        P MRR   Y  EHH K Y LG  +T W
Sbjct: 560 GLTGTHYYESLAYEW------PLMRRGIGYWGEHHRKIYLLGNAVTWW 601

>TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {ON}
           Anc_4.304 YML054C
          Length = 584

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 13  KEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDIT 59
           KEV  H   +DCWV I    +YD++ F+  +    +++   AG D++
Sbjct: 81  KEVEKHNAPDDCWVVIDGY-VYDLSDFIPSHPGGPAVIRANAGKDVS 126

>Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON}
           complement(21978..22631) [654 nt, 218 aa]
          Length = 217

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 9   LFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDY-AGTDIT 59
           + +KK VA H   +DCW  I   K+Y ++ +   +   D +L++  +G D T
Sbjct: 142 MITKKMVAKHKDIDDCWC-IIRGKVYSISNYFKFHPGGDKILINQCSGRDCT 192

>TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa]
           {ON} Anc_1.180 YKL168C
          Length = 981

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 30/75 (40%), Gaps = 3/75 (4%)

Query: 285 CAPIYKTVFLLLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYK 344
           C  IY  + ++    W  A  +      ++ D CH  +H  K      + K  + EH+  
Sbjct: 879 CGIIYCNLLMIDEPLWKVAIASKDP---IFKDYCHQIVHTKKFQLIETKFKHINAEHNEN 935

Query: 345 NYELGYGITSWFWDK 359
             +  YGI  W  +K
Sbjct: 936 QKQTIYGILRWEPEK 950

>NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON}
           Anc_5.322 YDR303C
          Length = 769

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%)

Query: 75  DNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFDLATLVVELPPEEKLTIATNYDRDF 134
           DN + LV  V + + E+ L+  +   +   L+QD  L TL+ EL     LT  T     F
Sbjct: 512 DNTSLLVKKVISDNVERHLIRGEMPMIPPILQQDLHLITLIEELKNGISLTALTTLLEKF 571

Query: 135 KKHKFLDLNKPLLPQ 149
            K+  ++LN  L  Q
Sbjct: 572 NKNDPIELNGLLFTQ 586

>CAGL0M13101g Chr13 (1288111..1289136) [1026 bp, 341 aa] {ON}
           similar to uniprot|P35735 Saccharomyces cerevisiae
           YKL051w
          Length = 341

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 2/51 (3%)

Query: 295 LLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKN 345
           L P + ACAG+ G   GYV    C Y     + P  M   K  H+E  Y N
Sbjct: 59  LRPLFIACAGWQG--LGYVITIACEYFQRAGRWPFRMPNSKSPHVEAEYDN 107

>NCAS0G03820 Chr7 complement(706134..707171) [1038 bp, 345 aa] {ON} 
          Length = 345

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 13/64 (20%)

Query: 74  LDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQDFDLATLVVELPPEEKLTIATNYDRD 133
           LD +  ++G V + ++ Q++L + DH   +++E   DLA+L             T +D  
Sbjct: 26  LDQNYKVIGSVRSEEKGQEVLADFDHNANLSIEIVKDLASL-------------TAFDEV 72

Query: 134 FKKH 137
           FKKH
Sbjct: 73  FKKH 76

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.142    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,817,163
Number of extensions: 2083088
Number of successful extensions: 7403
Number of sequences better than 10.0: 112
Number of HSP's gapped: 7539
Number of HSP's successfully gapped: 112
Length of query: 377
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 266
Effective length of database: 40,753,473
Effective search space: 10840423818
Effective search space used: 10840423818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)