Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B027608.273ON79794082e-53
ZYRO0D06908g8.273ON7764720.021
SAKL0H16786g8.273ON7444680.083
Kwal_YGOB_YDR119W-A8.273ON7433650.26
Kpol_YGOB_YDR119W-A8.273ON7567640.30
KNAG0B020105.340ON68054640.80
CAGL0B01875g8.273ON7436601.5
ZYRO0A04070g3.222ON18136593.3
NOTE: 14 genes in the same pillar as KAFR0B02760 were not hit in these BLAST results
LIST: KAFR0B05440 Skud_4.380 Smik_4.364 YDR119W-A NCAS0B03770 TBLA0F03030 Suva_2.280 KLTH0G13442g TDEL0F04000 Ecym_4297 KLLA0F19371g KNAG0H03170 TPHA0A01740 NDAI0J01290

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B02760
         (79 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B02760 Chr2 (565868..566107) [240 bp, 79 aa] {ON} Anc_8.273...   161   2e-53
ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...    32   0.021
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    31   0.083
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    30   0.26 
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    29   0.30 
KNAG0B02010 Chr2 (383361..385403) [2043 bp, 680 aa] {ON} Anc_5.3...    29   0.80 
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    28   1.5  
ZYRO0A04070g Chr1 complement(325007..325552) [546 bp, 181 aa] {O...    27   3.3  

>KAFR0B02760 Chr2 (565868..566107) [240 bp, 79 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 79

 Score =  161 bits (408), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%)

Query: 1  MIFSKVLHQKNLKLQAIKSQIPKLNPKSGRAGGPWGLMEFKRQIVLIPGFLLTLSVLCFW 60
          MIFSKVLHQKNLKLQAIKSQIPKLNPKSGRAGGPWGLMEFKRQIVLIPGFLLTLSVLCFW
Sbjct: 1  MIFSKVLHQKNLKLQAIKSQIPKLNPKSGRAGGPWGLMEFKRQIVLIPGFLLTLSVLCFW 60

Query: 61 PFSIRAVHRVRHKDTSSMI 79
          PFSIRAVHRVRHKDTSSMI
Sbjct: 61 PFSIRAVHRVRHKDTSSMI 79

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score = 32.3 bits (72), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 1  MIFSKVLHQKNLKLQAIKSQIPKLNPKSGRAGGPWGLMEFKRQIVLIPGFLLTLSVLCFW 60
          M F++VL  +N  + A K    +++  S  AG  WGL+E +R       + ++LS++  W
Sbjct: 1  MFFTQVL--RNSAVSATKQAAKQISKSS--AGEQWGLLEARRLSRGAVEWAVSLSLILAW 56

Query: 61 PFSI 64
          P +I
Sbjct: 57 PAAI 60

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 30.8 bits (68), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 24/44 (54%)

Query: 24 LNPKSGRAGGPWGLMEFKRQIVLIPGFLLTLSVLCFWPFSIRAV 67
          L    GR G PW + E KR +  I  +  +++ +  WPF+++ +
Sbjct: 28 LRASHGRLGEPWAITEAKRLVPTIFLWGASMAAVLGWPFAVKKI 71

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 29.6 bits (65), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 9/33 (27%), Positives = 21/33 (63%)

Query: 35 WGLMEFKRQIVLIPGFLLTLSVLCFWPFSIRAV 67
          W ++E KR +  +  +  +++++  WPF +RA+
Sbjct: 40 WAVIEAKRIVPTVAMWATSMTIMLGWPFGVRAI 72

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 29.3 bits (64), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 2  IFSKVLHQKNLKL---QAIK-SQIPKLNPKSGRAGGPWGLMEFKRQIVLIPGFLLTLSVL 57
          +FS++L +   ++   QA++ +        +G  G  W + E KR    I G+  TL+ +
Sbjct: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60

Query: 58 CFWPFSI 64
            WPF I
Sbjct: 61 LSWPFII 67

>KNAG0B02010 Chr2 (383361..385403) [2043 bp, 680 aa] {ON} Anc_5.340
           YDR314C
          Length = 680

 Score = 29.3 bits (64), Expect = 0.80,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 26/54 (48%)

Query: 18  KSQIPKLNPKSGRAGGPWGLMEFKRQIVLIPGFLLTLSVLCFWPFSIRAVHRVR 71
           K ++P ++ KS +       + F   IV+IP  L TL    +W   IR   R+R
Sbjct: 86  KRRLPSISAKSRKENQQIKKLCFGLSIVMIPVMLNTLKERAYWADDIRLNRRLR 139

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 27.7 bits (60), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%)

Query: 29 GRAGGPWGLMEFKRQIVLIPGFLLTLSVLCFWPFSI 64
          GR G  W + E KR    + G+   L+V   WPF I
Sbjct: 32 GRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGI 67

>ZYRO0A04070g Chr1 complement(325007..325552) [546 bp, 181 aa] {ON}
           similar to uniprot|P38218 Saccharomyces cerevisiae
           YBR022W POA1 Phosphatase that is highly specific for
           ADP- ribose 1''-phosphate a tRNA splicing metabolite may
           have a role in regulation of tRNA splicing
          Length = 181

 Score = 27.3 bits (59), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 4   SKVLHQKNLKLQAIKSQIPKLNPKSGRAGGPWGLME 39
           + VLH+ +  L+  K ++PK+N  SG  G PWG  E
Sbjct: 128 NSVLHKLDKPLKDYKLEMPKIN--SGIFGVPWGETE 161

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.140    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,208,818
Number of extensions: 218434
Number of successful extensions: 697
Number of sequences better than 10.0: 8
Number of HSP's gapped: 697
Number of HSP's successfully gapped: 8
Length of query: 79
Length of database: 53,481,399
Length adjustment: 51
Effective length of query: 28
Effective length of database: 47,633,433
Effective search space: 1333736124
Effective search space used: 1333736124
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)