Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B027508.271ON83483444670.0
Skud_12.1608.271ON89389128940.0
NCAS0B050508.271ON92388828810.0
KNAG0G020708.271ON89987228810.0
YLR092W (SUL2)8.271ON89389428750.0
Smik_12.1518.271ON89388828580.0
Suva_10.1768.271ON89387428220.0
NDAI0B020208.271ON90587828190.0
Kpol_543.438.271ON86685627280.0
TDEL0F039808.271ON86785827260.0
TPHA0J008008.271ON91790227070.0
CAGL0L12342g8.271ON89189127050.0
Suva_4.554na 1ON85085527030.0
Smik_2.435na 1ON86387526960.0
YBR294W (SUL1)na 1ON85987826840.0
Skud_2.424na 1ON86386326760.0
SAKL0H16830g8.271ON86285826150.0
KLTH0G13486g8.271ON90288225600.0
ZYRO0C01452g8.271ON90688825470.0
KLLA0F19338g8.271ON89186725280.0
TPHA0A017608.271ON89383125220.0
Kwal_56.237598.271ON86187224960.0
AGR077C8.271ON84883324070.0
Ecym_42998.271ON87486322560.0
TBLA0F030508.271ON89750313931e-179
Ecym_7084na 2ON6895053173e-29
NDAI0B022108.99ON7065153164e-29
Suva_16.3228.99ON7424732961e-26
TBLA0C052708.99ON7764602932e-26
ZYRO0F04796g8.99ON7354862914e-26
YPR003C8.99ON7544732915e-26
Kpol_467.118.99ON7445182871e-25
NCAS0B048008.99ON7244792871e-25
KNAG0D023908.99ON7164922833e-25
KLTH0G16764g8.99ON7105262656e-23
KLLA0E14059g8.99ON7064962531e-21
SAKL0H08800gna 2ON6204692218e-18
CAGL0L09207g8.99ON7251472004e-15
SAKL0B03124g8.99ON7441521951e-14
TPHA0H007208.99ON7871671933e-14
TDEL0C012808.99ON7272181924e-14
Kwal_27.110398.99ON7261461862e-13
Smik_16.2418.99ON7441571818e-13
Skud_16.2868.99ON7451981782e-12
AGR213Cna 2ON6891791683e-11
Kwal_26.90328.732ON591118717.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B02750
         (834 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...  1725   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...  1119   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271   1114   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...  1114   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...  1112   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...  1105   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...  1091   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271   1090   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...  1055   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...  1054   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....  1047   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...  1046   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...  1045   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...  1043   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...  1038   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...  1035   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...  1011   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...   990   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...   985   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...   978   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   976   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   966   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   931   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   873   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   541   e-179
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   126   3e-29
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   126   4e-29
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   118   1e-26
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   117   2e-26
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   116   4e-26
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   116   5e-26
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...   115   1e-25
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   115   1e-25
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   113   3e-25
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...   106   6e-23
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...   102   1e-21
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    90   8e-18
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    82   4e-15
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    80   1e-14
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...    79   3e-14
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    79   4e-14
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    76   2e-13
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    74   8e-13
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    73   2e-12
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    69   3e-11
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    32   7.8  

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score = 1725 bits (4467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 834/834 (100%), Positives = 834/834 (100%)

Query: 1   MSNQHDTELTDFSNLDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDS 60
           MSNQHDTELTDFSNLDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDS
Sbjct: 1   MSNQHDTELTDFSNLDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDS 60

Query: 61  IFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFI 120
           IFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFI
Sbjct: 61  IFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFI 120

Query: 121 SDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMS 180
           SDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMS
Sbjct: 121 SDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMS 180

Query: 181 LQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGF 240
           LQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGF
Sbjct: 181 LQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGF 240

Query: 241 MTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAW 300
           MTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAW
Sbjct: 241 MTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAW 300

Query: 301 KWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTS 360
           KWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTS
Sbjct: 301 KWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTS 360

Query: 361 ETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYK 420
           ETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYK
Sbjct: 361 ETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYK 420

Query: 421 IVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCL 480
           IVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCL
Sbjct: 421 IVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCL 480

Query: 481 TGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGI 540
           TGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGI
Sbjct: 481 TGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGI 540

Query: 541 YFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDENSEILPTTKAGY 600
           YFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDENSEILPTTKAGY
Sbjct: 541 YFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDENSEILPTTKAGY 600

Query: 601 SVEVVSNHNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHF 660
           SVEVVSNHNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHF
Sbjct: 601 SVEVVSNHNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHF 660

Query: 661 DILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKKYLRRENYDEDNVDIEDRVI 720
           DILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKKYLRRENYDEDNVDIEDRVI
Sbjct: 661 DILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKKYLRRENYDEDNVDIEDRVI 720

Query: 721 DDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRN 780
           DDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRN
Sbjct: 721 DDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRN 780

Query: 781 FGFGTINNEYSDESIIMGHSSYHLTKDVDGIKAATGTNLPFFHIDIPNFNKWDI 834
           FGFGTINNEYSDESIIMGHSSYHLTKDVDGIKAATGTNLPFFHIDIPNFNKWDI
Sbjct: 781 FGFGTINNEYSDESIIMGHSSYHLTKDVDGIKAATGTNLPFFHIDIPNFNKWDI 834

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1119 bits (2894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/891 (62%), Positives = 673/891 (75%), Gaps = 64/891 (7%)

Query: 3   NQHDTELTDFS-------NLDDLEQEFNQYKKIELTISSTRQNEEVDS--KRQGKSD-KN 52
           N  + E+ DF        NLDDLE E++QYK  E     +  + E +S   R   +D K 
Sbjct: 8   NLEEVEIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKG 67

Query: 53  VKSSS---FDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFH 109
           VK S    FD          V  +EE+++++ +YY +S+R + T K   DY+KS+FPI +
Sbjct: 68  VKGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIIN 127

Query: 110 WLPHYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSK 169
           WLPHYN  WFI+DLIAGIT+GCVLVPQSMSYAQ+ATL  Q+GLYSSFIGA++YS FATSK
Sbjct: 128 WLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSK 187

Query: 170 DVCIGPVAVMSLQTAKVIARVQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRLGFL 228
           DVCIGPVAVMSLQTAKVIA VQ K P  DT IT   IATTLALLCGII+  VG LRLGFL
Sbjct: 188 DVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFL 247

Query: 229 VELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAV 288
           VELISLNAVAGFMTGSA NI+ GQVP LMGYN  VNTR +TYKV+I+TLKHLPDTKLDAV
Sbjct: 248 VELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAV 307

Query: 289 FGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFT 348
           FGLIPLFLL+ WKW C   GPRLN+R+  N KN R H+I+K  YFYAQ ++N IIIIVFT
Sbjct: 308 FGLIPLFLLYVWKWWCGTYGPRLNDRY--NSKNARLHKIVKWTYFYAQASRNGIIIIVFT 365

Query: 349 CISWAITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIA 408
           CI WAITRGK+S  RPIS+LGSVP GLK+V  F VPSGLM+KL P LP+SIIVLLLEHIA
Sbjct: 366 CIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIA 425

Query: 409 IAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLF 468
           I+KSFGRINDYK+VPDQE++AIG++NLLGTFF+AYPATGSFSRSALKAKCNVRTPLSGLF
Sbjct: 426 ISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLF 485

Query: 469 SGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTV 528
           SG+CVLLALYCLTGAFFYIPKATL AVIIHAVS+L+ASY+ T NFWKMNPLD  CF+VTV
Sbjct: 486 SGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTV 545

Query: 529 IITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDE 588
           +ITVFASIEDGIYFAMCWS A+LL KVAFP GKFLG++EI EV D  +  DS  ++   E
Sbjct: 546 LITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSE 605

Query: 589 NSEILPTTKAG------YSVEVVSNHNE--NTN-------------------YYTKWVPF 621
           N+  + T +         S + ++N ++   TN                   Y+TKW+PF
Sbjct: 606 NNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPF 665

Query: 622 DFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMR 681
           D  YT+ELNPD HI PPP  V+VYR+++S+TY+NCSRH++I+ DE+KR+T+RG++ +  +
Sbjct: 666 DHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRK 725

Query: 682 KSDRPWNDPGKWEPRVFIK--KYLRRENYD--------EDNVDIEDRVIDDRPFLKIICL 731
           KSDRPWNDPG WE   F+K  K+ +++  D         +++D E    D+RP LKI+CL
Sbjct: 726 KSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAER---DERPLLKILCL 782

Query: 732 DFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYS 791
           DFSQV+Q DATA+Q L DLRK++N+YADRQVEFHFVGIISPW+K+ L + GFGTIN EYS
Sbjct: 783 DFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYS 842

Query: 792 DESIIMGHSSYHLTK--------DVDGIKAATGTNLPFFHIDIPNFNKWDI 834
           DESI+ GH+SYH+ +        D   +  A+GTNLPFFHIDIP+F KWDI
Sbjct: 843 DESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score = 1114 bits (2881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/888 (62%), Positives = 663/888 (74%), Gaps = 72/888 (8%)

Query: 14  NLDDLEQEFNQYKKIELTIS--------------------STRQNEEVDSKRQGKSDKNV 53
           NLDDLE E++QYK  E   +                     T+QN +V    Q  +  N 
Sbjct: 41  NLDDLELEYDQYKVSETNNNDDVINNNNNNNNNNNNIPELETQQNLDV----QFSNTTNN 96

Query: 54  KSSSFDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPH 113
           K + +  I S      +P Y+E +++I DYY +S+R   T   + DY  S+FPI  WLPH
Sbjct: 97  KENQY-RIVSTVNPVIIPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPH 155

Query: 114 YNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCI 173
           YNLTWF SDLIAGITVGCVLVPQSMSYAQIATL  Q+GLYSSFIGAF YSLFATSKDVCI
Sbjct: 156 YNLTWFTSDLIAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCI 215

Query: 174 GPVAVMSLQTAKVIARVQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRLGFLVELI 232
           GPVAVMSL+TAKV+ +V  K P +D  ITA  +AT L+LLCGI+  GVG+LRLGFLVELI
Sbjct: 216 GPVAVMSLETAKVVTKVLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELI 275

Query: 233 SLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLI 292
           SLNAV GFMTGSALNI+ GQVPGLMGYNS+VNTRT+ YKVII+TLKHLPDTKLDAVFGLI
Sbjct: 276 SLNAVTGFMTGSALNILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLI 335

Query: 293 PLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISW 352
           PLFLL+ WKW CD +GP+L ++ F   KN RA+   K FYFYAQ  KNAIIIIVFT ISW
Sbjct: 336 PLFLLYLWKWWCDNMGPKLVDKWFPKNKNERANFYFKKFYFYAQAAKNAIIIIVFTAISW 395

Query: 353 AITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKS 412
           +ITRGK    RPIS+LG+VPKGLK+V    +P GL++KLAPELPAS+IVLLLEHIAIAKS
Sbjct: 396 SITRGKAKADRPISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKS 455

Query: 413 FGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGAC 472
           FGRINDYK+VPDQE++AIG+TNL+GTFF+AYPATGSFSRSALKAKC VRTPLSG+F+GAC
Sbjct: 456 FGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGAC 515

Query: 473 VLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITV 532
           VLLALYCLTGAFFYIPKATL AVII AVS+LIASYK T NFWKMNPLDC CFLVTV ITV
Sbjct: 516 VLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITV 575

Query: 533 FASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKL---------------- 576
           F+SIE+GIYFA+CWS A+LL KV FP GKFLG+IE+ EV+DG +                
Sbjct: 576 FSSIENGIYFAVCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYVDNSIESATTAEYSSAS 635

Query: 577 --VGDSSVLTSSDENSEILPTTKAGYSVEVVS---NHNENTNYYTKWVPFDFSYTKELNP 631
               D+   T   + +  +   K   +V V +   + N    YYTKWVPFD +YT+ELNP
Sbjct: 636 SPSSDNETDTKKIQKTSSISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNP 695

Query: 632 DAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPG 691
             +I PPPPGVIVYR+ DSFTY+NCSRH+D++FDE+KR T+RG+L +  +K+DRPWNDPG
Sbjct: 696 SVNILPPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPG 755

Query: 692 KWEPRVFIKKYLRRENY----DEDNVDIEDR--VIDDRPFLKIICLDFSQVSQIDATAIQ 745
           +WE   F+K    R+      +E  VD+ D   + D+RP LKI+CLDFSQV+QIDA+AIQ
Sbjct: 756 EWEAPQFLKNLFHRKKKNSTDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQ 815

Query: 746 CLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLT 805
            L DLRKS+N+YADRQVEFHF GI+SPW+K+ L N GFGTIN+E+SD SII GHSSYHLT
Sbjct: 816 SLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLT 875

Query: 806 K-----DVD--------------GIKAATGTNLPFFHIDIPNFNKWDI 834
           +     D D               + AATGTNLPFFHIDIP+F+KWD+
Sbjct: 876 RTLPDSDFDLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score = 1114 bits (2881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/872 (62%), Positives = 665/872 (76%), Gaps = 47/872 (5%)

Query: 8   ELTDFSNLDDLEQEFNQYKKIELTISSTRQNEEVDSKR----------QGKSDKNVKSSS 57
           E++   +LD+LE E++QYK  EL    T  + + D+ R          Q   D N+ S+S
Sbjct: 30  EVSSTPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSAS 89

Query: 58  FDSIFSLTQQQQ----VPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPH 113
            + +     +      +P+Y E ++T  +++ +SLR  FT     +YI S+FPI HWLPH
Sbjct: 90  IEELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPH 149

Query: 114 YNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCI 173
           YN+ WFI DLIAGITVGCVLVPQSMSYAQIATL PQ+GLYSSFIGAF YSLFATSKDVCI
Sbjct: 150 YNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCI 209

Query: 174 GPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELIS 233
           GPVAVMSL+TAK+IARV  + P+D D+    IATT ALLCG IA GVG LRLGFLVELIS
Sbjct: 210 GPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLVELIS 269

Query: 234 LNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIP 293
           LNAVAGFMTGSALNIISGQVP LMGY   VNTRT+TYKVI++TLKHLPDTKLDAVFGLIP
Sbjct: 270 LNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGLIP 329

Query: 294 LFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWA 353
           LF+L+ W+W C+  GP+L +R++  G   R + + K FYFYAQ +++ IIIIVFT ISW+
Sbjct: 330 LFILYFWRWWCNGYGPKLTDRYYPKGS--RGNFLWKKFYFYAQASRSGIIIIVFTAISWS 387

Query: 354 ITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSF 413
           ITR   S+ R IS+LG+VPKGLKDV    VP  L AK+APELPA++IVLLLEHIAI+KSF
Sbjct: 388 ITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAISKSF 447

Query: 414 GRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACV 473
           GRINDYK+VPDQE++AIG+TNL+GTFFHAYP TGSFSRSALKAKCNV+TPLSGLF+G+CV
Sbjct: 448 GRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTGSCV 507

Query: 474 LLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVF 533
           LLALYCLTGAFFYIPKATL AVIIH+VS+L+ASY  T NF+KMNPLD  CFL T+IITVF
Sbjct: 508 LLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIIITVF 567

Query: 534 ASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDE----- 588
           +SIE+GIYFA+CWS A+LLFKVAFP GKFLG++EI EV+DG+++ D+SV+ ++D+     
Sbjct: 568 SSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTDDCVSEF 627

Query: 589 --NSEILPTTKAGYSVEVVSNHNENT-----------NYYTKWVPFDFSYTKELNPDAHI 635
             N E       G S  +V +  ++T            YYTKWVPFD +YT+ELNPD  I
Sbjct: 628 GGNKEFSKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNPDVTI 687

Query: 636 KPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEP 695
           +PPPPGVIVYRM+DS+TY+N S H+DI+ DEIKR T+RG+L Q  +KSDRPWNDPG+W+P
Sbjct: 688 QPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPGEWKP 747

Query: 696 RVFIKKYL--RRENYDEDNVDIEDR----VIDDRPFLKIICLDFSQVSQIDATAIQCLYD 749
             F+   L  R+        D+E      V D+RP LK++CLDFSQV+Q+D+T++Q L D
Sbjct: 748 PKFLSNVLHWRKNKKKNQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVD 807

Query: 750 LRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTKDVD 809
           LRK+VN YADRQVEFHF GIISPWIK+ L   GFGT+N E+SDESII GHSSYHL K+  
Sbjct: 808 LRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLVKNTI 867

Query: 810 G-------IKAATGTNLPFFHIDIPNFNKWDI 834
           G       +K ATGTNLPFFHIDIP+F KWDI
Sbjct: 868 GDIENGYQVKTATGTNLPFFHIDIPDFKKWDI 899

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 1112 bits (2875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/894 (62%), Positives = 675/894 (75%), Gaps = 70/894 (7%)

Query: 3   NQHDTELTDFS-------NLDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGK-----SD 50
           N  + E+ DF        +LDDLE E++QYK  E   + T  +++++S    K     S 
Sbjct: 8   NFEEVEIPDFQETNNTVPDLDDLELEYDQYKNNE--NNDTFNDKDLESNSVAKHNAVNSS 65

Query: 51  KNVKSSSFD----SIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFP 106
           K VK S  D    S  SL     V  +EE ++++ +YY +S+R + T K    Y+KS+FP
Sbjct: 66  KGVKGSKIDYFNPSDVSL-YDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFP 124

Query: 107 IFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFA 166
           I +WLPHYN +WF +DLIAGIT+GCVLVPQSMSYAQ+ATL  Q+GLYSSFIGA+SYS FA
Sbjct: 125 IINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFA 184

Query: 167 TSKDVCIGPVAVMSLQTAKVIARVQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRL 225
           TSKDVCIGPVAVMSLQTAKVIA V  K P  D+ IT   IATTLALLCGII+  VG LRL
Sbjct: 185 TSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRL 244

Query: 226 GFLVELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKL 285
           GFLVELISLNAVAGFMTGSA NI+ GQVP LMGYNS VNTR +TYKV+I+TLKHLPDTKL
Sbjct: 245 GFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKL 304

Query: 286 DAVFGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIII 345
           DAVFGLIPLFLL+ WKW C   GPRLN+R+  N KNPR H+I+K  YFYAQ ++N IIII
Sbjct: 305 DAVFGLIPLFLLYVWKWWCGTYGPRLNDRY--NSKNPRLHKIIKWTYFYAQASRNGIIII 362

Query: 346 VFTCISWAITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLE 405
           VFTCI WAITRGK+   RPIS+LGSVP GLK+V  F VP GLM+KL P LPASIIVLLLE
Sbjct: 363 VFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLE 422

Query: 406 HIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLS 465
           HIAI+KSFGRINDYK+VPDQE++AIG++NLLGTFF+AYPATGSFSRSALKAKCNVRTPLS
Sbjct: 423 HIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLS 482

Query: 466 GLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFL 525
           GLFSG+CVLLALYCLTGAFFYIPKATL AVIIHAVS+L+ASY+ T NFWKMNPLD  CF+
Sbjct: 483 GLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFI 542

Query: 526 VTVIITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTS 585
           VTV+ITVFASIEDGIYFAMCWS A+L+ KVAFP GKFLG++E+ EV D  +  DS V++ 
Sbjct: 543 VTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSY 602

Query: 586 SDENSEILPTTKAG------YSVEVVSNHNE--NTN-------------------YYTKW 618
             EN+  + T + G       S + V+N ++   TN                   Y+TKW
Sbjct: 603 VSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKW 662

Query: 619 VPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQ 678
           +PFD  YT+ELNPD  I PPP GV+VYR+++S+TY+NCSRH++I+ +E+K+ T+RG+L +
Sbjct: 663 IPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIR 722

Query: 679 IMRKSDRPWNDPGKWEPRVFIKK---YLRRENYDED-------NVDIEDRVIDDRPFLKI 728
             +KSDRPWNDPG WE   F+K    + +REN  E        +VD+E    DDRP LKI
Sbjct: 723 HRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVER---DDRPLLKI 779

Query: 729 ICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINN 788
           +CLDFSQV+Q DATA+Q L DLRK++N+YADRQVEFHFVGIISPW+K+ L + GFGT+N 
Sbjct: 780 LCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNE 839

Query: 789 EYSDESIIMGHSSYHLTKDVDG--------IKAATGTNLPFFHIDIPNFNKWDI 834
           EYSDESI+ GH+SYH+ +   G        +  A+GTNLPFFHIDIP+F KWDI
Sbjct: 840 EYSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/888 (61%), Positives = 662/888 (74%), Gaps = 58/888 (6%)

Query: 3   NQHDTELTDFSN-------LDDLEQEFNQYKKIELTISSTRQNEEVDSKRQ------GKS 49
           N  + E+ DF +       LDDLE E++QYK  E   +    + E +S  +      GK 
Sbjct: 8   NLEEVEIPDFQDTSNTVPDLDDLELEYDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKG 67

Query: 50  DKNVKSSSFDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFH 109
            K  K   F+          V  +EE+++++ +YY +S+R + T K   DY+KS+FPI +
Sbjct: 68  AKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIIN 127

Query: 110 WLPHYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSK 169
           WLPHYN  WF +DLIAGIT+GCVLVPQSMSYAQ+ATL  Q+GLYSSFIGA+SYS FATSK
Sbjct: 128 WLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSK 187

Query: 170 DVCIGPVAVMSLQTAKVIARVQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRLGFL 228
           DVCIGPVAVMSLQTAKVIA V  K P  D  IT   IATTLALLCGII+  +G LRLGFL
Sbjct: 188 DVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFL 247

Query: 229 VELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAV 288
           VELISLNAVAGFMTGSA NI+ GQVP LMGYNS VNTR +TYKV+I+TLKHLPDTKLDAV
Sbjct: 248 VELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAV 307

Query: 289 FGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFT 348
           FGLIPLFLL+ WKW C   GP LN+R+  N KNPR H+I+K  YFYAQ ++N +II+VFT
Sbjct: 308 FGLIPLFLLYVWKWWCGTYGPILNDRY--NSKNPRLHKILKWTYFYAQASRNGVIIVVFT 365

Query: 349 CISWAITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIA 408
           CI WAITRGK+   RPIS+LGSVP GLK+V  F VPSGLM+KL P LPASIIVLLLEHIA
Sbjct: 366 CIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIA 425

Query: 409 IAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLF 468
           I+KSFGRINDYK+VPDQE++AIG++NLLGTFF+AYPATGSFSRSALKAKCNVRTPLSGLF
Sbjct: 426 ISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLF 485

Query: 469 SGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTV 528
           SG+CVLLALYCLTGAFFYIPKATL AVIIHAVS+L+ASY+ T NFWKMNPLD  CF+VTV
Sbjct: 486 SGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTV 545

Query: 529 IITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDE 588
           +ITVFASIEDGIYFAMCWS A+LL K+AFP GKFLG++EI EV D  +  +S  ++ + E
Sbjct: 546 LITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSE 605

Query: 589 NSEILPTTKAGYSVEVVSNHNENTN---------------------------YYTKWVPF 621
           N+  + T++ G   E  S+    TN                           Y+TKWVPF
Sbjct: 606 NNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPF 665

Query: 622 DFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMR 681
           D  YT+ELNPD  I PPP GV+VYR+++S+TY+NCSRH++I+ +++K  T+RG+L +  +
Sbjct: 666 DHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRK 725

Query: 682 KSDRPWNDPGKWEPRVFIKK---YLRRENYDEDNVDIEDRVI----DDRPFLKIICLDFS 734
           KSDRPWNDPG WE   F+K    + +RE+  E   +  D  I    DDRP LKI+CLDFS
Sbjct: 726 KSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFS 785

Query: 735 QVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDES 794
           QV+Q DATA+Q L DLRK +N+YADRQVEFHFVGIISPW+K+ L + GFGT+N EYSDES
Sbjct: 786 QVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDES 845

Query: 795 IIMGHSSYHLTK--------DVDGIKAATGTNLPFFHIDIPNFNKWDI 834
           I+ GH+SYH+ +        D   +  A+GTNLPFFHIDIP+F KWDI
Sbjct: 846 IVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1091 bits (2822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/874 (61%), Positives = 655/874 (74%), Gaps = 51/874 (5%)

Query: 10  TDFSNLDDLEQEFNQYKKIELTISSTRQNEEVDS------KRQGKSDKNVKSSSFDSIFS 63
           T   +LDDLE E++QYK  E   +    + E +S        + K  K  K   F++   
Sbjct: 22  TTVPDLDDLELEYDQYKNNENNGAFNDNDLESNSLTNHNTASEAKGVKGSKVEYFNTSDI 81

Query: 64  LTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDL 123
                 V  ++E +++  +YY +S+R + T K   +Y+KS+FPI +WLPHYN+ WFI+DL
Sbjct: 82  SLYDNSVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYLKSVFPIIYWLPHYNVNWFIADL 141

Query: 124 IAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQT 183
           IAGIT+GCVLVPQSMSYAQ+ATL  Q+GLYSSFIGA++YS FATSKDVCIGPVAVMSLQT
Sbjct: 142 IAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQT 201

Query: 184 AKVIARVQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMT 242
           AKVIA V  + P  DT IT   IATTLALLCGII+  VG LRLGFLVELISLNAVAGFMT
Sbjct: 202 AKVIADVTARYPDGDTTITGPIIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMT 261

Query: 243 GSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKW 302
           GSA NI+ GQVP LMGYN  VNTR +TYK++ID+LKHLPDT LDA FGLIPLF+L+ WKW
Sbjct: 262 GSAFNILWGQVPALMGYNKLVNTRVATYKIVIDSLKHLPDTTLDAAFGLIPLFILYTWKW 321

Query: 303 VCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSET 362
            C   GPRLN+R   N K PR H+I+K   FYAQ ++N IIIIVFTCI+WAITRGK+S  
Sbjct: 322 WCGTYGPRLNDRF--NSKKPRLHKIVKWTCFYAQASRNGIIIIVFTCIAWAITRGKSSAD 379

Query: 363 RPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIV 422
           RPIS+LGSVP GLK+V  F VP GLM+KL P LPASIIVLLLEHIAI+KSFGR+NDYK+V
Sbjct: 380 RPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRVNDYKVV 439

Query: 423 PDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTG 482
           PDQE++AIG++NLLGTFF+AYPATGSFSRSALKAKCNVRTPLSGLFSG+CVLLALYCLTG
Sbjct: 440 PDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTG 499

Query: 483 AFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIYF 542
           AFFYIPKATL AVIIHAVS+L+ASY+ T NFWKMNPLD  CF+VTV+ITVF+SIE+GIYF
Sbjct: 500 AFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFSSIENGIYF 559

Query: 543 AMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDENSEILPTTKA---- 598
           AMCWS A+ + KVAFP GKFLG++EI EV D  +  DS  ++ + EN+  + T +     
Sbjct: 560 AMCWSCAIFILKVAFPAGKFLGRVEIAEVTDAYVRADSDSVSFTSENNNRISTLEEDGVG 619

Query: 599 -----------------------GYSVEVVSNHNENTNYYTKWVPFDFSYTKELNPDAHI 635
                                  G+     S       Y+TKW+PFD  YTKELNPD +I
Sbjct: 620 EKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPRIKYHTKWLPFDHKYTKELNPDVNI 679

Query: 636 KPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEP 695
            PPP GV+VYR+++S+TY+NCSRH++++ DEIK+ T+RG+L +  +KSDRPWNDPG WEP
Sbjct: 680 LPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRRGQLIRHRKKSDRPWNDPGPWEP 739

Query: 696 RVFIK--KYLRRENYD----EDNV-DIEDRVIDDRPFLKIICLDFSQVSQIDATAIQCLY 748
             F K  K+ +++  D    E+ V +  D V DDRP LKI+CLDFSQV+Q DATA+Q L 
Sbjct: 740 PTFFKNLKFWKKKETDIESSENAVNNPTDAVRDDRPLLKILCLDFSQVAQTDATALQSLV 799

Query: 749 DLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHL---- 804
           DLRK++N+YADRQVEFHFVGIISPW+K+ L + GFGT+N EYSDESI+ GH+SYH+    
Sbjct: 800 DLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVARVP 859

Query: 805 ----TKDVDGIKAATGTNLPFFHIDIPNFNKWDI 834
               T D   +  A+GTNLPFFHIDIP+F KWDI
Sbjct: 860 QNEETPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/878 (62%), Positives = 660/878 (75%), Gaps = 56/878 (6%)

Query: 10  TDFSNLDDLEQEFNQYKKIELTISSTR------QNEEV---DSKRQGKSDKNVKSSSFDS 60
           T   NL DLE E++QYK  E    S         N +V   ++   G    ++K+     
Sbjct: 31  TSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDKKNSIKNHQIQI 90

Query: 61  IFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFI 120
                    +P++EE++I+  DYY +SL+  F+ K++ +Y  S+FPI  WLPHYNL WF 
Sbjct: 91  NTFNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFS 150

Query: 121 SDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMS 180
           SDLIAGITVGCVLVPQSMSYAQIATL PQ+GLYSSFIGAF+YSLFATSKDVCIGPVAVMS
Sbjct: 151 SDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMS 210

Query: 181 LQTAKVIARVQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAG 239
           L+T KVI +V  K P +D +ITA  IAT LA LCG+I  G+G LRLGFLVELISLNAV G
Sbjct: 211 LETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVTG 270

Query: 240 FMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFA 299
           FMTGSALNI+ GQ+P LMGY S+VNTRTSTYKVII++LKHLPDTKLDAVFGLIPLF+L+ 
Sbjct: 271 FMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILYL 330

Query: 300 WKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKT 359
           WKW C  +GPR+ ++ F N  N + +  +K FYFYAQ  KNA+IIIVFT I+W+IT+GKT
Sbjct: 331 WKWWCGNMGPRMADKWFAN--NEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSITKGKT 388

Query: 360 SETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDY 419
            + RPIS+LGSVPKGLK+V    +P GL +K+APELPAS+IVLLLEHIAIAKSFGRINDY
Sbjct: 389 KDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFGRINDY 448

Query: 420 KIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYC 479
           K+VPDQE++AIG+TNL+GTFF+AYPATGSFSRSALKAKC VRTPLSGLF+G+CVLLALYC
Sbjct: 449 KVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVLLALYC 508

Query: 480 LTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDG 539
           LTG F YIPKATL AVIIHAVS+LIASY  T NFWKMNPLDCF F+VTV ITVF+SIE+G
Sbjct: 509 LTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFIVTVFITVFSSIENG 568

Query: 540 IYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLT-------------SS 586
           IYFAMCWS A+L+ KVAFP GKFLG++EI EV++G  V DS  +T             + 
Sbjct: 569 IYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNG-CVDDSFEVTDYSSNSNLSLSADTI 627

Query: 587 DENSE-------ILPTTKAGYSVEVVSNHNENT-NYYTKWVPFDFSYTKELNPDAHIKPP 638
           + N +       +L T K     ++ S   ++   YYTKW+PFD +YTKELNP+  I PP
Sbjct: 628 NHNKKLKILHIPLLKTLKDQLFSDISSIQGKSKIRYYTKWLPFDHAYTKELNPNVIILPP 687

Query: 639 PPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVF 698
           PPGVIVYR+ DSFTYMNCS+H+D++F+EIK+ TKRG+L +  +KSDRPWNDPG+WE   F
Sbjct: 688 PPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDPGEWEAPNF 747

Query: 699 IKKY----LRRENYDEDNV-----DIEDRVIDDRPFLKIICLDFSQVSQIDATAIQCLYD 749
            K +     RR   + DN      D+     DDRP LK++CLDFSQV+Q+DATA+Q L D
Sbjct: 748 SKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVAQVDATALQSLVD 807

Query: 750 LRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTK--- 806
           LRK++NKYADRQVEFHF GI+SPWIKK L N GFGTIN EYSDESII GH+SYHL +   
Sbjct: 808 LRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIAGHTSYHLARIPG 867

Query: 807 -DVD---------GIKAATGTNLPFFHIDIPNFNKWDI 834
            D++          +  ATGTNLPFFHIDIP+F +WD+
Sbjct: 868 DDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score = 1055 bits (2728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/856 (60%), Positives = 642/856 (75%), Gaps = 47/856 (5%)

Query: 22  FNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSF---------DSIFSLTQQ----- 67
           +NQYK +E   +S   +   +       D   K S F         D    LT++     
Sbjct: 15  YNQYKTVEEQGNSDVGDSSGNDDLGNAGDGLTKDSKFVFEKDLGYTDDSNELTRESFLNS 74

Query: 68  -QQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAG 126
            + VP Y E ++T+ +YY +S+R Y TFK+  +Y+ S+FPI  WLP YN  W ISDLIAG
Sbjct: 75  SENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDLIAG 134

Query: 127 ITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKV 186
           IT+GCVLVPQSMSYAQIATL PQ+GLYSSF+GA++YSLFATSKDVCIGPVAVMSLQTAKV
Sbjct: 135 ITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQTAKV 194

Query: 187 IARVQDKLPSD--TDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGS 244
           I  V   L  +  T ITA  IATTLALLCGII+ GVGLLRLGFLVELISLNAV GFMTGS
Sbjct: 195 IQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFMTGS 254

Query: 245 ALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVC 304
           ALNIISGQVP LMGY SEVNTR +TYKVII+TLKHLPDTK+DA+FGLIPL +L+ WKW  
Sbjct: 255 ALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWKWWF 314

Query: 305 DVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRP 364
             +GP+L +R++ N K     + +K FYFY    ++ IIIIV T ISW++TRGK+   RP
Sbjct: 315 SSMGPKLVDRYYPNSK---YKKYIKAFYFYGNAMRSGIIIIVMTSISWSVTRGKSKSERP 371

Query: 365 ISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVPD 424
           IS+LG+VP GL++V  FT P+GL+AK+APELP+SIIVLLLEHIAIAKSFGR+NDYK+VPD
Sbjct: 372 ISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKVVPD 431

Query: 425 QEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAF 484
           QE++AIGI+NL+GTFF++YP TGSFSRSALKAKCNV+TPLSG+F+G+CVLLALYCLTGAF
Sbjct: 432 QELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLTGAF 491

Query: 485 FYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIYFAM 544
           FYIPKATL AVIIHAVS+L+ASYK T +FWKMNPLD  CF+ TV ITVFASIEDGIYF M
Sbjct: 492 FYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIYFTM 551

Query: 545 CWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDENS-----EILPTTKAG 599
           CWS A+LLFKVAFP GKFLG ++I E+++ ++V DS  L    E S      ++   K  
Sbjct: 552 CWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIV-DSDYLVEKAETSVQYSTVLMNPEKGE 610

Query: 600 YSVEVVSNHNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRH 659
            S     +      Y+ KW+P+D +YTKE+NP+  + PPP GVIVYR+ +SFTY+NCSR+
Sbjct: 611 LSYLSSKSSESQLKYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLTESFTYINCSRN 670

Query: 660 FDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIK---KYLRRENYDEDNVDIE 716
           ++ L+D++K  T+ G+L   ++KSDRPWNDPG W+P  F+K    + + +N D++    +
Sbjct: 671 YETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLKNIINWRKNKNKDDEPTTFD 730

Query: 717 DRVIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKK 776
           ++V+D RP LKIICLDFSQV+Q D+TA+Q L DLR+++NKYADRQVEFHF GI+SPW+KK
Sbjct: 731 NKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFHFSGILSPWVKK 790

Query: 777 SLRNFGFGTINNEYSDESIIMGHSSYHLTKDVD------------------GIKAATGTN 818
            L N GFGT+N EYSDESII+GH+SYH+ K  D                   I A TGTN
Sbjct: 791 GLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNSSYYIHAGTGTN 850

Query: 819 LPFFHIDIPNFNKWDI 834
            PFFHI+IP+F+KW+I
Sbjct: 851 FPFFHIEIPDFSKWNI 866

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score = 1054 bits (2726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/858 (60%), Positives = 639/858 (74%), Gaps = 43/858 (5%)

Query: 14  NLDDLEQEFNQYKKIE-LTISSTRQNEEVDSKRQGKSDKNVKSSSFDSIFSLTQQQ---Q 69
            LDDLE E++ YK  E L  +    N   D     K    VK +      S   +     
Sbjct: 16  KLDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETEVRYYGSPGPEAIGGN 75

Query: 70  VPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITV 129
           +P +EE+++++ DYY   +R   T  +   Y+ SLFPI  W PHYNLTW  +DL+AGITV
Sbjct: 76  IPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITV 135

Query: 130 GCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIAR 189
           GCVLVPQSMSYAQIA+L PQ+GLYSSFIGAF YSLFATSKDVCIGPVAVMSLQTAKVIA+
Sbjct: 136 GCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQ 195

Query: 190 VQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNI 248
           V  K P +D  +TA  IAT L+LLCGI+A GVGLLRLGFLVELISLNAVAGFMTGSA NI
Sbjct: 196 VSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNI 255

Query: 249 ISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCDVLG 308
           + GQVP LMGY+S+VNTR STYKV+ID+LKHLPDTKLDAVFGL+PL LL+ WKW C   G
Sbjct: 256 LWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYG 315

Query: 309 PRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVL 368
           P+L +R   +  +P+  RI+K FYFY+   +NA+IIIVFT ISW IT+ K  E RPI VL
Sbjct: 316 PKLADRQLAH--SPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVL 373

Query: 369 GSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVPDQEIV 428
           G+VP GL+DV    +P GL+AK+AP++PASIIVLLLEHIAI+KSFGRINDYK+VPDQE++
Sbjct: 374 GTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELI 433

Query: 429 AIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIP 488
           AIG TNL+GTFF+AYPATGSFSRSALKAKC VRTP SG+F+G CVL+A+YCLT AFF+IP
Sbjct: 434 AIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIP 493

Query: 489 KATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIYFAMCWSV 548
            ATL AVIIHAVS+L+ASYK T NFWKMNPLDC  F+VTV+ITVF+SIE+GIYFAMCWS 
Sbjct: 494 SATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSC 553

Query: 549 AVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDE------NSEILPTTKAGYSV 602
           A+LL K AFP G+FLG++E+ EV++  +V D   ++ +D+       S+ L   K   S 
Sbjct: 554 AMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQIEGSVGKSKSLKADKGAISA 613

Query: 603 EVVSNHNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDI 662
              SN+     +++KWV   ++Y +ELNPD  I PPPPGV+VYRM+DSFTY+NCSRH+D 
Sbjct: 614 SSGSNY----KFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDT 669

Query: 663 LFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKKYLRRENYDEDNVDIEDRVI-- 720
           +FD IK+ T+RG+L  + +KSDRPWNDPG+WE    IKK+ +    ++++++ +D  +  
Sbjct: 670 IFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAI 729

Query: 721 ----DDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKK 776
               D+RP LKIICLDFSQV Q+D+TAIQ L DLRK+V+KYADRQVEFHF GIIS W+K+
Sbjct: 730 DNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKR 789

Query: 777 SLRNFGFGTINNEYSDESIIMGHSSYHLTKDVD--------------------GIKAATG 816
           SL + GFGT+N  YSDESII GHSSYH+ K                        I AATG
Sbjct: 790 SLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDSSGSSQLQQSQEIYAATG 849

Query: 817 TNLPFFHIDIPNFNKWDI 834
           TN+PFFH+DIP+F+KWD+
Sbjct: 850 TNMPFFHLDIPDFSKWDL 867

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score = 1047 bits (2707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/902 (59%), Positives = 641/902 (71%), Gaps = 75/902 (8%)

Query: 6   DTELTDFSN-----LDDLEQEFNQYKKIE--------LTISSTRQNEEVDSKRQGKSDKN 52
           + EL+ +SN     L+ LE+E++QYKK E           SS  QN  V S  + +  K 
Sbjct: 18  NIELSSYSNSNTVDLEALEEEYDQYKKEEEIEYISGNYLNSSPTQNINVTSNPKYEEYKK 77

Query: 53  VK----SSSFDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIF 108
           +K    S ++ S   L     +P + EN IT  +YY +SL+ YFTF    +Y  S+FPI 
Sbjct: 78  LKHLDQSYNYVSTEYLDTDYLIPAHNENIITFKEYYNHSLKEYFTFNAAKNYALSIFPII 137

Query: 109 HWLPHYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATS 168
           HWLP YN  WFISDLIAGIT+GCVLVPQSMSYAQIATL PQ+GLYSSFIGAF Y+LFATS
Sbjct: 138 HWLPFYNFNWFISDLIAGITIGCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYALFATS 197

Query: 169 KDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFL 228
           KDVCIGPVAVMSL+TAKVIA V     +D D+T   IATTLALLCG IA  VG LRLGFL
Sbjct: 198 KDVCIGPVAVMSLETAKVIADVSSHFQNDPDVTGPIIATTLALLCGGIAAAVGFLRLGFL 257

Query: 229 VELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAV 288
           VELISLNAV GFMTGSA NI+ GQVPGLMGY+  VNTR +TYKV+IDTLKHLPDTKLDAV
Sbjct: 258 VELISLNAVTGFMTGSAFNILWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPDTKLDAV 317

Query: 289 FGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFT 348
           FGLIPLF+L+  KW C   G +L E+ F +  N R    +K FYFY    +NA++II+FT
Sbjct: 318 FGLIPLFILYVVKWWCTNYGLQLAEKQFSS--NERYRFYLKKFYFYTNAMRNAVVIIIFT 375

Query: 349 CISWAITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIA 408
            ISW+ITR K+S  RPI+VLG+VP GLKD+  F   + ++ K+ P+LPASIIVLLLEHIA
Sbjct: 376 AISWSITRNKSSSERPITVLGTVPSGLKDIGVFKPQTKIVQKIGPQLPASIIVLLLEHIA 435

Query: 409 IAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLF 468
           IAKSFGRINDYKIVPDQE++AIGI+NL+GTFF AYPATGSFSRSAL AKCNV+TPLSG+F
Sbjct: 436 IAKSFGRINDYKIVPDQELIAIGISNLVGTFFSAYPATGSFSRSALNAKCNVKTPLSGIF 495

Query: 469 SGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTV 528
           +G CVLLALYCLTGAFFYIPKATL AVIIHAVS+LIASY+ T++FW MNPLD  CFLVTV
Sbjct: 496 TGGCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCFLVTV 555

Query: 529 IITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSV-----L 583
           +ITVF+SIE+GIYFAMC+S A+ +F+ AFP GKFLG+IEI EV++     D  +      
Sbjct: 556 LITVFSSIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEVINATPKDDFQMDNFNGF 615

Query: 584 TSSDENSEILPTTKAGYSVEVVSNHNENT-----NYYTKWVPFDFSYTKELNPDAHIKPP 638
            +S+ N+     +   + +   + H  N+     N+YTKWVPFD +YTKELN D  I  P
Sbjct: 616 ETSEYNNFPADQSYGKFDIANKNTHKYNSPHCSKNFYTKWVPFDHTYTKELNKDVEILEP 675

Query: 639 PPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWE-PRV 697
           PPGVIVYR++DSF Y+NCSRHFD +FDE+KR TKRGK    ++KS RPWNDPG+WE P  
Sbjct: 676 PPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRGKFIGNIKKSQRPWNDPGEWEAPTW 735

Query: 698 FIKKY-----LRRENYDEDNVDIEDRV------------IDDRPFLKIICLDFSQVSQID 740
             KK+      +R+   E NV  ED              +D RP L++ICLDFSQVSQ D
Sbjct: 736 MTKKFSIRNLFKRKQEAESNVPNEDASTDLDISNNKDIDMDHRPVLQVICLDFSQVSQTD 795

Query: 741 ATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHS 800
            TA+Q L+DLRKSVN YADRQVEFHF GIISPW+K+ L   GFGT+N  YSD S I+GH 
Sbjct: 796 NTALQSLFDLRKSVNSYADRQVEFHFCGIISPWVKRGLIKLGFGTVNEAYSDASTIVGHV 855

Query: 801 SYHLTKDVD----------------------------GIKAATGTNLPFFHIDIPNFNKW 832
           SYH+ K+                               I+AA+GTN PFFHIDIPNF+KW
Sbjct: 856 SYHIVKNPTFRNKSFSSHTSEDTISDMNIEAKDYNNYSIEAASGTNYPFFHIDIPNFSKW 915

Query: 833 DI 834
           D+
Sbjct: 916 DV 917

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score = 1046 bits (2705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/891 (59%), Positives = 648/891 (72%), Gaps = 74/891 (8%)

Query: 15  LDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDSIFSLTQQQQVPTYE 74
           LD+LE E+NQ+K  E     +  N   D ++   + K  + S  D+     +   +P+YE
Sbjct: 4   LDNLELEYNQFKNNE---RPSNTNAGADIEKGLDTKKYFERSITDNSTYGKKSYSIPSYE 60

Query: 75  ENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLV 134
           E++IT+ DYY  +LR YFT+ ++ DYI+SLFP+ +WLP YN  WF+SDLIAGITVG VLV
Sbjct: 61  EDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLV 120

Query: 135 PQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKL 194
           PQSMSYAQIATL P++GLYSSFIGA  YS FATSKDVCIGPVAVMSLQTAKVIARV++K 
Sbjct: 121 PQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKH 180

Query: 195 PS-DTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQV 253
           P  D  IT   IAT LA +CGIIATGVGLLRLGFLVELISLNAVAGFMTGSA NII GQ+
Sbjct: 181 PDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQI 240

Query: 254 PGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCDVLGPRLNE 313
           PGLMGY+ +VNTR STY V+ID+LKHLPDTKLDA FGLIPLF LF WKW C+ +GP+L +
Sbjct: 241 PGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTD 300

Query: 314 RHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSVPK 373
           R+F     PRA++  K FYFY Q ++N IIII+FT +S+ IT+G   + R ISVLG+VPK
Sbjct: 301 RYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVPK 360

Query: 374 GLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVPDQEIVAIGIT 433
           GL+      +P G++  +A E+P+SIIVLLLEHIAI+KSFGR+NDYKI P+QEI+AIG++
Sbjct: 361 GLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIGVS 420

Query: 434 NLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLC 493
           NLLGTFF+AYPATGSFSRSALKAKCNV TPLSG+FS ACVLLA+YCLTGAFFYIPKATL 
Sbjct: 421 NLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLS 480

Query: 494 AVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIYFAMCWSVAVLLF 553
           AVIIHAV +LIASY  T + WKMN  D   F+ TV ITVF+SIE+GIYFA+CWS A+LL+
Sbjct: 481 AVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLY 540

Query: 554 KVAFPPGKFLGQIEITEVLDGKLVGDSSV-LTSSDEN--------------------SEI 592
             AFP GKFLG+IEI EV++ K+V D      +S+E+                    S  
Sbjct: 541 NNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLGTSSND 600

Query: 593 LPTTKAGYSVEVVSNH------NENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYR 646
           L    AG     ++        + +  YYTKWVPFD +Y+KELNP   I PPPPGVIVYR
Sbjct: 601 LKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPGVIVYR 660

Query: 647 MADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEP----RVF-IKK 701
           ++DS+TY+NCSRH+D++FDEIKR T+RG+L Q   K DRPWNDPG+WE     + F +KK
Sbjct: 661 LSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLKKFFNVKK 720

Query: 702 YL---RRENYDEDNVDIEDRV-------------IDDRPFLKIICLDFSQVSQIDATAIQ 745
           ++   +R+  D D  + E+ +              D+RP L+++CLDFSQV+  DATA+Q
Sbjct: 721 FVSVFKRKVTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANTDATALQ 780

Query: 746 CLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLT 805
            L DLRK+VNKYADRQVEFHFVGI SPWIK+ LRN GFGT N EYSDESII GHSSYHL+
Sbjct: 781 SLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYHLS 840

Query: 806 K----DVDG------------------IKAATGTNLPFFHIDIPNFNKWDI 834
           +    + DG                  + AA+GTNLPFFH+DIP+F+KWDI
Sbjct: 841 RFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score = 1045 bits (2703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/855 (60%), Positives = 643/855 (75%), Gaps = 52/855 (6%)

Query: 14  NLDDLEQEFNQYKKIELTI----SSTRQNEEVDSKRQGKSDKNVKSS-SFDSIFSLTQQQ 68
           N++  + +++ Y++ E       S   Q+ +V+  R+ +  K   S  S+DSI       
Sbjct: 14  NIEIFDSKYSSYRESEAAANRDDSHNEQSWKVNGNRKFEHTKTESSDVSYDSI------- 66

Query: 69  QVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGIT 128
             P YEE+++T+ +YY +S++   T K+  +Y+ SLFPI  WLPHYN TW  +DL+AGIT
Sbjct: 67  --PRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVAGIT 124

Query: 129 VGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIA 188
           VGCVLVPQSMSYAQIA+LSP++GLYSSF+GAF YSLFATSKDVCIGPVAVMSLQTAKVIA
Sbjct: 125 VGCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 184

Query: 189 RVQDKLPSD-TDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALN 247
            V  K P D T++T   IAT L LLCGI+ T +G+LRLGFLVELISLNAVAGFMTGSA +
Sbjct: 185 EVLKKYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTGSAFS 244

Query: 248 IISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCDVL 307
           II GQVP LMGYN  VNTR STYKV+I+TLKHLP+TKLDAVFGLIPL +L+ WKW C   
Sbjct: 245 IIWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWWCGTY 304

Query: 308 GPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISV 367
           G  L  RH+ N  +P+    +K+FYFYAQ  +NA++I+VFT ISW+ITR K SE RPIS+
Sbjct: 305 GITLANRHYQN--HPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASEDRPISI 362

Query: 368 LGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVPDQEI 427
           LG+VP GL +V    +P GL++ ++ ELPASIIVL+LEHIAI+KSFGRINDYK+VPDQE+
Sbjct: 363 LGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVVPDQEL 422

Query: 428 VAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYI 487
           +AIG+TNL+GTFFH+YPATGSFSRSALKAKCNVRTP SGLF+G CVLLALYCLT AFF+I
Sbjct: 423 IAIGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTDAFFFI 482

Query: 488 PKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIYFAMCWS 547
           PKATL AVIIHAVS+L+ SY+ T  FWK NPLDC  F+VTV ITVF+SIE+GIYFAMCWS
Sbjct: 483 PKATLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYFAMCWS 542

Query: 548 VAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDENSEILPTTKAGYSVEVVSN 607
            A+LL K AFP G+FLG++E+ E+L+  L  + S + S +E+++ + TT     V+V+  
Sbjct: 543 CAILLLKQAFPAGRFLGRVEVAEILNPTLQNNVSAVVSLNESNKQVKTT-----VDVL-- 595

Query: 608 HNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEI 667
            +    + TKWVPFD  Y++ELN  A I PPPPGVIVYR++DSFTY+NCSRH+DI+FD +
Sbjct: 596 RSSEYRFTTKWVPFDHEYSRELNRCAKICPPPPGVIVYRLSDSFTYVNCSRHYDIIFDHV 655

Query: 668 KRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKKYLR--RENYDEDNV-----DIEDRVI 720
           K  T+RG+L  + +KSDRPWNDPG+W+    +K   R  R++  E+          +R  
Sbjct: 656 KEETRRGQLVNLRKKSDRPWNDPGEWKMPTSLKTLFRFKRKSVTENEEPSVSNGSTNRGS 715

Query: 721 DDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRN 780
            ++P LK+ICLDFSQV+Q+D+TAIQ L DLRK+VNKYADRQVEFHF GIISPWIK+SL +
Sbjct: 716 YEKPLLKVICLDFSQVAQVDSTAIQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLSS 775

Query: 781 FGFGTINNEYSDESIIMGHSSYHLTK-----DVD----------------GIKAATGTNL 819
             FGT+N EYSDES+I GHSS H+TK     D D                 + AATGTNL
Sbjct: 776 VDFGTVNEEYSDESVIAGHSSVHVTKFSSDDDADYTDEESHISAPYSNYGTLCAATGTNL 835

Query: 820 PFFHIDIPNFNKWDI 834
           PFFHIDIP+F+KWDI
Sbjct: 836 PFFHIDIPDFSKWDI 850

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score = 1043 bits (2696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/875 (58%), Positives = 652/875 (74%), Gaps = 53/875 (6%)

Query: 1   MSNQHDTELT--------DFSNLDDLEQEFNQYKKIELTISST--RQNEEVDSKRQGKSD 50
           MS ++ + +T        D ++++  E E+  Y++ E   +    + ++  D K   K +
Sbjct: 1   MSGKYSSHVTSTEVSDKQDDADIEVFESEYRTYREAEAAENREEIQNDDNQDWKVPSKLN 60

Query: 51  KNVKSSSFDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHW 110
             + +S    +F       +P YEEN++T+ DYY ++++   T K+   Y+ SLFPI  W
Sbjct: 61  LELTNSKVSEVF----YDSIPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKW 116

Query: 111 LPHYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKD 170
           LPHYN TW  +DL+AGITVGCVLVPQSMSYAQIA+LSP++GLYSSFIGAF YSLFATSKD
Sbjct: 117 LPHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKD 176

Query: 171 VCIGPVAVMSLQTAKVIARVQDKLPSD-TDITASEIATTLALLCGIIATGVGLLRLGFLV 229
           VCIGPVAVMSLQTAKVIA V  K P D  ++T   IATTL LLCG++ATG+G+LRLGFLV
Sbjct: 177 VCIGPVAVMSLQTAKVIAEVLKKYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLV 236

Query: 230 ELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVF 289
           ELISLNAVAGFMTGSA +II GQ+P LMGYN  VNTR +TYKV+I+TLKHLP+TKLDAVF
Sbjct: 237 ELISLNAVAGFMTGSAFSIIWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVF 296

Query: 290 GLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTC 349
           GLIPL +L+ WKW C   G +L +RH+ N   P+    +K+FYFYAQ  +NA++IIVFT 
Sbjct: 297 GLIPLVILYLWKWWCGSFGIKLVDRHYSN--QPKTANRIKSFYFYAQAMRNAVVIIVFTA 354

Query: 350 ISWAITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAI 409
           IS+ ITR K+ E RPIS+LG+VP GL +V    +P GL++ ++ ELPASIIVL+LEHIAI
Sbjct: 355 ISFRITRNKSKEKRPISILGTVPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAI 414

Query: 410 AKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFS 469
           +KSFGRINDYK++PDQE++AIG+TNL+GTFFH+YPATGSFSRSALKAKCNVRTP SG+F+
Sbjct: 415 SKSFGRINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFT 474

Query: 470 GACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVI 529
           GACVLLALYCLT AFFYIPKATL AVIIHAVS+L+ASY+ T NFWKMNPLDC  F+VTV+
Sbjct: 475 GACVLLALYCLTSAFFYIPKATLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVL 534

Query: 530 ITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDEN 589
           ITVF+SIE+GIYFAMCWS A+LL K AFP GKFLG++E+ EVL+  + G    + S +E+
Sbjct: 535 ITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTIQGHIDSIVSPNES 594

Query: 590 SEILPTTKAGYSVEVVSNHNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMAD 649
                + +   SV+ +   +    +  KWVPFD +YT+ELN    ++PPPPGVIVYR +D
Sbjct: 595 PNEF-SKQVKSSVDALP--SSEYKFSVKWVPFDHAYTRELNSYTRVRPPPPGVIVYRFSD 651

Query: 650 SFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWE-PRVF-----IKKYL 703
           SFTY+NCSRH+D++FD IK  T+RG+L  + +KSDRPWNDPG+W+ P  F     +K+ L
Sbjct: 652 SFTYVNCSRHYDVIFDRIKEETRRGQLVSLRKKSDRPWNDPGEWKLPNSFKNIFRVKRGL 711

Query: 704 RRENYD----EDNVDIEDRVIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYAD 759
             +N +     DN + E     ++P LK++CLDFSQV+Q+D+TA+Q L DLRK+VNKYAD
Sbjct: 712 ATKNSELPAVNDNTNSESY---EKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYAD 768

Query: 760 RQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTK------------- 806
           RQVEFHF GIISPWIK+SL +  FGTIN E+SD SII GHSS+H+ K             
Sbjct: 769 RQVEFHFAGIISPWIKRSLLSVKFGTINEEFSDTSIITGHSSFHIAKVLKDEVDYTDEDS 828

Query: 807 -------DVDGIKAATGTNLPFFHIDIPNFNKWDI 834
                  + D + AATGTNLPFFHIDIP+F+KWD+
Sbjct: 829 PISVTCSNYDTLCAATGTNLPFFHIDIPDFSKWDV 863

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score = 1038 bits (2684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/878 (58%), Positives = 643/878 (73%), Gaps = 76/878 (8%)

Query: 3   NQHDTELTDFSNLDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDSIF 62
           NQ D ++  F      E E+  Y++ E         E  D    G  ++N K +S    F
Sbjct: 12  NQEDADIEVF------ESEYRTYRESEAA-------ENRDGLHNG-DEENWKVNSSKQKF 57

Query: 63  SLTQQQ-------QVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYN 115
            +T+ +        +P YEE+++T+ +YY +S++   T K+   Y+ SLFPI  W PHYN
Sbjct: 58  GVTKNELSDVLYDSIPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYN 117

Query: 116 LTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGP 175
            TW  +DL+AGITVGCVLVPQSMSYAQIA+LSP++GLYSSFIGAF YSLFATSKDVCIGP
Sbjct: 118 FTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGP 177

Query: 176 VAVMSLQTAKVIARVQDKLPSD-TDITASEIATTLALLCGIIATGVGLLRLGFLVELISL 234
           VAVMSLQTAKVIA V  K P D T++TA  IATTL LLCGI+ATG+G+LRLGFLVELISL
Sbjct: 178 VAVMSLQTAKVIAEVLKKYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISL 237

Query: 235 NAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPL 294
           NAVAGFMTGSA NII GQ+P LMGYNS VNTR +TYKV+I+TLKHLP+TKLDAVFGLIPL
Sbjct: 238 NAVAGFMTGSAFNIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPL 297

Query: 295 FLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAI 354
            +L+ WKW C   G  L +R++ N   P+    +K+FYFYAQ  +NA++I+VFT ISW+I
Sbjct: 298 VILYVWKWWCGTFGITLADRYYRN--QPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSI 355

Query: 355 TRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFG 414
           TR K+S+ RPIS+LG+VP GL +V    +P GL++ ++ E+PASIIVL+LEHIAI+KSFG
Sbjct: 356 TRNKSSKDRPISILGTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFG 415

Query: 415 RINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVL 474
           RINDYK+VPDQE++AIG+TNL+GTFFH+YPATGSFSRSALKAKCNVRTP SG+F+G CVL
Sbjct: 416 RINDYKVVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVL 475

Query: 475 LALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFA 534
           LALYCLT AFF+IPKATL AVIIHAVS+L+ SYK T  FWK NPLDC  F+VTV ITVF+
Sbjct: 476 LALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFS 535

Query: 535 SIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDE------ 588
           SIE+GIYFAMCWS A+LL K AFP GKFLG++E+ EVL+  +  D   + SS+E      
Sbjct: 536 SIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEDIDAVISSNELPNELN 595

Query: 589 -----NSEILPTTKAGYSVEVVSNHNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVI 643
                  E+LP  +  +SV              KWVPFD  Y++ELN +  ++PPPPGVI
Sbjct: 596 KQVKSTVEVLPAPEYKFSV--------------KWVPFDHGYSRELNINTTVRPPPPGVI 641

Query: 644 VYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIK--- 700
           VYR+ DSFTY+NCSRH+DI+FD IK  T+RG+L  + +KSDRPWNDPG+W+    +K   
Sbjct: 642 VYRLGDSFTYVNCSRHYDIIFDRIKEETRRGQLITLRKKSDRPWNDPGEWKMPDSLKSLF 701

Query: 701 KYLRRENYDEDNVDIEDRVID----DRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNK 756
           K+ R       ++ I +   +    ++P LK++CLDFSQV+Q+D+TA+Q L DLRK+VN+
Sbjct: 702 KFKRHSATTNSDLPISNGSSNGETYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNR 761

Query: 757 YADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTK----DVD--- 809
           YADRQVEFHF GIISPWIK+SL +  FGT N EYSD+SII GHSS+H+ K    DVD   
Sbjct: 762 YADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTD 821

Query: 810 -------------GIKAATGTNLPFFHIDIPNFNKWDI 834
                         + AATGTNLPFFHIDIP+F+KWD+
Sbjct: 822 EDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWDV 859

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score = 1035 bits (2676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/863 (58%), Positives = 641/863 (74%), Gaps = 43/863 (4%)

Query: 1   MSNQHDTELTDFSNLDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDS 60
           + NQ DT++  F      E E+  Y++ E   +  R N +    +  K +   K     S
Sbjct: 15  LDNQEDTDIEVF------ESEYRTYRESEA--AENRDNFQNGDDQSWKINGKQKYEVTKS 66

Query: 61  IFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFI 120
             S      +P YEE+++T+ +YY +S++   T K+  DY+ SLFPI  WLPHYN TW  
Sbjct: 67  EVSDVAYDSIPAYEESTVTLKEYYDHSIKSSLTVKSAGDYLYSLFPIIKWLPHYNFTWGY 126

Query: 121 SDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMS 180
           +DL+AGITVGCVLVPQSMSYAQIA+LSP++GLYSSFIGAF YSLFATSKDVCIGPVAVMS
Sbjct: 127 ADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMS 186

Query: 181 LQTAKVIARVQDKLPS-DTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAG 239
           LQTAKVIA V  K P   T++T   IAT L  LCG+++T +G+LRLGFLVELISLNAVAG
Sbjct: 187 LQTAKVIAEVLKKYPEGQTEVTGPIIATALCFLCGVVSTALGVLRLGFLVELISLNAVAG 246

Query: 240 FMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFA 299
           FMTGSA +II GQ+P LMGYNS VNTR +TYKV+I+TLKHLP+TKLDAVFGLIPL +L+ 
Sbjct: 247 FMTGSAFSIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYV 306

Query: 300 WKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKT 359
           WKW C   G  L +R++ N   P+    +K+FYFYAQ  +NA++IIVFT ISW ITR K+
Sbjct: 307 WKWWCGTFGITLADRYYRN--QPKIANRLKSFYFYAQAMRNAVVIIVFTAISWRITRNKS 364

Query: 360 SETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDY 419
           S+ RPIS+LG+VP GL +V    +P GL++ ++ ELPASIIVL+LEHIAI+KSFGRINDY
Sbjct: 365 SKERPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDY 424

Query: 420 KIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYC 479
           K++PDQE++AIG+TNL+GTFFH+YPATGSFSRSALKAKCNVRTP SG+F+GACVLLALYC
Sbjct: 425 KVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGIFTGACVLLALYC 484

Query: 480 LTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDG 539
           LT AFF+IPKATL AVIIHAVS+L+ SYK T  FWK NPLDC  F+ TV ITVF+SIE+G
Sbjct: 485 LTSAFFFIPKATLSAVIIHAVSDLLTSYKTTWIFWKTNPLDCISFIATVFITVFSSIENG 544

Query: 540 IYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDE-NSEILPTTKA 598
           IYFAMCWS A+LL K AFP GKFLG++E+ EVL+  +    + +TSS+E  +E+    K+
Sbjct: 545 IYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEGINAVTSSNELPNELSKQVKS 604

Query: 599 GYSVEVVSNHNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSR 658
              V     +     +  KW+PFD  Y++ELN    ++PPPPGVIVYR+ADSFTY+NCSR
Sbjct: 605 TVDVLPAPEY----KFSVKWIPFDHDYSRELNRYTKVRPPPPGVIVYRLADSFTYVNCSR 660

Query: 659 HFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWE-PRVF--IKKYLRRENYDEDNVDI 715
           H+DI+FD IK  T+RG+L  + +KSDRPWNDPG+W+ P  F  + K+ R+    ++ + +
Sbjct: 661 HYDIIFDRIKEETRRGQLISLRKKSDRPWNDPGEWKMPNSFKALFKFKRKSATTDNELPV 720

Query: 716 E----DRVIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIIS 771
                ++   ++P LK++CLDFSQV+Q+D+TA+Q L DLRK+VNKYADRQVEFHF GIIS
Sbjct: 721 SSGRNNQESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIIS 780

Query: 772 PWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTK----DVD----------------GI 811
           PWIK+SL +  FGT N EYSD+SII GHSS+H+ K    DVD                 +
Sbjct: 781 PWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTEEDSRISTSYSNYETL 840

Query: 812 KAATGTNLPFFHIDIPNFNKWDI 834
            AATGTNLPFFHIDIP+F+KWD+
Sbjct: 841 CAATGTNLPFFHIDIPDFSKWDV 863

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 1011 bits (2615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/858 (58%), Positives = 641/858 (74%), Gaps = 38/858 (4%)

Query: 4   QHDTELTDFS--NLDDLEQEFNQYKKIELTISSTRQNEEV-------DSKRQGKSDKNVK 54
           +H++  +DF+  NLDDLE E++ YK  E    + R+  +V         +   K  KN  
Sbjct: 16  EHNS--SDFAEPNLDDLEAEYDNYKNAE---QNPREKSDVVETLPPTTHQNDAKGLKNDG 70

Query: 55  SSSFDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHY 114
            ++ +   + +    +P Y E+++   DYY  SL    +F +  +Y+ SLFP+  W+PHY
Sbjct: 71  QTTVELYGTTSSGGVIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHY 130

Query: 115 NLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIG 174
           N  W   D++AG+TVGCVLVPQSMSYAQIA+L  Q+GLYSSFIGAF YS FATSKDVCIG
Sbjct: 131 NFAWMYGDVVAGVTVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIG 190

Query: 175 PVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISL 234
           PVAVMSL+TAKVIARV + LP DT+IT   IAT L+LLCG I  G+G+LRLGFLVELISL
Sbjct: 191 PVAVMSLETAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISL 250

Query: 235 NAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPL 294
           NAVAGFMTGSA +II+GQ+P LMGYN +VNTR +TYKV+I+TLKHLPDTKLDAVFGLIPL
Sbjct: 251 NAVAGFMTGSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPL 310

Query: 295 FLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAI 354
            +L+ WK+ C+ +GP   +R   N  +PRA +  K+F+FYAQ  +NA +I++FT I+W I
Sbjct: 311 LILYLWKYGCNTIGPNWVDRRM-NPHSPRA-KFWKSFFFYAQALRNAFVIVLFTLIAWGI 368

Query: 355 TRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFG 414
           TR K  +  PIS+L +VP GLK+V     P  L   LAPELPA+ I+LLLEHIAIAK+FG
Sbjct: 369 TRHK--KKHPISLLNTVPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFG 426

Query: 415 RINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVL 474
           RINDYK+VPDQE++AIG+TNL+GTFF+AYPATGSFSRSALKAKCNVRTPLSG+F+GACVL
Sbjct: 427 RINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVL 486

Query: 475 LALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFA 534
           LALYCLT AF+YIPKATL AVIIHAVS+LIASY+ T NFWKMNPLDC CFLVTV IT+F+
Sbjct: 487 LALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFS 546

Query: 535 SIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSD-ENSEIL 593
           SIE+GIYFA+CWS A+LLFK+AFP GKFLG++E++EV++  +  D  V+   D EN  + 
Sbjct: 547 SIENGIYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVA 606

Query: 594 PTTKAGYSVEV----VSNHNENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMAD 649
            +TK    +      +S       ++TKW+P + +Y +E N    ++PPPPGVIVYR ++
Sbjct: 607 SSTKPKLGLSADNSSISTGPSRVRFHTKWIPLENNYGREYNSGIVVQPPPPGVIVYRPSE 666

Query: 650 SFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKKYLRRENYD 709
           S+TY+NCSR +DI+FDE+KR T+RG +    +KSDRPWNDPG+WEP +F+KK  +R    
Sbjct: 667 SWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPLFLKKLFKRGKRL 726

Query: 710 EDNVDIE-DRVIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVG 768
           E  +  E  R  D+RP LKI+ +D+SQV+QIDAT +Q L DLRK++NKYADRQVEFHF G
Sbjct: 727 EQELSPELGR--DERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSG 784

Query: 769 IISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTKDVD------------GIKAATG 816
           IISPWIK++L   GFGT+N+E++DES+I+GHSSYH+ K                I AA+G
Sbjct: 785 IISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQDEENHIGQGRYNISAASG 844

Query: 817 TNLPFFHIDIPNFNKWDI 834
           TN+PFFH+++P+F+KW +
Sbjct: 845 TNMPFFHVEMPDFSKWSL 862

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score =  990 bits (2560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/882 (55%), Positives = 630/882 (71%), Gaps = 73/882 (8%)

Query: 14  NLDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDSIFSLTQQQQ---- 69
           +LDDL+ E+ Q+K  E + ++  ++   +   Q  ++   +  S     S   + +    
Sbjct: 29  DLDDLDAEYGQFKNAEHSDATAGRDLTSEYGAQFAAEFGGEPGSGSGSGSGFPEAKPVAP 88

Query: 70  -----VPT----YEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFI 120
                VP+    + E  +T+ ++Y+ +LR  FT  T T+Y++SL PI  WLPHYN  W  
Sbjct: 89  AAPGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLY 148

Query: 121 SDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMS 180
            DL+AGITVGCVLVPQSMSYAQIATLSPQ+GLYSSF+GAF YS FATSKDVCIGPVAVMS
Sbjct: 149 QDLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMS 208

Query: 181 LQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGF 240
           LQTAK I+ V   LP DT+IT+  IAT LALLCGII+ G+G+LRLGFLVELIS  AVAGF
Sbjct: 209 LQTAKAISHVVSSLPEDTEITSPMIATALALLCGIISLGLGVLRLGFLVELISSTAVAGF 268

Query: 241 MTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAW 300
           MTGSALNII+GQVP LMGYN  VNTRTSTYKVII++L+HLPDTKLDAVFGL+PL +L+ W
Sbjct: 269 MTGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVW 328

Query: 301 KWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTS 360
           KW C   GPRL +R+       R  R+  N + Y Q  +NA++I+VFT I+W ++     
Sbjct: 329 KWGCSTGGPRLVQRY-----GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALK 383

Query: 361 E--TRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRIND 418
           E  +  IS+LG+VP GLKDV    VPSGL++K+APELPAS+IVL+LEHIAI+K+FGR+ND
Sbjct: 384 EGGSARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVND 443

Query: 419 YKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALY 478
           Y++VPDQE++AIG TNL+GTFF+AYPATGSFSRSALKAKCNV TPLSGLFSGACVLLA+Y
Sbjct: 444 YRVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIY 503

Query: 479 CLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIED 538
           CLT AF +IPKATL AVIIHAVS+LIASYK T +FW+++P D  CFLVTV+ITVF+SIE+
Sbjct: 504 CLTSAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIEN 563

Query: 539 GIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVL-----DGKLVGDSS------------ 581
           GIYFAMCWSVAVLLF+ AFP GKFLG+++I E        G  VG SS            
Sbjct: 564 GIYFAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGAGVGMSSGNSAGTAVNREK 623

Query: 582 ----VLTSSDENSEILPTTKAGYSVEVVSNHNEN----------------TNYYTKWVPF 621
                 T+   +SE L  T  G +    S   +                   ++TKWVPF
Sbjct: 624 ERETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPF 683

Query: 622 DFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMR 681
           D  YT+ELNP+  + PPPPGVIV+R ++S+TY+NCSR +D +FDE+ R T+RG+   + +
Sbjct: 684 D-RYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAK 742

Query: 682 KSDRPWNDPGKWEPRVFIKKYLRRENYDEDNVDIEDRVI--DDRPFLKIICLDFSQVSQI 739
            S RPWNDPG+W P  F++K      +   + D+E+R +  D+RP L++I +D+SQV+Q+
Sbjct: 743 SSSRPWNDPGEWHPPKFLRKL-----FKSSSEDLENRAVARDERPVLRVIAMDWSQVAQV 797

Query: 740 DATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGH 799
           D+T +Q L DLRK+VNKYADRQVEFHF GII PW+K+ L N GFGT+N+E++DES+++GH
Sbjct: 798 DSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGH 857

Query: 800 SSYHLTKDVDGIK--------AATGTNLPFFHIDIPNFNKWD 833
            S H+ +  +  +         ATGTNLPFFH+++P+F++WD
Sbjct: 858 KSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWD 899

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/888 (56%), Positives = 643/888 (72%), Gaps = 63/888 (7%)

Query: 4   QHDTELTDFSNLDDLEQEFNQYKKIE--LTISSTRQNEEVDSKRQGKSD-KNVKSSSFDS 60
           + + EL++ SNLDDLEQE++QYK  E    +     +E  D  R+GK D K  +   ++S
Sbjct: 25  ESEVELSEVSNLDDLEQEYDQYKAAEDRERVVGRGDDEYDDDLRKGKVDYKETELEYWNS 84

Query: 61  IFSLTQ----QQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNL 116
               T     +  VP+YEE  +   D + + L+   T   +  Y +S FPI  WLP YN 
Sbjct: 85  TNGTTNLLAPKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIKWLPFYNW 144

Query: 117 TWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPV 176
            W  +DL+AGITVGCVLVPQSMSYAQIATL PQ+GLYSSF+GAF YS FATSKDVCIGPV
Sbjct: 145 KWGYADLVAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSKDVCIGPV 204

Query: 177 AVMSLQTAKVIARVQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLN 235
           AVMSL+TAKVI    +K P  D ++T   IAT LALLCGI+A G G+LRLGFLVELISLN
Sbjct: 205 AVMSLETAKVIQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAGVLRLGFLVELISLN 264

Query: 236 AVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLF 295
           AVAGFMTGS+LNIISGQVP LMG+   V+TR STYK+II++LK+L  T+LDAVFGLIPL 
Sbjct: 265 AVAGFMTGSSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAVFGLIPLV 324

Query: 296 LLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAIT 355
           LL+ WKW C   GP+L +RHF N  NP+   I+K FYFYAQ  ++A+IIIVFT IS+ IT
Sbjct: 325 LLYTWKWWCSSYGPKLADRHFKN--NPKKRDILKTFYFYAQAMRSAVIIIVFTAISYGIT 382

Query: 356 RGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGR 415
           +G+  +T  ISVLG VPKGLKDV    +P GL++K+   +P++II+LLLEHI+IAKSFGR
Sbjct: 383 KGR--KTPRISVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIAKSFGR 440

Query: 416 INDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLL 475
           +N+YK+VPDQE++AIG TNL+GTFF+AYPATGSFSRSALKAKCNVRTPLSG+FSGACVLL
Sbjct: 441 VNNYKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFSGACVLL 500

Query: 476 ALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFAS 535
           ALYCLT  F+YIP ATL AVIIHAVS+L ASYK + NF+KMNP D   F+VTV ITVF+S
Sbjct: 501 ALYCLTQTFYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFITVFSS 560

Query: 536 IEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDENSEILPT 595
           I+ GIYFAMCWS A+ L K  F PG+FLG++E+ EV++ ++  D +V + S+     L  
Sbjct: 561 IDYGIYFAMCWSAAMFLLKNMFAPGRFLGRVEVAEVVNAQV--DPNVESVSESAGSHLDG 618

Query: 596 TKAGYSVE-------------VVSNH--------NENTN--------YYTKWVPFDFSYT 626
            +A  S+E             V SN+        + N N        Y+TKW+ +D SY+
Sbjct: 619 FQAQSSIESSSKKLDPLDKSAVHSNYLNGGDDGSDNNINNQIGQKLVYHTKWISYDRSYS 678

Query: 627 KELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRP 686
           +E NP+  I+PPPPGVIVYR  DS+TY+NCSRH+DI++DE++R+T+RG++   ++K DRP
Sbjct: 679 REFNPEVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRGQMISAVKKVDRP 738

Query: 687 WNDPGKWE-PRVFIKKYLRRENYDE-------DNVDIEDRVIDDRPFLKIICLDFSQVSQ 738
           WNDPG+WE PR F K   +++  +E       ++   E ++ D+RP LKIICLDFSQ SQ
Sbjct: 739 WNDPGEWEAPRWFKKLTSKKKTAEEWAETEAQESKAAEQKLQDNRPLLKIICLDFSQCSQ 798

Query: 739 IDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMG 798
            DATAIQ L DLRK VN+YADRQVEFH  G+ +PW+K++L NFGFGT+N EYSDES++ G
Sbjct: 799 TDATAIQNLTDLRKQVNRYADRQVEFHICGLYAPWVKRALVNFGFGTVNEEYSDESLLAG 858

Query: 799 HSSYHLTKD----VDGIKA--------ATGTNLPFFHIDIPNFNKWDI 834
           H SYH+ +      DG+ +        A+GTNLPFFH++IP+F+KWD+
Sbjct: 859 HRSYHVARAPTSLEDGLGSPAQYSVYPASGTNLPFFHVEIPDFSKWDL 906

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/867 (56%), Positives = 627/867 (72%), Gaps = 51/867 (5%)

Query: 14  NLDDLEQEFNQYKKIEL---------TISSTRQNEEVDSKRQGKS--DKNV----KSSSF 58
           + D LEQE++  K  E+         +ISS+ ++  +   R   S  D N     K  + 
Sbjct: 30  DFDQLEQEYDDLKTSEIIAPHISNGHSISSSPRHHHLYEDRHLDSIIDTNTHGFKKHDNG 89

Query: 59  DSIFSLTQQQQ--------VPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHW 110
           +  F+    +Q        VP YEE  +     Y   LRPY TF  I +Y+ SLFP+  W
Sbjct: 90  NGKFADVNIEQIYNYDSLRVPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKW 149

Query: 111 LPHYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKD 170
           + HYN  W  +DL+AGITVGCVLVPQSMSYAQIATL  Q+GLYSSF+GAF YS FATSKD
Sbjct: 150 VHHYNFNWLYNDLVAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKD 209

Query: 171 VCIGPVAVMSLQTAKVIARVQDKLPSDT-DITASEIATTLALLCGIIATGVGLLRLGFLV 229
           VCIGPVAVMSL+TAKVIARV +K+  D  +ITA  IATTL+L+CG +A GVGLLRLGFLV
Sbjct: 210 VCIGPVAVMSLETAKVIARVLEKVGEDNPEITAPIIATTLSLICGGVALGVGLLRLGFLV 269

Query: 230 ELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVF 289
           E ISLNAVAGFMTGSA+NI+SGQVPGLMGY+  VNTR STYKVII+TLKHLPDTKLDAVF
Sbjct: 270 EFISLNAVAGFMTGSAINIMSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDAVF 329

Query: 290 GLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTC 349
           GLIPLF+L++WK+ C  LGP+L +R+       RA    K   FY Q  +NA +II+FT 
Sbjct: 330 GLIPLFILYSWKYFCGTLGPKLVDRYVARSDVKRA-AAYKYILFYLQALRNAFVIIIFTL 388

Query: 350 ISWAITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAI 409
           ISW ITR K  E  PIS+LG+VP GLK+V    +P GL++ LA ELP++II+L+LEHIAI
Sbjct: 389 ISWGITRHKAKEDLPISLLGTVPSGLKNVGVMKLPDGLVSNLASELPSAIIILVLEHIAI 448

Query: 410 AKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFS 469
           +K+FGR+N YK+VPDQE++AIG+TNL+ TFF+AYPATGSFSRSALKAKCNV+TPLSG+F+
Sbjct: 449 SKAFGRVNGYKVVPDQELIAIGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPLSGIFT 508

Query: 470 GACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVI 529
           GACVLL+LYCLT AF++IPKA L A+IIHAVS+L+ASYK T NFW MNPLD  CF+VTVI
Sbjct: 509 GACVLLSLYCLTDAFYFIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTVI 568

Query: 530 ITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGD-SSVLTSSDE 588
           IT+F+SIE+GIYFA+CWS A+LL KV FP G+FLG +EI +V + ++  +   ++ S D 
Sbjct: 569 ITIFSSIENGIYFAVCWSCALLLLKVVFPTGQFLGYVEICQVSNAEVDENIDRIVLSEDS 628

Query: 589 NSEILP--TTKAGYSVEVVSNHNEN-----TNYYTKWVPFDFSYTKELNPDAHIKPPPPG 641
             + +    TK   +V+V    NE+       Y+TKW+P +  Y +ELNPD  ++ PPPG
Sbjct: 629 QPKTIEDNVTKNNTAVKVGVVANESFGHSQLQYHTKWLPLNNHYQRELNPDVVVQAPPPG 688

Query: 642 VIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKK 701
           VIVYR ++S+TY+NCSR +D +FD +K  T+ GKL + + K D+ WNDPG+WEP   +KK
Sbjct: 689 VIVYRPSESWTYVNCSRQYDTIFDRVKELTRPGKLLKHVSKHDKMWNDPGEWEPPFLVKK 748

Query: 702 YLRRENYDEDNVDIE-DRVIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADR 760
             +  N      D+E   VID+RP LKI+ +D+SQV+QID+T +Q L DLRK++NKYA+R
Sbjct: 749 LFKLGNKH----DLEGGEVIDERPVLKILAMDWSQVTQIDSTGVQNLVDLRKAINKYANR 804

Query: 761 QVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTKDVDGIK-------- 812
           QVEFHF GIISPWIK+SL N GFGT+N E+SDESII+GH+SY L K+   ++        
Sbjct: 805 QVEFHFSGIISPWIKRSLINAGFGTVNEEFSDESIIVGHTSYSLVKNRPDLQDPEAALPE 864

Query: 813 -----AATGTNLPFFHIDIPNFNKWDI 834
                 A G NLPFFH+++P F+KW +
Sbjct: 865 PIALHTALGVNLPFFHLEMPEFHKWHL 891

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/831 (60%), Positives = 603/831 (72%), Gaps = 67/831 (8%)

Query: 70  VPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITV 129
           +P Y E  +TI D+Y   +  YF+   I  Y+ SLFP+  WLPHYNL W I DLIAGITV
Sbjct: 64  IPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITV 123

Query: 130 GCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIAR 189
           GCVLVPQSMSYAQIATL+PQ+GLYSSFIGAF YS FATSKDVCIGPVAVMSLQTAKVI R
Sbjct: 124 GCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIER 183

Query: 190 VQDKLPSD--TDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALN 247
           V   L +D  T  TA  IAT LALLCGII+TG+G LRLGFL+E ISLNAVAGFMTGSA N
Sbjct: 184 VTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFN 243

Query: 248 IISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCDVL 307
           II GQVP LMGYN +VNTR STY+V+I+TLKHLPDTKLDAVFGLIPL +L+  KW    L
Sbjct: 244 IICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSL 303

Query: 308 GPR-LNERHFGNGKNPRAHRIMK---NFYFYAQTTKNAIIIIVFTCISWAITRGKTSETR 363
           GP+ LN+         R  +I+K   N++FY+   +N ++IIVFT ISWAITRGK+S + 
Sbjct: 304 GPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSV 363

Query: 364 PISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVP 423
           PIS+LG+VPKGLK+V  F VP GL  KLAP+LP+SII+LLLEHIAI+KSFGR+NDYKIVP
Sbjct: 364 PISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDYKIVP 423

Query: 424 DQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGA 483
           DQE++AIG+TNL+GTFF AYPATGSFSRSALKAKC+V+TPLSGLFSGACVLLALYCLTGA
Sbjct: 424 DQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGA 483

Query: 484 FFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIYFA 543
           F+YIPKATL AVIIHAVS+L+ASYK T+NF+KMNPLD  CF+ TV ITVF+SIE GIYFA
Sbjct: 484 FYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFA 543

Query: 544 MCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKL--------------------VGDSSVL 583
           +C+S A L+FK  FP G FLG I+I EVL+  L                      D SV 
Sbjct: 544 ICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSVK 603

Query: 584 TSSDENSEILPTTKAGY----SVEVVSN-HNENTNYYTKWVPFDFSYTKELNPDAHIKPP 638
              D+N E   +++  Y    S E+ SN    N +YY +WVP    Y +E+NP   I PP
Sbjct: 604 NRLDQN-ENPKSSEKEYSEFKSYEMSSNSKTTNLSYYVRWVPMKNDYHREVNPLIKITPP 662

Query: 639 PPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWE-PRV 697
           PPG+IVYR  DSFTY+NCSRH+DI++DE+K++T++G      RK DRPWND G+WE P+ 
Sbjct: 663 PPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECPKS 722

Query: 698 FIKKYLRRENY-----DED---NVDIEDRV----IDDRPFLKIICLDFSQVSQIDATAIQ 745
               + + +       DED   N  IE        D++P LKIIC DFSQV Q DATAIQ
Sbjct: 723 LKNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATAIQ 782

Query: 746 CLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLT 805
            L DLRK+VN+Y+++Q+E+HF GIIS W+KKSL   GFGT+N+ YSD+SII+GH SYH++
Sbjct: 783 SLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYHVS 842

Query: 806 K---DVDG-------------------IKAATGTNLPFFHIDIPNFNKWDI 834
           K     DG                   I+  TGTN PFFHIDIP+F+ W++
Sbjct: 843 KINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/872 (56%), Positives = 628/872 (72%), Gaps = 53/872 (6%)

Query: 1   MSN-QHDTELTDFSNLDDLEQEFNQYKKIELTI----SSTRQNEEVD---SKRQGKSDKN 52
           MSN +  T L    +LDDL+ E+  +K  E +      S+     V    S + G+    
Sbjct: 1   MSNLERQTSL----DLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNG 56

Query: 53  VKSSSFDSIFSLTQQQQV----PTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIF 108
            KS +        +   +      Y E+ +T  +YY  ++RP  T   +  Y++ L P+ 
Sbjct: 57  DKSGATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVI 116

Query: 109 HWLPHYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATS 168
           +WLPHYN  WF  D++AGITVGCVLVPQSMSYA IATL PQFGLYSSF+GA  YS FATS
Sbjct: 117 NWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATS 176

Query: 169 KDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFL 228
           KDVCIGPVAVMSLQTAK +++V  +LP+DTDITA  +AT LA LCG+I+ G+G+LRLGFL
Sbjct: 177 KDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISLGLGVLRLGFL 236

Query: 229 VELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAV 288
           VELIS  AVAGFMTGSALNIISGQ+P LMGYN  VNTRTSTYKVII+TLKHLPDTKLDAV
Sbjct: 237 VELISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAV 296

Query: 289 FGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFT 348
           FGLIPL +L+ WKW+C+  GPRL ER+   G   R  RI     FY Q  +NA+IIIVFT
Sbjct: 297 FGLIPLVMLYTWKWLCNSGGPRLVERYTVRGS--RKQRIWSATLFYTQALRNAVIIIVFT 354

Query: 349 CISWAITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIA 408
            I+W+I+  K  +  PIS+LG VP GLKDV    +P GL AK+APELPAS+IVLLLEHIA
Sbjct: 355 AIAWSISHHK--KKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIA 412

Query: 409 IAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLF 468
           IAK+FGR+NDY++VPDQE++AIG TNLLGTFF+AYPATGSFSRSALKAKCNV TPLSG+F
Sbjct: 413 IAKAFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVF 472

Query: 469 SGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTV 528
           SGACVLLA+YCLT AF YIPKATL AVIIHAVS+LIASYK T + W++NPLD  CFL TV
Sbjct: 473 SGACVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATV 532

Query: 529 IITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVL---------------- 572
            I VF+SIE+GIYFAMCWSVAVLLFKVAFP  +FLG++EI E+                 
Sbjct: 533 FIAVFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELATNEGVSAGSEFAPLSK 592

Query: 573 ---DGKLVGDSSVLTSSDENSEILPTTKAGYSVEVVSNHNENTNYYTKWVPFDFSYTKEL 629
               GK V  +S   SS+  +      + G      +++     ++TKWVPF+  YT+EL
Sbjct: 593 DFEKGKGVSYASGSVSSESFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTREL 651

Query: 630 NPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWND 689
           NP   +  PPPGVIV+R ++S+TY+NC+R ++ +FDE+ R+T+RGK+ Q+  KS RPWND
Sbjct: 652 NPQVPVAQPPPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGKV-QVTSKSGRPWND 710

Query: 690 PGKWEPRVFIKKYLRRENYDEDNVDIEDRVI-DDRPFLKIICLDFSQVSQIDATAIQCLY 748
           PG+W P  F++K+  ++ Y E    +E  V+ DDRP L++I +D+SQV+Q+D+T +Q L+
Sbjct: 711 PGEWHPPKFLRKWFGKK-YSE---SLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLH 766

Query: 749 DLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHL---- 804
           DLRK+V+KYADRQVEFHF GIISPWIK+ L N GFGT+N E++DES+++GH +Y +    
Sbjct: 767 DLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGG 826

Query: 805 -TKDVDGI--KAATGTNLPFFHIDIPNFNKWD 833
            T D + +  + ATG N+PFFH ++P+F+KWD
Sbjct: 827 ATGDEEALLPQPATGVNMPFFHAEMPDFSKWD 858

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/833 (55%), Positives = 598/833 (71%), Gaps = 32/833 (3%)

Query: 14  NLDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDSIFSLTQQQQVPTY 73
           +++ L+ E++Q K  E+  +    + ++ S++   S K   ++ +  + ++  ++ VP Y
Sbjct: 30  DIEALQAEYDQLKAGEVHSAQGATHGDIGSRQYSGSGK--PAAQYLGL-NVNSREAVPEY 86

Query: 74  EENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVL 133
           EE  +++ DYY Y LR + +  T  DY  S+FP+  W+ HYN+ W  +D++AGITVGCVL
Sbjct: 87  EETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVL 146

Query: 134 VPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDK 193
           VPQSMSYAQ+A+LSPQ+GLYSSF+GAF YS FATSKDVCIGPVAVMSL+TAKVIARV + 
Sbjct: 147 VPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTEN 206

Query: 194 LPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQV 253
           LP DT+IT   IAT L LLCG IA  +G+LRLGFLVE IS+ AV GFMTGSAL+IISGQV
Sbjct: 207 LPEDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQV 266

Query: 254 PGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCDVLGPRLNE 313
           P LMGY+ +VNTR +TYKVII++LKHL DT ++A FGL+PL LLF WKW+C  LGPRL +
Sbjct: 267 PSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVD 326

Query: 314 RHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSVPK 373
           R+    K  RA R    F FY Q  +NA+II+VFT ISW I+R K  E  PIS+LG VP 
Sbjct: 327 RYL-QFKPSRASRWNAAF-FYLQALRNAVIIVVFTAISWGISRHKL-EKPPISLLGKVPS 383

Query: 374 GLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVPDQEIVAIGIT 433
           GLK+V    +P GL+ KL PELPA+ I+LLLEHIAIAKSFGRIN+YK+VPDQE++AIG+T
Sbjct: 384 GLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVT 443

Query: 434 NLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLC 493
           NL  TFF+AYPATGSFSRSALKAKCNV+TPLSGLF+GACVLLALYCLT AF++IPKATL 
Sbjct: 444 NLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLS 503

Query: 494 AVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIYFAMCWSVAVLLF 553
           AVIIHAV++LIASYK T  FW+ NPLD F F+VTVIITVF+SIE GIYF++ WS AVLL 
Sbjct: 504 AVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGIYFSISWSCAVLLC 563

Query: 554 KVAFPPGKFLGQIEITEVLDGK---LVGDSSVLTSSDENSEILPTTKAGYSVEVVSN--H 608
           KVAFP GKFLG I++ EV++      +   + L S D ++      K G  +  V +   
Sbjct: 564 KVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQIDKDGGKLNTVESVLP 623

Query: 609 NENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIK 668
           + +T ++ +W+P D +Y++ELNP+A + PPPPGVIVYR  DS+TY+NCSRHFDI+ D +K
Sbjct: 624 DPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSRHFDIILDHVK 683

Query: 669 RSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKKYLRRENYDEDNVDIEDRVIDDRPFLKI 728
             T+ G+L   +   +R W DPG W P    ++++  +            V D RP L++
Sbjct: 684 EHTRPGQLVNHLSNKERLWCDPGPWRPPRIFRRFIADKR-------TGSAVADARPVLRV 736

Query: 729 ICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINN 788
           + +D+SQVSQ+D+T IQ L DLR ++NKYADR VEFHF GI+SPWIK++L N GFG    
Sbjct: 737 LAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFGI--- 793

Query: 789 EYSDESIIMGHSSYHLTK-------DVDG--IKAATGTNLPFFHIDIPNFNKW 832
             +D  +I    SYHL +        V G  +  A GTN PFFH+D+P+F  W
Sbjct: 794 --ADPPLISSRVSYHLVRLPADPPHIVHGHSVVFALGTNTPFFHLDMPDFETW 844

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/863 (50%), Positives = 593/863 (68%), Gaps = 47/863 (5%)

Query: 3   NQHDTELTDFSNLDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDSIF 62
           + ++  L D S LD+LE ++ ++K             E  +   G  ++  +   FDS+ 
Sbjct: 28  DNNNRGLQDTSGLDELETDYTRFK-----------TNEDSAGYSGAENERSRIDKFDSVG 76

Query: 63  SLTQ----------QQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLP 112
           S  Q            + P Y E ++T  +YY  ++R          Y  SLFPI  W+ 
Sbjct: 77  SSLQFAKYDGNALPDFKAPPYYETTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIH 136

Query: 113 HYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVC 172
           HYN  W  SD IAGITVGCVLVPQSMSYAQ+A L P++GLYSSFIGAF YS FATSKDVC
Sbjct: 137 HYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVC 196

Query: 173 IGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELI 232
           IGPVAVMS+Q +KVI+ V D+LP  T ITA  +A+ LAL   I+   +GLLRLGF++ELI
Sbjct: 197 IGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLRLGFILELI 256

Query: 233 SLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLI 292
           S+ AVAGFMTGSAL+I++ Q+P L+G   ++NTR  TY+V+I TLKHL  + ++A FGLI
Sbjct: 257 SVTAVAGFMTGSALSILASQLPSLLGIQ-KINTRVETYRVLISTLKHLNGSDINAAFGLI 315

Query: 293 PLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISW 352
            L LLF WKW C  LGP+L  ++     N +  RI ++F+FYAQ  +NA ++ + T +SW
Sbjct: 316 CLALLFFWKWTCGYLGPKLISKYLR--PNSKKARIWQSFFFYAQALRNAFVLFLATFVSW 373

Query: 353 AITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKS 412
            +  G+  +   ISVLG+VP GLK V   T+PSGL+ KL P+LP ++I+LLLEHI IAKS
Sbjct: 374 LVI-GRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKS 432

Query: 413 FGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGAC 472
           FGRIN+YKIVPDQE++AIG+TNL+G+FF+AYPATGSFSRSALKAKCNV+TPLSGLFSGAC
Sbjct: 433 FGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGAC 492

Query: 473 VLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITV 532
           VLLALY LT AF+YIPKA L AVIIHAV +LIASYK +   W  NP D   FL T+++T+
Sbjct: 493 VLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTI 552

Query: 533 FASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDEN--S 590
           F+SIE+GIYFA+ +S+A LL K AFP GKFLG ++ITEV +  +  D   + ++D     
Sbjct: 553 FSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELPQ 612

Query: 591 EILPTTKAGYSVEVVSNHN-----ENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVY 645
           EI   +K     +V ++ N      +  ++TKWVP D  Y++ELNP+  +  PPPGVIVY
Sbjct: 613 EISKDSKLAKDPDVHASANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVY 672

Query: 646 RMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKKYLRR 705
           R  +S+ Y+NCSR FDI+ D +K  T+ GKL   +RKS++ W +PG W P +F++K+ ++
Sbjct: 673 RPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKK 732

Query: 706 ENYDEDNVDIEDRVIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFH 765
             +     ++ ++V D+RP LKI+ +D++QV+ +D+T+IQ L DLRK++N+YADRQV FH
Sbjct: 733 YRHKAAKPEVVEQV-DNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFH 791

Query: 766 FVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTKDV--------------DGI 811
           F GI+SPWIK++L + GFGTIN  YS++ +++ +S+YH+ ++V                +
Sbjct: 792 FSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEENQQNSEISASL 851

Query: 812 KAATGTNLPFFHIDIPNFNKWDI 834
             A+GTN PFFHID+P+F KWDI
Sbjct: 852 DVASGTNFPFFHIDMPDFTKWDI 874

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  541 bits (1393), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 270/503 (53%), Positives = 360/503 (71%), Gaps = 24/503 (4%)

Query: 73  YEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCV 132
           Y E  +T+ + + + +   FT+++I  Y+ SL PI  W+ HYNL WFISD+IAGITVGCV
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 133 LVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQD 192
           LVPQSMSYAQIATL PQ+GLYSS +G F Y++FATSKD+CIGPVA+MSLQTAK IA V  
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 193 KLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQ 252
           K P   DI A  IA+T+A++CG I  G+G+LRLGF ++LI + AV GF +GSA NI+ GQ
Sbjct: 123 KHP---DIPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWGQ 179

Query: 253 VPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCDVLGPRLN 312
           +PGLMGY+ +VNTR  TYKV++DTLK LP T ++AV GLIPLF LF WK+ CD    R  
Sbjct: 180 IPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCDYALRR-- 237

Query: 313 ERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSVP 372
               GN K P   RI+    FY  + +  I+II+ +  ++       ++   + VLG +P
Sbjct: 238 ----GNLK-PWPKRIV----FYLLSLRVTIVIIICSAAAYG------AKNPSLKVLGKIP 282

Query: 373 KGL---KDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVPDQEIVA 429
           KG     D    ++PS L++ +  E+PAS+IVL+LEH++IAKSF R+N+Y++  DQE+ A
Sbjct: 283 KGFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQELTA 342

Query: 430 IGITNLLGTF-FHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIP 488
           IG++N++G     AYP TGSFSR+ALKA+C VRTPL  +FSG CV++A+  LT A  +IP
Sbjct: 343 IGVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAWIP 402

Query: 489 KATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIYFAMCWSV 548
           KATL AVIIHAVS LI+SYK T+  +KM PLDC  FLVT+ ITVF+ IE G+YFA+CW+ 
Sbjct: 403 KATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCWAC 462

Query: 549 AVLLFKVAFPPGKFLGQIEITEV 571
            +L+ ++AFP G FLG + + E+
Sbjct: 463 FLLMIRIAFPYGAFLGYVRVREI 485

 Score =  189 bits (481), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 152/246 (61%), Gaps = 19/246 (7%)

Query: 584 TSSDENSEILPTTKAGYSVEVVSNHNENTNYYTK--WVPFDFSYTKELNPDAHIKPPPPG 641
           +S DEN + +   +   + ++V +H    +  T+  W+P+   +T+ELNP   I PPPPG
Sbjct: 654 SSVDENQDNIINKR--LTRQLVYDHELEHDTPTEIIWIPYSHRFTRELNPHVKIHPPPPG 711

Query: 642 VIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSD----RPWNDPGKWEPRV 697
           V+VYR +DS TY+NCSR++D + D IK +TK G++  +   SD    +PWN+PG WE   
Sbjct: 712 VVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGEIDVL---SDALYVKPWNNPGPWE--- 765

Query: 698 FIKKYLRRENYDEDNVDIEDRVIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKY 757
             K  L+   + +  +  + R+ D RP L+I+CLDFSQV+QID+TA+Q L DLR  VN Y
Sbjct: 766 --KPKLKFWEHADPEIARKKRMADKRPTLRILCLDFSQVAQIDSTALQALIDLRHEVNAY 823

Query: 758 ADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTKDVD-GIKAATG 816
               VE+HF GIISPW++++L   GFG IN E+  +  +   S+  +  D++   + A G
Sbjct: 824 TCSLVEWHFCGIISPWVRRNLIEIGFGKINKEFFPK--VNDSSTVEVISDLEYNGELALG 881

Query: 817 TNLPFF 822
            N+PFF
Sbjct: 882 ENVPFF 887

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  126 bits (317), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 127/505 (25%), Positives = 224/505 (44%), Gaps = 46/505 (9%)

Query: 85  TYSLRPYFTFKT-------ITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQS 137
           T SLR Y   K           YI    PI  W P Y+      DL+AGI++    +P +
Sbjct: 21  TPSLRSYRAIKVDQPLKLNTKSYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIPFA 80

Query: 138 MSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSD 197
           +S + +A +SP  GL+S  I    Y++F +   + +GP  V+SL   +       K   D
Sbjct: 81  ISLSTMAHVSPYAGLFSLVIPPLIYAVFGSVPTMVVGPQTVVSLVVGQSCEAWSHK-SVD 139

Query: 198 TDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSA-LNIISGQVPGL 256
           + +T + IA T     G I   +GL R+GF+   IS   + GF+   A + +I+  +P L
Sbjct: 140 SLVTVAVIACT----SGFILLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELLPEL 195

Query: 257 MG---YNSEV---NTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCDVLGPR 310
                Y  EV   N  T+T+      LK+ P+   D+ F +   F+ F+   VC  +   
Sbjct: 196 QLEDLYRDEVAQGNAGTTTWDKFNFILKYGPEHA-DS-FSMKLSFIAFSILMVCKYV--- 250

Query: 311 LNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGS 370
             +++F   +  +  R   +           +++  F  +S+      T  TR   ++G+
Sbjct: 251 --KKYFTEKRGSKLCRFFPDLL---------LVVAGFIYLSYYNDWSSTMGTR---IIGN 296

Query: 371 VPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRIN---DYKIVPDQEI 427
           +P    +   F VP     +       S +V +L     A +F  I    D  I  ++E+
Sbjct: 297 LPP---NKNHFKVPITSFKEFKELFDISFLVAILGLFDSATAFKAIGEKFDIDISSNREL 353

Query: 428 VAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYI 487
           V++G+ N++ + F A PA G + RS L   C+ +TP++G+      +  +  + GAF Y+
Sbjct: 354 VSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNYMMGAFHYL 413

Query: 488 PKATLCAVIIHAVSNLIASYKATMNF-WKMNPL-DCFCFLVTVIITVFASIEDGIYFAMC 545
           P   L  +I +   NL+    + + F W +    +   F+  V+ T+  S + G+   + 
Sbjct: 414 PLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTLVWSPQFGVSIGVG 473

Query: 546 WSVAVLLFKVAFPPGKFLGQIEITE 570
            ++  LL        + LG+  +T+
Sbjct: 474 LTMIRLLKHTTQSRVQILGRDPVTK 498

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  126 bits (316), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 124/515 (24%), Positives = 211/515 (40%), Gaps = 50/515 (9%)

Query: 50  DKNVKSSSFDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFH 109
           D N  S S ++I    +   V   E+    + D    + R   T   I DY+   FP F 
Sbjct: 9   DTNGSSDSAEAISQHNEDGLVYNQED----VQDRIAINNRSILTTSNIWDYLAYYFPCFS 64

Query: 110 WLPHYNLTWFISDLIAGITVGCVLVPQSMSYA-QIATLSPQFGLYSSFIGAFSYSLFATS 168
           W+P+Y LT F+ DL AG++V    +P ++SYA  +A + P  GLYS  I  F Y++F + 
Sbjct: 65  WMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVEPLSGLYSLAITPFIYAIFGSV 124

Query: 169 KDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFL 228
             + +GP + +SL   +    V+  +  D  I+   I+  +  + G     +G+ RLGFL
Sbjct: 125 PQMIVGPESAISLVVGQA---VEPMVNHDERISTISISIVVTFISGSFLLFLGIFRLGFL 181

Query: 229 VELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTL----------K 278
             ++S   + GF+      +I   +   +  +  + T    Y    + +           
Sbjct: 182 GNILSRALLRGFICSVGFVMIINSLISELKLDKVLATSPEHYHTPFEKILFLIKYGQHNY 241

Query: 279 HLPDTKLDAVFGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTT 338
           H P T + +++  I L L+   K                        R+MK F +     
Sbjct: 242 HAP-TAILSLYSFIILMLMKVMK-----------------------KRLMKRFKWVIFVP 277

Query: 339 KNAIIIIVFTCISWAITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPAS 398
           +  I+I+     S+            IS++G       D     +       L P L A 
Sbjct: 278 EILIVIVGTIMFSFHF---DIKHKFDISIIGDFKVNGFDSLHNPLDKTNRLLLKPLLDAG 334

Query: 399 IIVLLL---EHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALK 455
           I+  +L   E    +K+ G   D  +  ++E+VA+G  N++G+ F A PA G + RS + 
Sbjct: 335 IVCAVLGFFESTTASKALGTTYDLTVSSNRELVALGSMNIVGSLFGALPAFGGYGRSKIN 394

Query: 456 AKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWK 515
           A    +T +SG+  G+  L  +          P   L  V       L+      + F+ 
Sbjct: 395 ALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLSVVTSVVGLTLLEEAPTDLKFYF 454

Query: 516 MNPL--DCFCFLVTVIITVFASIEDGIYFAMCWSV 548
            +    +     +T I T+F S+E GI    C+S+
Sbjct: 455 QSHGYNELIVLGLTFITTIFYSVEVGICVGCCYSI 489

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 118/473 (24%), Positives = 207/473 (43%), Gaps = 54/473 (11%)

Query: 94  FKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSY-AQIATLSPQFGL 152
           F+T+  Y+    P F WLP Y       D+IAGI++    +P ++SY   IA + P  GL
Sbjct: 88  FETVPYYL----PCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGL 143

Query: 153 YSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALL 212
           YS  I  F Y +  +   + +GP + +SL   + +  +   L  D +++  +I+  +  +
Sbjct: 144 YSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESIT--LHKD-NVSLIDISIVITFV 200

Query: 213 CGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKV 272
            G I    G+ R GFL  ++S   + GF++   L +I   +   +  +  + +    Y  
Sbjct: 201 SGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHT 260

Query: 273 IIDTLKHLPD------TKLDAVFGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHR 326
             + +  L D       K  A+F      +L   +    +L  +L +RH           
Sbjct: 261 PFEKVLFLIDYAPAQYHKPTAIFSGCCFIILIVMR----LLKKKLMKRH----------- 305

Query: 327 IMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSVPKGLKDVETFTVP-S 385
             K+  F+       +++IV   IS  ++     +   IS++G     + + +    P +
Sbjct: 306 --KSAVFFPDIL---LVVIVTILISMKLS---LKQRYGISIVGDF--SMDNFDKLKNPLT 355

Query: 386 GLMAKLAPEL-PASIIVLLL---EHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFH 441
               KL P+L  AS+IV +L   E    +KS G   +  +  ++E+VA+G  N+  + F 
Sbjct: 356 HSRRKLMPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFG 415

Query: 442 AYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVS 501
           A P+ G + RS + A    ++ +SG+F G   L+ +  L     YIP   L  +      
Sbjct: 416 ALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGI 475

Query: 502 NLIASYKATMNFWKMNPLDC------FCFLVTVIITVFASIEDGIYFAMCWSV 548
           +L+      + F     L C      F F VT  +T+F SIE GI     +S+
Sbjct: 476 SLLEEVPGDIKFH----LQCGGYSELFVFAVTFGVTIFYSIESGICIGCVYSI 524

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 110/460 (23%), Positives = 198/460 (43%), Gaps = 34/460 (7%)

Query: 99  DYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYA-QIATLSPQFGLYSSFI 157
           + I+   P  +WLP+Y  T  + DL+AGIT+    +P ++SYA  IA + P  GLY+  +
Sbjct: 104 ELIRYYLPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAV 163

Query: 158 GAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIA 217
             F Y++F ++  + +GP   +SL   + +   +   P   D+    I   + L+ G I 
Sbjct: 164 SPFFYAIFGSTPQMIVGPEGAISLVIGQCVQSCKKHNP---DLDPILIVIAVTLISGTIL 220

Query: 218 TGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTL 277
              G+ RLG+L  +++   + GF+         G V  +M  +S +N       ++ DT 
Sbjct: 221 LISGIFRLGYLGNILNKALLHGFI---------GSVGFVMIIDSLIN-ELKLGDILADTP 270

Query: 278 KHLPDTKLDAVFGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQT 337
           +H     L  V         F WK+             F +       R  K    +   
Sbjct: 271 EHYNTPFLKIV---------FLWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHRHR 321

Query: 338 TKNAI--IIIVFTCISWAITRGKTSETRPISVLGSVPKGLKDVETFTVP-----SGLMAK 390
               I  I+IV T +     +   ++T  I +LG        +  F  P      GL+  
Sbjct: 322 WLIFIPEILIVLTTVLILSYKLDFADTYDIDILGDFKSNENSI--FHNPLSNKNRGLIHV 379

Query: 391 LAPELPASIIVLLLEHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFS 450
           +      + I    E    +K+ G  ++  +  ++E+VA+G++N++ +   A P+ G + 
Sbjct: 380 VFNIGIITAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGALPSFGGYG 439

Query: 451 RSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKAT 510
           RS + A    +T LSG+F G   +LA+  L     YIP   L  +       L+      
Sbjct: 440 RSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTLLEEIPKE 499

Query: 511 MNF-WKMNPL-DCFCFLVTVIITVFASIEDGIYFAMCWSV 548
           ++F W+     + F  ++T + ++F S+E  +Y    +S+
Sbjct: 500 VSFHWRCRGYNELFLIVLTFMTSIFYSVETSMYIGCVYSI 539

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  116 bits (291), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 126/486 (25%), Positives = 204/486 (41%), Gaps = 80/486 (16%)

Query: 96  TITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYA-QIATLSPQFGLYS 154
           +I D +    P F WLP+YN++  I DLIAG+++    +P ++S+A  +A + P  GLYS
Sbjct: 81  SIWDVLPYYLPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYS 140

Query: 155 SFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCG 214
                F Y++  +   + +GP + +SL   + + ++    P   D+   +++  +  + G
Sbjct: 141 LAFTPFIYAILGSVPQMIVGPESAISLVVGQAVEKMISHNP---DLHTLQLSAVITFISG 197

Query: 215 IIATGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVII 274
                 GL RLGFL  ++S   + GF++   L +I             +N+  S +K + 
Sbjct: 198 GFLFFFGLCRLGFLGNVLSRALLRGFISSVGLVMI-------------INSMISEFK-LD 243

Query: 275 DTLKHLP---DTKLDAVFGLIP-----------------LFLLFAWKWVCDVLGPRLNER 314
             LK LP    T  + +  L+                   F+L   K +   L PR    
Sbjct: 244 KILKDLPVHYHTPFEKILFLVTYAPNNYHGPTTALSLSCFFILIMTKIIKKKLMPRC--- 300

Query: 315 HFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSV-PK 373
                           +  +       II  +F  I +     +      IS +G    K
Sbjct: 301 ---------------RWIVFVPDILLLIIGTIFLSIKY-----RFKHNYSISTVGDFNTK 340

Query: 374 GL-KDVETFTVPS-GLMAKLAPELPASIIVLLL---EHIAIAKSFGRINDYKIVPDQEIV 428
           GL K +   +  + GL+ +L   L A  I  +L   E    +KS G   D  I  ++E+V
Sbjct: 341 GLDKLLNPLSAENRGLIPQL---LSAGFITAMLGFFESTTASKSLGSSYDLAISSNRELV 397

Query: 429 AIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIP 488
           A+G  NL  +   + PA G + RS + A    +T +SG F G  VLL +  L     YIP
Sbjct: 398 ALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIP 457

Query: 489 KATLCAVIIHAVSNLIASYKATMNFWKMNPLDCF------CFLVTVIITVFASIEDGIYF 542
              L  V      +L+    A + F       CF       F +TV+ T+F S+E GI  
Sbjct: 458 ICVLSVVTTMVGISLLEEAPADLMFH----FRCFGYDELLVFTLTVLTTMFYSVEVGICI 513

Query: 543 AMCWSV 548
              +SV
Sbjct: 514 GCGYSV 519

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  116 bits (291), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 119/473 (25%), Positives = 204/473 (43%), Gaps = 54/473 (11%)

Query: 94  FKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSY-AQIATLSPQFGL 152
           F+T+  Y+    P F WLP Y       D+IAGI+V    +P ++SY   IA + P  GL
Sbjct: 98  FETLPYYL----PCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGL 153

Query: 153 YSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALL 212
           YS  I  F Y +  +   + +GP + +SL   + +  +        +++  +I+T +  +
Sbjct: 154 YSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLH---KENVSLIDISTVITFV 210

Query: 213 CGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKV 272
            G I    G+ R GFL  ++S   + GF++   L +I   +   +  +  + +    Y  
Sbjct: 211 SGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHT 270

Query: 273 IIDTLKHLPDTK------LDAVFGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHR 326
             + +  L D          A+F    L +LF  +    +L  +L + H           
Sbjct: 271 PFEKILFLIDYAPAQYHIPTAIFSGCCLIVLFLTR----LLKRKLMKYH----------- 315

Query: 327 IMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSVPKGLKDVETFTVP-S 385
             K+  F+       +++IV   IS    +        IS++G     + + +    P +
Sbjct: 316 --KSAIFFPDIL---LVVIVTILISM---KFNLKHRYGISIIGDF--SMDNFDELKNPLT 365

Query: 386 GLMAKLAPEL-PASIIVLLL---EHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFH 441
               KL P+L  AS+IV +L   E    +KS G   +  +  ++E+VA+G  N++ + F 
Sbjct: 366 RPRRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFG 425

Query: 442 AYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVS 501
           A PA G + RS + A    ++ +SG+F G   L+ +  L     YIP   L  +      
Sbjct: 426 ALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGI 485

Query: 502 NLIASYKATMNFWKMNPLDC------FCFLVTVIITVFASIEDGIYFAMCWSV 548
           +L+      + F     L C      F F VT   T+F SIE GI     +S+
Sbjct: 486 SLLEEVPGDIKFH----LRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSI 534

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 131/518 (25%), Positives = 231/518 (44%), Gaps = 67/518 (12%)

Query: 86  YSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWF--ISDLIAGITVGCVLVPQSMSYA-Q 142
           +SL PY+             P F W+P Y  TWF  ISD +AGI++    +P ++SYA  
Sbjct: 82  WSLVPYY------------LPCFSWIPQY--TWFKLISDFLAGISLASFQIPLALSYATS 127

Query: 143 IATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITA 202
           IA + P  GLYS  I  F Y++F +   + +GP + +SL   + +  ++     D+ +  
Sbjct: 128 IAHVEPLCGLYSLAITPFIYAVFGSVPQMIVGPESAISLVVGQSVELLKSH---DSALEI 184

Query: 203 SEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQVPGLMGYNS- 261
             I+  L  + G     +G+LRLGFL  ++S + + GF++   L +I   +   +  N  
Sbjct: 185 INISVVLTFISGAALLILGILRLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKL 244

Query: 262 ----EVNTRTSTYKVIIDTLKHLPDT--KLDAVFGLIPLFLLFAWKWVCDVLGPRLNERH 315
               +V+  TS  KV    +K+ P    K  A+   I    LF+ +    +L  R   +H
Sbjct: 245 LAGLKVHCHTSFEKVQF-LIKYAPTNYHKPTALLSAIAFVTLFSIR----LLKKRWMAKH 299

Query: 316 FGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSVPKGL 375
                          +  +       +II ++   +W   +        I ++G      
Sbjct: 300 --------------RWLAFIPEILMVVIISIYLSATWEFKK-----QYGILIVGDF--NT 338

Query: 376 KDVETFTVP-SGLMAKLAPELPASIIVLLL----EHIAIAKSFGRINDYKIVPDQEIVAI 430
             ++    P S    K+ P+L  + +++ L    E +  +KS G   D  I  ++E+VA+
Sbjct: 339 HAIDKLKNPISKENRKIMPQLLNTGVLISLLGFFESMTASKSLGTTYDLAISSNRELVAL 398

Query: 431 GITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKA 490
           G  N++ + F A P+ G + RS + A    +T +SG+F G+  L+ +  L     YIP  
Sbjct: 399 GSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLC 458

Query: 491 TLCAVIIHAVSNLIASYKATMNF-WKMNPLD-CFCFLVTVIITVFASIEDGIYFAMCWSV 548
            L  +      +L+    + + F ++    D  F F +TV+ T+  S+E GI     +S+
Sbjct: 459 ILSVITSIVGISLLEEAPSELKFHFRCKGYDELFVFAITVLATLLYSVEMGICIGCGYSI 518

Query: 549 AVLLFKVAFPPGKFLGQIE-------ITEVLDGKLVGD 579
             ++   A    + LG+++       I E LD   +GD
Sbjct: 519 ISIVKHSAKSRIQILGRVQGTREFANIDEYLDSDPIGD 556

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 120/479 (25%), Positives = 204/479 (42%), Gaps = 64/479 (13%)

Query: 99  DYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYA-QIATLSPQFGLYSSFI 157
           D +K   P F WLP Y L  F  D+IAGIT+    +P ++SYA  +A + P  GLYS  I
Sbjct: 75  DRLKYYLPCFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSLAI 134

Query: 158 GAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITAS-EIATTLALLCGII 216
             F Y +F +   + +GP + +SL    V+ +  +KL +  +   +  I+  +  L G I
Sbjct: 135 TPFVYCVFGSVPQMIVGPESAISL----VVGQAVEKLVTHNEKVGTINISVVVTFLSGAI 190

Query: 217 ATGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDT 276
               G+ RLGFL  ++S   + GF++   L ++   +   +     + T    Y    + 
Sbjct: 191 LLIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEK 250

Query: 277 LKHL----PDT--KLDAVFGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKN 330
           ++ L    P+   K  A+  L    +L   ++    L  +L +R+             K+
Sbjct: 251 VQFLFKYGPENLHKPTAILSLCSFIILMTLRF----LKKKLMKRY-------------KS 293

Query: 331 FYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSV----------PKGLKDVET 380
             F+ +     I++IV + +  ++      +   IS+LG            P G KD  +
Sbjct: 294 VIFFPE-----ILLIVISSLIISVNFNLKKDFD-ISMLGDFSTSGFDKLNNPLG-KDNRS 346

Query: 381 FT---VPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVPDQEIVAIGITNLLG 437
                +  GLM           I+   E    +KS G I D  I  ++E+VA+G  NL+G
Sbjct: 347 LCHELLSVGLMCA---------ILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVG 397

Query: 438 TFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVII 497
           + F A P+ G + RS + A    +T +SG   G   L  +  L     Y P   L  +  
Sbjct: 398 SLFGALPSFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITT 457

Query: 498 HAVSNLIASYKATMNF----WKMNPLDCFCFLVTVIITVFASIEDGIYFAMCWSVAVLL 552
               +L+    + + F       N L  F  +   + T+  S+E GI     +S+  ++
Sbjct: 458 VVGLSLLEEAPSDIRFHIRCHGYNELIIFTLI--FVTTIIHSVEAGISVGCIYSIGSII 514

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  113 bits (283), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 121/492 (24%), Positives = 206/492 (41%), Gaps = 54/492 (10%)

Query: 99  DYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYA-QIATLSPQFGLYSSFI 157
           D +    P   W+P+YN   F  D IAG+++    +P  +S+A  +A + P  GLYS  +
Sbjct: 66  DVLPYYLPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAV 125

Query: 158 GAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIA 217
             F Y+LF +   + +GP + +SL   + +  +      D  +   +IAT ++ + G+  
Sbjct: 126 TPFIYALFGSVPHMIVGPESAISLVVGQAVETLTSH---DLSLETVDIATMISFMSGLTL 182

Query: 218 TGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTL 277
              G+ RLGFL  ++S   + GF++     +I   +   +  N  + T    Y    + +
Sbjct: 183 LFGGIFRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKI 242

Query: 278 ----------KHLPDTKLD-AVFGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHR 326
                      HLP + L  AVF  +    +F  K +                      R
Sbjct: 243 LFLVRYGPSNYHLPTSFLSLAVFTTLMTIRIFKKKMM----------------------R 280

Query: 327 IMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSV-PKGLKDVETFTVP- 384
            +K   F  +     I  IV   +S+     K  +   ISV+G     G  D   F  P 
Sbjct: 281 RIKWIVFIPEILSVVIFSIV---LSYMCDLKKKYD---ISVIGDFNTDGFDD---FRNPL 331

Query: 385 ----SGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFF 440
                GL+  L      S ++  LE I  +KS G   +     ++E+VA+G+ N +G+ F
Sbjct: 332 SKCNRGLIPALRDVSLVSALLGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAF 391

Query: 441 HAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAV 500
              PA G + RS + A    +T ++G+F G+  L  +  L     YIP   L  +     
Sbjct: 392 GIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVG 451

Query: 501 SNLIASYKATMNFW-KMNPLD-CFCFLVTVIITVFASIEDGIYFAMCWSVAVLLFKVAFP 558
            +L+      + F  +    D    F++T + T F SIE GI     +S+  ++   A  
Sbjct: 452 VSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISIVKHSAQS 511

Query: 559 PGKFLGQIEITE 570
             + L ++E T+
Sbjct: 512 RIQILARVEGTD 523

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score =  106 bits (265), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 127/526 (24%), Positives = 212/526 (40%), Gaps = 57/526 (10%)

Query: 42  DSKRQGKSDKNVKSSSFD------SIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFK 95
           +  RQ  S  +  S+SFD      S  ++    Q P    N  T+ D+   +L    T+ 
Sbjct: 12  ERSRQAGSYASPNSASFDTKSSKRSFGAIDVHIQSPPLISN--TVDDHNQLTLWHRLTY- 68

Query: 96  TITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYA-QIATLSPQFGLYS 154
                     P F WLP Y+ +  + D IAG ++    +P +MSY+  +A + P  GL +
Sbjct: 69  --------YLPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNA 120

Query: 155 SFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCG 214
                F Y++F +   + +GP + +SL   + I   + ++  D  +    +   L  + G
Sbjct: 121 LAFTPFVYAVFGSVPHMIVGPESAISLVVGQAI---EKQMKHDKSLDVVNLCLILTFISG 177

Query: 215 IIATGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVII 274
            I    G++R G+L  ++S   + GF++   L ++   +   +      N     Y    
Sbjct: 178 AILFCFGIMRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHY---- 233

Query: 275 DTLKHLPDTKLDAVFGLIP-----LFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMK 329
               H P  KL  +F   P        L +      ++  RL ++        R  R+ K
Sbjct: 234 ----HAPFQKLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKK--------RLSRVYK 281

Query: 330 NFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSVPKGLKDVETFTVP-SGLM 388
              F  +      I+IV   ++             I ++G +  G  D   F  P S   
Sbjct: 282 KVIFVPE------ILIVVALVTLGSYHFSFKLRYNIDIVGDIEVG--DTSKFRNPLSKKN 333

Query: 389 AKLAPEL-PASIIVLLL---EHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYP 444
             L  EL  A  +V LL   E    +KS G   +  +  ++E+VA+G  NL+G+ F A P
Sbjct: 334 LSLFSELFHAGFMVALLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALP 393

Query: 445 ATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLI 504
           + G + RS + A     T +SG+F G    +    L  A  +IP   L  +       L 
Sbjct: 394 SFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLF 453

Query: 505 ASYKATM--NFWKMNPLDCFCFLVTVIITVFASIEDGIYFAMCWSV 548
               A +  +F      +   F +TV+ T F S+E GI     +SV
Sbjct: 454 EEAPADLRYHFRCRGYNELLIFALTVLTTFFYSVEAGITLGCGYSV 499

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 118/496 (23%), Positives = 215/496 (43%), Gaps = 56/496 (11%)

Query: 96  TITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYA-QIATLSPQFGLYS 154
           T+ D I    P F W+P Y++   + D IAG+++    +P +MSYA  +A + P  GLYS
Sbjct: 65  TLKDTIPYYLPCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPPLCGLYS 124

Query: 155 SFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCG 214
                  Y++  +   + +GP + +SL   + I   + +L  D  + A  I   +  + G
Sbjct: 125 LVFSPAVYTVLGSVPQMIVGPESAISLILGQAI---EARLSEDPKLKAINICLVITFISG 181

Query: 215 IIATGVGLLRLGFLVELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRT----STY 270
           ++    GLLRLGFL  ++S   + GF++G  + ++   +   +  N    TR     S +
Sbjct: 182 LVLLTGGLLRLGFLENVLSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPF 241

Query: 271 KVIIDTLKHLPDT--KLDAVFGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIM 328
           + ++  +K+ P+   K  A+  L+   +L +          R+ ++ +G           
Sbjct: 242 EKVLFIMKYGPENYHKPTAILSLVAFVILMSL---------RIFKKRYG----------- 281

Query: 329 KNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVLGSVPKG----LK------DV 378
           K F +        +++ +   +S+ +          I ++  +PK     LK      +V
Sbjct: 282 KKFKWLVLLPDILVVVALSIFVSYKM---HLKSRYGIEIINDIPKDSMKHLKNPFSNVNV 338

Query: 379 ETFT--VPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVPDQEIVAIGITNLL 436
            TF     +G M  +         +   E    +KS G   +  I  ++E++A+G  N++
Sbjct: 339 ATFKDLFSTGFMVAM---------LGFFESATASKSLGTSYNLAISSNRELIALGSMNVV 389

Query: 437 GTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVI 496
           G+ F   PA G + RS + A    +T +SG F G   L  +  L     YIP   L  + 
Sbjct: 390 GSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPIIRYIPVCILSVIT 449

Query: 497 IHAVSNLIASYKATMNF-WKMNPL-DCFCFLVTVIITVFASIEDGIYFAMCWSVAVLLFK 554
                 L+      + F W+     +   F VT++ T+F S+E GIY     S+  ++  
Sbjct: 450 TVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTLLATLFYSLEAGIYIGCACSIINVIKH 509

Query: 555 VAFPPGKFLGQIEITE 570
            A    + LG++  TE
Sbjct: 510 SAKSRIQILGRVPGTE 525

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 89.7 bits (221), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 108/469 (23%), Positives = 197/469 (42%), Gaps = 48/469 (10%)

Query: 136 QSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLP 195
            S+S + +A L P  GLYS  I    Y +  T     +GP  V+SL   +       +  
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQ-----SCEWW 55

Query: 196 SDTDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNII------ 249
           S   +        +  + G I   +G+ R+GF+   +S   + GF++  AL ++      
Sbjct: 56  SHRSLEPLSTVAVIGCVSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITELLP 115

Query: 250 -SGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCDVLG 308
                     Y ++    T+T++     L+  P+      + L     LF +  +  +  
Sbjct: 116 ELKLEELYAHYVAQGYIGTTTWEKFRFILEKAPENSDTFTWNLS----LFTFILLMTI-- 169

Query: 309 PRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISWAITRGKTSETRPISVL 368
            R  +RH             K   F+ +     I+I+V   I+ + T+ K SE + I ++
Sbjct: 170 -RYLKRHLAEKCG------WKKCIFFPE-----ILIVVVGSITLSNTQ-KWSELKGIKII 216

Query: 369 GSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLL---EHIAIAKSFGRINDYKIVPDQ 425
           G +P     ++   VP    ++       S ++ +L   E   + KS    ++     ++
Sbjct: 217 GDIPPNSDHIK---VPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSNVDASSNR 273

Query: 426 EIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFF 485
           E+V++G+ NL+ + F A PA G + RS +   C  +T  SG+F     ++ +  L  AF 
Sbjct: 274 ELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNAFH 333

Query: 486 YIPKATLCAVIIHAVSNLIASYKATMNF-WKMNPL-DCFCFLVTVIITVFASIEDGIYFA 543
           ++P   L  +I     +L+    A + F W +    + F F++ V+ T+  S + G+   
Sbjct: 334 HLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVTMG 393

Query: 544 MCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDENSEI 592
           MC ++  LL        + LG+  IT     K + D       DENS+I
Sbjct: 394 MCLTMIRLLKHSTRSRVQILGRDPITYTF--KNIDD-------DENSDI 433

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 81/147 (55%), Gaps = 6/147 (4%)

Query: 105 FPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYA-QIATLSPQFGLYSSFIGAFSYS 163
            P   W+PHY+   F  DL+AGI++    +P ++SYA  IA + P  GLYS  I    Y+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 164 LFATSKDVCIGPVAVMSLQTAKVIARVQDKLPS-DTDITASEIATTLALLCGIIATGVGL 222
           +F +   + +GP + +SL    V+ +  +K  + D++I+   I   +  + G++   +G 
Sbjct: 134 IFGSVPQMIVGPESAISL----VVGQATEKFSAHDSEISTVTITMMITFISGVVLFFLGS 189

Query: 223 LRLGFLVELISLNAVAGFMTGSALNII 249
           +RLGFL  ++S   + GF++   L +I
Sbjct: 190 VRLGFLGNILSKALLRGFISSVGLVMI 216

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 75/171 (43%), Gaps = 14/171 (8%)

Query: 405 EHIAIAKSFGRINDYKIV--PDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRT 462
           E    +KS G  +DY +    ++E++A+G  N++G+ F A P+ G + RS +      +T
Sbjct: 358 ESTTASKSLG--SDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKT 415

Query: 463 PLSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDC- 521
            +SG   G   LL    L     Y P   L  +      +L+    + + F     + C 
Sbjct: 416 VMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFH----IHCS 471

Query: 522 -----FCFLVTVIITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIE 567
                  F +T I T+  S+E G+     +S+ +++   A    + L ++E
Sbjct: 472 GYSELTVFTLTFIATLSQSVELGVTVGCIYSLILIVKHSALSRIQILAKLE 522

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 80/152 (52%), Gaps = 6/152 (3%)

Query: 99  DYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYA-QIATLSPQFGLYSSFI 157
           D +    P F WLP Y+L  F  D IAG+++    +P +MSYA  IA + P  GLY+   
Sbjct: 91  DVLPYYLPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAF 150

Query: 158 GAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIA 217
             F Y++F +   + +GP + +SL   + I   +  +  D  +++ ++   +  + G++ 
Sbjct: 151 TPFFYAIFGSVPQMIVGPESAISLVVGQAI---EPMIRHDPSLSSLDLCVIITFISGVVL 207

Query: 218 TGVGLLRLGFLVELISLNAVAGFMTGSALNII 249
              G+ R GFL  ++S   + GF+  SA+ +I
Sbjct: 208 FTFGVFRFGFLDNVLSRAFLRGFI--SAVGVI 237

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 68/148 (45%), Gaps = 6/148 (4%)

Query: 405 EHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPL 464
           E    +KS G   D  +  ++E+VA+G  NL+G+ F A P+ G + RS + A    +T +
Sbjct: 381 ESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVV 440

Query: 465 SGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFW----KMNPLD 520
           SG   G   +  +  L     YIP   L  +      +L+    A + F       N L 
Sbjct: 441 SGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNEL- 499

Query: 521 CFCFLVTVIITVFASIEDGIYFAMCWSV 548
              F++TV+ T F S+E GI     +S+
Sbjct: 500 -ISFIITVLTTFFYSVEAGITVGCGYSI 526

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (49%), Gaps = 20/167 (11%)

Query: 96  TITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYA-QIATLSPQFGLYS 154
           T    I+   P   WLP YN + F SD I+GI++    +P ++SYA  IA + P  GLYS
Sbjct: 105 TFYQLIQYYLPCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYS 164

Query: 155 SFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASE--------IA 206
             I    Y +  +   + +GP   +SL    V+ +  DKL    ++++ E        I+
Sbjct: 165 LAITPVIYGILGSVPPMIVGPEGAISL----VVGQAVDKLHGSYNLSSQEDDHISRMNIS 220

Query: 207 TTLALLCGIIATGVGLLRLGFLVELIS-------LNAVAGFMTGSAL 246
            T+  L G++    GLLRLGFL  ++S       +++V G M   AL
Sbjct: 221 VTITFLSGLVLFICGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDAL 267

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 73/164 (44%), Gaps = 2/164 (1%)

Query: 405 EHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPL 464
           E    +KS G   +  I  ++E+VA+G+ NL  +     P+ G + RS + A    +T +
Sbjct: 409 ESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGGLPSFGGYGRSKINAFSGAKTVM 468

Query: 465 SGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNF-WKMNPL-DCF 522
           SG+  G   +L +  L     +IP   L  +      +LI      + F W+     +  
Sbjct: 469 SGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLSLIEEAPGEVKFHWRCKGYNELI 528

Query: 523 CFLVTVIITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQI 566
            F +T   T+F S+E GI     +S+  ++   A    + LG+I
Sbjct: 529 IFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKSRIQILGRI 572

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 102/218 (46%), Gaps = 18/218 (8%)

Query: 33  SSTRQNEEVDSKRQGKSDKNVKSSSFDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYF 92
           S+   N   D  R+   D+ V     DS+ S   +        NS  + D+     +P F
Sbjct: 24  SAINPNSFADGTRR-VLDRQVNHQRVDSVLSNASKM-------NSRRL-DHAVIDSKPSF 74

Query: 93  TFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYA-QIATLSPQFG 151
                 D +    P F W+P Y  + F+ DL+AGIT+    +P ++SYA  +A + P  G
Sbjct: 75  R-----DVLPYYLPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCG 129

Query: 152 LYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLAL 211
           LYS     F Y++F +   + +GP + +SL   + + +++     + +I+   I+  +  
Sbjct: 130 LYSLAFTPFIYAIFGSVPQMIVGPESAISLVVGQAVEKLRAH---NHEISTMSISVLVTF 186

Query: 212 LCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNII 249
           + G+     G+ R GFL  ++S   + GF++   + +I
Sbjct: 187 ISGMFLFVFGICRFGFLGNVLSRALLRGFISSVGVVMI 224

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 92/203 (45%), Gaps = 10/203 (4%)

Query: 390 KLAPEL-PASIIVLLL---EHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPA 445
           +LAP L  A  IV +L   E    AKS G   ++ I  ++E+VA+G  NL  +   A PA
Sbjct: 347 ELAPNLMNAGFIVAILGFFESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVLGALPA 406

Query: 446 TGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIA 505
            G + RS + +    +T +SG+  G  VLL +        YIP   L  +      +L+ 
Sbjct: 407 FGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQIRYIPVCILSVITTIVGISLLE 466

Query: 506 SYKATMNFW--KMNPLDCFCFLVTVIITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFL 563
              A + F        +   F VTV+ T F S+E G+     +SV  ++   A    + L
Sbjct: 467 EAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMGVCIGCGYSVISIIKHSAKSRIQIL 526

Query: 564 GQIEITEVLDGKLVGDSSVLTSS 586
            ++E T    G+ +     L+S+
Sbjct: 527 ARVEST----GQFINSDEYLSSA 545

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 74/146 (50%), Gaps = 4/146 (2%)

Query: 105 FPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYA-QIATLSPQFGLYSSFIGAFSYS 163
            P F WLP Y+ T FI DLIAG ++    +P +MSY+  +A + P  GL +       Y+
Sbjct: 85  LPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 164 LFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLL 223
           +F +   + +GP + +SL   + I ++      D  +  + +   L  + G I    GL+
Sbjct: 145 VFGSVPHMIVGPESAISLVVGQAIEKLTKH---DASLNVTNLCVVLTFISGSILFSFGLM 201

Query: 224 RLGFLVELISLNAVAGFMTGSALNII 249
           R GFL  ++S   + GF++   L ++
Sbjct: 202 RFGFLDSVLSRALLRGFISAVGLIMV 227

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 73/159 (45%), Gaps = 9/159 (5%)

Query: 397 ASIIVLLL---EHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSA 453
           A  +V LL   E    +KS G   D  I  ++E+VA+G  NL+G+ F A P+ G + RS 
Sbjct: 358 AGFLVALLGFFESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSK 417

Query: 454 LKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNF 513
           + A     T +SG+F G   L+    L  A  +IP   L  +      +L     A + F
Sbjct: 418 INAYSGAATVMSGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKF 477

Query: 514 W----KMNPLDCFCFLVTVIITVFASIEDGIYFAMCWSV 548
                  N L    F +TV+ T F S+E GI     +S+
Sbjct: 478 HFRCRGYNEL--LTFAITVLTTFFYSVEAGITLGCGYSI 514

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 81/157 (51%), Gaps = 8/157 (5%)

Query: 94  FKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSY-AQIATLSPQFGL 152
           F+TI  Y+    P F WLP Y  +    D+IAGI++    +P ++SY   IA + P  GL
Sbjct: 88  FETIPYYL----PCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGL 143

Query: 153 YSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALL 212
           YS  I  F Y +F +   + +GP + +SL   + +  +   L  D +++  +I+  +  +
Sbjct: 144 YSLAISPFVYGVFGSVPQMIVGPESAISLVVGQAVESIT--LHKD-NVSLIDISIVITFV 200

Query: 213 CGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNII 249
            G I    G+ R GFL  ++S   + GF++   L +I
Sbjct: 201 SGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMI 237

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 82/169 (48%), Gaps = 14/169 (8%)

Query: 390 KLAPEL-PASIIVLLL---EHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPA 445
           KL P+L  AS+IV +L   E    +KS G   +  +  ++E+VA+G  N++ + F A P+
Sbjct: 360 KLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPS 419

Query: 446 TGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIA 505
            G + RS + A    ++ +SG+F G   L+ +  L     YIP   L  +      +L+ 
Sbjct: 420 FGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLE 479

Query: 506 SYKATMNFWKMNPLDC------FCFLVTVIITVFASIEDGIYFAMCWSV 548
              + + F     L C      F F VT  +T+F SIE GI     +S+
Sbjct: 480 EVPSDIKFH----LRCGGYSELFVFAVTFGVTIFYSIEAGICIGCVYSI 524

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 93/198 (46%), Gaps = 25/198 (12%)

Query: 53  VKSSSFDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLP 112
           V  S F+S  S++    V  Y+ N+I               F+T+  Y+    P F WLP
Sbjct: 64  VNVSRFESFNSMSNNDSV--YDNNTI---------------FETVPYYL----PCFSWLP 102

Query: 113 HYNLTWFISDLIAGITVGCVLVPQSMSY-AQIATLSPQFGLYSSFIGAFSYSLFATSKDV 171
            Y       D+IAGI++    +P ++SY   IA + P  GLYS  I  F Y +  +   +
Sbjct: 103 EYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYGILGSVPQM 162

Query: 172 CIGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVEL 231
            +GP + +SL   + +  +   L  D +++  +I+  +  + G I    G+ R GFL  +
Sbjct: 163 IVGPESAISLVVGQAVESIT--LHKD-NVSLIDISVVITFVSGAILLFSGISRFGFLGNV 219

Query: 232 ISLNAVAGFMTGSALNII 249
           +S   + GF++   L +I
Sbjct: 220 LSKALLRGFISSVGLVMI 237

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 80/169 (47%), Gaps = 14/169 (8%)

Query: 390 KLAPEL-PASIIVLLL---EHIAIAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPA 445
           KL P+L  AS+IV +L   E    +KS G   +  +  ++E+VA+G  N++ + F A P+
Sbjct: 360 KLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPS 419

Query: 446 TGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIA 505
            G + RS + A    ++ +SG+F G   L+ +  L     YIP   L  +      +L+ 
Sbjct: 420 FGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLE 479

Query: 506 SYKATMNFWKMNPLDC------FCFLVTVIITVFASIEDGIYFAMCWSV 548
                + F     L C      F F VT  +T+  SIE GI     +S+
Sbjct: 480 EVPGDIKFH----LRCGGYSELFVFAVTFGVTILCSIEAGICIGCVYSI 524

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 86/179 (48%), Gaps = 5/179 (2%)

Query: 397 ASIIVLLLEHIAIAKSFGRIN---DYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSA 453
           AS +V +L     A +F  I+   D  +  ++E+V++G+ N++G+ F + PA G + RS 
Sbjct: 320 ASFLVAILGLFESATAFKSISATFDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSK 379

Query: 454 LKAKCNVRTPLSGLFSGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNF 513
           L   C  +TP++G+F     +  +  L G F Y+P   L  +I     NL+      M F
Sbjct: 380 LNIFCGAQTPMAGIFVSLSAIFCMRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFF 439

Query: 514 -WKMNPL-DCFCFLVTVIITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITE 570
            W ++   +   F   V+ T+  S + G+   +  ++  LL        + LG+  IT+
Sbjct: 440 YWSVSGYQELITFSAVVLSTLIWSPQFGLVMGLGLTMIRLLKHTTQSRIQILGKDPITK 498

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 79/172 (45%), Gaps = 12/172 (6%)

Query: 85  TYSLRPYFTFKT-------ITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQS 137
           T SLR Y   K           Y+    PI  WLP Y+      D++AG+T+    +P +
Sbjct: 21  TMSLRSYRAIKVDKPLRHDTKSYVSYYLPILRWLPEYSWGKMAKDMLAGLTLTSFQIPLA 80

Query: 138 MSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIARVQDKLPSD 197
           +S   +A +SP  GLY+  I    Y++F +   + +GP  V SL    V+ +  D   + 
Sbjct: 81  ISLTTMAHVSPYAGLYALVIPPLIYAVFGSVPTMVVGPQTVASL----VVGQSCDAW-AH 135

Query: 198 TDITASEIATTLALLCGIIATGVGLLRLGFLVELISLNAVAGFMTGSALNII 249
             +        +  + G++   +G+ RLGF+   IS   + GF +  A+ ++
Sbjct: 136 KSLEPLMTVAVIGCISGVLVFAMGIFRLGFIDNAISKAFLKGFTSALAVVML 187

>Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa]
           {ON} YMR216C (SKY1) - Serine Protein Kinase [contig 68]
           FULL
          Length = 591

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 24/118 (20%), Positives = 46/118 (38%), Gaps = 8/118 (6%)

Query: 27  KIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDSIFSLTQQQQVPTYEENSITIADYYTY 86
           K +L+++   Q +E D    G+    ++ +  DS +S          E+N  ++ DY   
Sbjct: 37  KSKLSLALQIQKDENDDGSSGRGKNGMEDADSDSEYSSCD-------EKNEESLRDYKPG 89

Query: 87  SLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITVGCVLVPQSMSYAQIA 144
              P F  +T  +    +     W  H++  W   D ++   V   +V     Y + A
Sbjct: 90  GYHPAFKGETYNEGRYVVVRKLGW-GHFSTVWLAKDTVSNAHVAMKIVRSDKVYTEAA 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 90,686,003
Number of extensions: 4118724
Number of successful extensions: 13347
Number of sequences better than 10.0: 62
Number of HSP's gapped: 13581
Number of HSP's successfully gapped: 82
Length of query: 834
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 716
Effective length of database: 39,950,811
Effective search space: 28604780676
Effective search space used: 28604780676
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)