Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B027408.266ON25625612681e-179
KLTH0G13596g8.266ON2672152832e-29
NDAI0B020108.266ON2812322797e-29
KNAG0G020608.266ON2862292798e-29
TDEL0F039308.266ON2802662771e-28
YLR091W (GEP5)8.266ON2932492683e-27
Kwal_56.237778.266ON2672262524e-25
Suva_10.1758.266ON2992562413e-23
SAKL0H16940g8.266ON3032502362e-22
Smik_12.1508.266ON2922492333e-22
Ecym_43048.266ON2892262212e-20
AGR082C8.266ON2662062192e-20
NCAS0B050408.266ON2732212167e-20
ZYRO0C01562g8.266ON2772192106e-19
Skud_12.1598.266ON2942521974e-17
KLLA0F19228g8.266ON3052271941e-16
Kpol_392.48.266ON2812151824e-15
TPHA0J007608.266ON24984750.35
NCAS0B048708.238ON198389711.7
NDAI0F019906.146ON111853675.8
NOTE: 1 genes in the same pillar as KAFR0B02740 were not hit in these BLAST results
LIST: CAGL0L12320g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B02740
         (256 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...   493   e-179
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...   113   2e-29
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...   112   7e-29
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...   112   8e-29
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   111   1e-28
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...   107   3e-27
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...   101   4e-25
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...    97   3e-23
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...    96   2e-22
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...    94   3e-22
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...    90   2e-20
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...    89   2e-20
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...    88   7e-20
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...    86   6e-19
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...    80   4e-17
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...    79   1e-16
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...    75   4e-15
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    33   0.35 
NCAS0B04870 Chr2 complement(888985..894936) [5952 bp, 1983 aa] {...    32   1.7  
NDAI0F01990 Chr6 (487556..490912) [3357 bp, 1118 aa] {ON} Anc_6....    30   5.8  

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score =  493 bits (1268), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 242/256 (94%), Positives = 242/256 (94%)

Query: 1   MSGRAPCIRTLVTKEVRDKITNAIEGLPXXXXXXXXXXXXXXRNDALAIPLLRDVVSYET 60
           MSGRAPCIRTLVTKEVRDKITNAIEGLP              RNDALAIPLLRDVVSYET
Sbjct: 1   MSGRAPCIRTLVTKEVRDKITNAIEGLPLHQKTLLQLQDTLKRNDALAIPLLRDVVSYET 60

Query: 61  TGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAEPEAISLRN 120
           TGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAEPEAISLRN
Sbjct: 61  TGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAEPEAISLRN 120

Query: 121 AWMRNKATAVDLSTSDGVIKPILNHFRYLRVNEDRLCKKKVGLPILEVPLNVFGTEIPEC 180
           AWMRNKATAVDLSTSDGVIKPILNHFRYLRVNEDRLCKKKVGLPILEVPLNVFGTEIPEC
Sbjct: 121 AWMRNKATAVDLSTSDGVIKPILNHFRYLRVNEDRLCKKKVGLPILEVPLNVFGTEIPEC 180

Query: 181 RVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSKNTRALKRVYLRSCSRAYTGE 240
           RVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSKNTRALKRVYLRSCSRAYTGE
Sbjct: 181 RVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSKNTRALKRVYLRSCSRAYTGE 240

Query: 241 SNPKDSSNITFHIIDW 256
           SNPKDSSNITFHIIDW
Sbjct: 241 SNPKDSSNITFHIIDW 256

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score =  113 bits (283), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 106/215 (49%), Gaps = 29/215 (13%)

Query: 57  SYETTGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAE-PEA 115
            Y   G SK LESI++  YF W NE   H+K     Y  L+ +WP E H    + + P+ 
Sbjct: 39  QYTADGSSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPKT 98

Query: 116 ISLRNAWMRNK-----ATAVDLSTSDGVIKP--------------ILNHFRYLRVNEDRL 156
            S+R  W  N        + +    D   +P              +  HF +L+ +   L
Sbjct: 99  QSIRFLWSSNSPKVLSKMSYEKYAHDTEERPSRLTELQRTVQFHEVFQHFLFLK-SRPHL 157

Query: 157 CKKKVGL--PILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHS 214
           CK + GL  PI+E+P+   G  IPE RV NL K++IA+V K L  D+P LS + E +L  
Sbjct: 158 CKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAK 217

Query: 215 IIN------DSKNTRALKRVYLRSCSRAYTGESNP 243
           II+      D  + R LKR+Y R+C  AYT E +P
Sbjct: 218 IIDSPQLPEDVSSKRELKRLYQRACRGAYTIEQHP 252

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score =  112 bits (279), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 80/232 (34%), Positives = 122/232 (52%), Gaps = 28/232 (12%)

Query: 46  ALAIPLLRDVVSYE---TTGKSKF----LESIIYRLYFQWLNEVPSHLKPLLNQYEHLKS 98
           +  IPLL  + SYE    +G+SK     LESIIY  YF+W N++ SHLKP   QY  L +
Sbjct: 43  SFKIPLLTLINSYEKAQASGQSKLSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLT 102

Query: 99  NWPIERHIKFKNAEPEAISLRNA------WMRNKATAVDLSTS--------DGVIKPILN 144
            WP   H K  + +   I   N        +R   + ++ + S          + K I  
Sbjct: 103 FWPHIYHSKIDSKKNSIILTWNKSSNSKNMLRELLSHLNYTQSLVPQKKDFQVIFKKIYQ 162

Query: 145 HFRYLRVNEDRLCK--KKVGLPILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNP 202
           H+ +L +N   LC   K++  PI+E+P+N  G +IP+ R+NNLL+ +IA     L   NP
Sbjct: 163 HYIFLSLNPS-LCSNGKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNP 221

Query: 203 MLSPKLEDTLHSIINDSK--NTRALKRVYLRSCSRAYTGESNPKDSSNITFH 252
           +L+ + E  L  IIN S    +R L+++Y R+CS +Y  ++  +D +NI F 
Sbjct: 222 ILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSYVIKN--EDDNNIEFQ 271

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score =  112 bits (279), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 114/229 (49%), Gaps = 28/229 (12%)

Query: 52  LRDVVSYETTGKSKFLESIIYRLYFQW------LNEVPSHLKPLLNQYEHLKSNWPIERH 105
             DV S +   + K L +++ +LY QW      L+ +P HL P    +  L   WP E H
Sbjct: 48  FHDVPSTKKHTQYKILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESH 107

Query: 106 IKFKNAEPEAISLRNAWMRNKATAVDLS--------TSD-----GVIKPILNHFRYLRVN 152
           +  K +     +L++AW+ N   A+ +S        TS      G ++ IL+H++ L  N
Sbjct: 108 LSLKQSTKGHATLKHAWVTNNKHALQMSFDAAAANPTSGNIELRGSLRQILSHYQLLYNN 167

Query: 153 EDRLCKKKVGLPILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPML--SPKLED 210
                K K+ +P+ E+PLNVFG EIP CR  NLL++++ +VK+ L+E+ P L  +  + +
Sbjct: 168 MRMFGKIKLQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAE 227

Query: 211 TLHSIINDSKNTRA-------LKRVYLRSCSRAYTGESNPKDSSNITFH 252
               I  D    R+       L+R+Y R+ +  YT  S  ++  N   H
Sbjct: 228 LTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYTLASTAQEGQNGGVH 276

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  111 bits (277), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/266 (28%), Positives = 129/266 (48%), Gaps = 31/266 (11%)

Query: 12  VTKEVRDKITNAIEGLPXXXXXXXXXXXXXXRND--ALAIPLLRDVVSYET----TGKSK 65
           +T+++   +  A+E LP               ++   + IPL + V + E+    T + K
Sbjct: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQRIK 60

Query: 66  FLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAE-PEAISLRNAWMR 124
            LESIIY  +F W + +P HLK   + Y  +  +WP ERH    N E P + SLR  W  
Sbjct: 61  ALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWED 120

Query: 125 NKATAVDLS--------------------TSDGVIKPILNHFRYLRVNEDRLCK--KKVG 162
           +  T + ++                      D +   + +H+ +L+ N  RLC   + + 
Sbjct: 121 SSKTVLSMAEYSKNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKAN-PRLCNNGRNLP 179

Query: 163 LPILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSKNT 222
           +PI+E+P+   G +I   R+ NL K ++AH  + L  +NP+LS   E+ L  II+D+ ++
Sbjct: 180 IPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISDA-SS 238

Query: 223 RALKRVYLRSCSRAYTGESNPKDSSN 248
           R  +R+Y  SC RAY  E +  +  N
Sbjct: 239 RKQRRLYQASCKRAYVMEYDDGEHGN 264

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score =  107 bits (268), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 115/249 (46%), Gaps = 39/249 (15%)

Query: 47  LAIPLLRDVVSYETTGKS-------KFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSN 99
           +A+PL + +  YE   +        K LESIIY+ +FQW N +P H       Y  L ++
Sbjct: 42  IAVPLTKSLQLYEKAQRRQDLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTH 101

Query: 100 WPIERH------IKFKNAEPEAISLRNAW----------------------MRNKATAVD 131
           WP E H      I   N +  + S R+ W                      MR   T +D
Sbjct: 102 WPFENHRDLVDSIAVNNGKLNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLD 161

Query: 132 LSTSDGV--IKPILNHFRYLRVNED-RLCKKKVGLPILEVPL-NVFGTEIPECRVNNLLK 187
             T + +  I  + NH+++L  N       KK   P +++P+ N  G   P  ++  L  
Sbjct: 162 TFTPERIFLINSLGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFA 221

Query: 188 KRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSKNTRALKRVYLRSCSRAYTGESNPKDSS 247
           ++++H+ KSL  +NP LSP+ E  L ++  D    R L+R+Y+R+C+RAYT  +    + 
Sbjct: 222 RQLSHIYKSLFIENPPLSPENELALTAVFYDETVERRLRRLYMRACARAYTTTNADSTTE 281

Query: 248 NITFHIIDW 256
            + FH   W
Sbjct: 282 PLMFHCTRW 290

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score =  101 bits (252), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 109/226 (48%), Gaps = 29/226 (12%)

Query: 46  ALAIPLLRDVVSYETTGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERH 105
           A ++  L     YE     K LE+II+  YF W NE+P H+K     Y  L+  WP E H
Sbjct: 28  AESLRFLELARQYEAKKDYKTLENIIHHTYFSWENEIPQHIKAFREHYNELRDFWPYECH 87

Query: 106 IKFKNAE-PEAISLRNAW----------MR-------NKATAVDLSTSDGVIK--PILNH 145
                 + P++ S+R  W          MR        +     L+  +  ++   I  H
Sbjct: 88  RTILGMQSPKSQSIRFLWSAGNPRVLAAMRYGSYGWNREGGGERLTELERTLRFHEIFQH 147

Query: 146 FRYLRVNEDRLCK--KKVGLPILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPM 203
           F +L+    +LCK  K + +PI+E+P+   G  I + R+ NL K+++A+V + L  DNP 
Sbjct: 148 FLFLQ-RRPQLCKNRKHLSVPIVEIPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPA 206

Query: 204 LSPKLEDTLHSIINDSK------NTRALKRVYLRSCSRAYTGESNP 243
           LS + E  L  II   +      ++R LKR+Y R+C  AY  + +P
Sbjct: 207 LSAENESLLMDIIESPQLPQGQTSSRMLKRLYQRACRGAYVIKPHP 252

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score = 97.4 bits (241), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 113/256 (44%), Gaps = 46/256 (17%)

Query: 47  LAIPLLRDVVSYETTGKS-------KFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSN 99
           +A+PL   +  YE   ++       K LESI+Y+ +FQW N  P H       Y  L S+
Sbjct: 42  IAVPLTESLQVYEKAQRAQDLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSH 101

Query: 100 WPIERHIKFKNAEPEA---------------------ISLRNAWMR-------------- 124
           WP E H    ++ P                         ++N W+R              
Sbjct: 102 WPFENHRSLVDSIPAQNGKLISLTSKGNWLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQ 161

Query: 125 NKATAVDLSTSD--GVIKPILNHFRYLRVNED-RLCKKKVGLPILEVPL-NVFGTEIPEC 180
           N    +D  T++   ++K + NH+++L  N       KK   P++++P+ N  G   P  
Sbjct: 162 NSIAELDAFTAERTFLVKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPK 221

Query: 181 RVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSKNTRALKRVYLRSCSRAYTGE 240
           +++ L  +++A +  SL  +NP LS   E  L ++ +D    R   R+Y+R+C+RAYT  
Sbjct: 222 QISKLFARQLAQIYTSLFVENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIA 281

Query: 241 SNPKDSSNITFHIIDW 256
           +   D+  +TF    W
Sbjct: 282 NADSDNEPLTFRCTHW 297

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score = 95.5 bits (236), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 110/250 (44%), Gaps = 58/250 (23%)

Query: 46  ALAIPLLRDVVSYETTGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERH 105
           AL   L + +  Y+    SK LE I+Y  YF W N  P H++     Y  L+ +WP ERH
Sbjct: 34  ALLDTLEQKLFDYQANENSKSLEWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERH 93

Query: 106 IKFKN-AEPEAISLR------------------NAWMRN--------------------- 125
               + + PE +S+R                  N W RN                     
Sbjct: 94  RDLLSMSAPERVSIRHMWNDNNKKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALE 153

Query: 126 --KATAVDLSTSDGV--------IKPILNHFRYLRVNEDRLCK--KKVGLPILEVPLNVF 173
             K     LST   +           I  H+ +L+ N  +LCK  KK+ +PI+E+P+   
Sbjct: 154 EEKNRGSMLSTLPKISQLELTLLFHEIFQHYMFLKRNP-KLCKYGKKLPIPIVEIPMKPL 212

Query: 174 GTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSII-----NDSKNTRALKRV 228
           G +IP  R+ NL K++ A   K L E+NP+LS + E  L  II     + S + R +KR+
Sbjct: 213 GQDIPLVRIRNLFKRKAAATWKLLAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRL 272

Query: 229 YLRSCSRAYT 238
           Y R+C  +Y 
Sbjct: 273 YQRACKHSYV 282

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score = 94.4 bits (233), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 113/249 (45%), Gaps = 39/249 (15%)

Query: 47  LAIPLLRDVVSYETTGKS-------KFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSN 99
           +A+PL + +  +E   +        K LESIIY+ +F+W N  P H       Y  L ++
Sbjct: 42  IAVPLTKLLQVHEKAQRRQDLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTH 101

Query: 100 WPIERH----------------IKFKNAEPEA-----ISLRNAWMRNKATAVDLSTSD-- 136
           WP E H                I  K    +A       ++N W++   T  +LS +D  
Sbjct: 102 WPFENHRLLVDSIAAHKGKLNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLD 161

Query: 137 -------GVIKPILNHFRYLRVNED-RLCKKKVGLPILEVPL-NVFGTEIPECRVNNLLK 187
                   ++  + N +++L  N       KK   P +++P+ N  G   P  +++ L  
Sbjct: 162 AFTPERAFLVNSLGNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFS 221

Query: 188 KRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSKNTRALKRVYLRSCSRAYTGESNPKDSS 247
           +++A++  SL E+NP LSP  +  L +I ND    R  KR+Y+R+C+RAYT  +      
Sbjct: 222 RQLAYIYTSLFEENPPLSPANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIE 281

Query: 248 NITFHIIDW 256
            +TF    W
Sbjct: 282 PLTFRCTQW 290

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 103/226 (45%), Gaps = 47/226 (20%)

Query: 58  YETTGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAE-PEAI 116
           Y  +G+  +L  +I+ +YF+ LN    H++      + L+  WP ERH    + E P   
Sbjct: 49  YLLSGEVSYLRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKD 108

Query: 117 SLRNAWMRNKATAVDLSTSDGVI----------------KPILNHFRYLRVNEDR----- 155
           S R  W RN A  +D+   D  +                +P     +YLR  +D+     
Sbjct: 109 SARYLWSRNNAKVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGE 168

Query: 156 ----------------------LC-KKKVGLPILEVPLNVFGTEIPECRVNNLLKKRIAH 192
                                 LC  K + +PI+EV ++  G ++P+ R++NL +KR   
Sbjct: 169 TERIALLKLIFSHYLFVKSRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKA 228

Query: 193 VKKSLLEDNPMLSPKLEDTLHSIINDSKNTRALKRVYLRSCSRAYT 238
             K+LL D P LS ++E  LHSII +    R++ R+Y  SC+ AYT
Sbjct: 229 TLKTLLHDFPPLSREVESLLHSIIKEC--DRSMGRLYKWSCNGAYT 272

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score = 89.0 bits (219), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 103/206 (50%), Gaps = 24/206 (11%)

Query: 62  GKSKFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIK-------------- 107
           G  + L+ +++ ++FQ +   P HL+ L    E L+  WP ERH                
Sbjct: 51  GGHQGLQRLVFHVHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLALSDVRSQSLRR 110

Query: 108 -FKNAEPEAIS----LRNAWMRN----KATAVDLSTSDGVIKPILNHFRYLRVNEDRLCK 158
            +++ + E +      R+ W+R     +  A+  +  + V+  +   + +L+        
Sbjct: 111 LWEDGQEEVLQQMQYCRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSV 170

Query: 159 KKVGLPILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIIND 218
           +++ +P++E+ +   G +IP+ RV+ L K +   V + L  ++P L+P  E+ +  II +
Sbjct: 171 RRLPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAE 230

Query: 219 SKNTRALKRVYLRSCSRAYTGESNPK 244
              TRA++R+YLR+C RAY  +++ +
Sbjct: 231 CP-TRAMRRIYLRACRRAYVLDADAQ 255

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score = 87.8 bits (216), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 107/221 (48%), Gaps = 29/221 (13%)

Query: 46  ALAIPLLRDVVSYE-------TTGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKS 98
           +  +PLL+ +  YE         G  K LESI Y  YF W N VPSHL+      E L+ 
Sbjct: 41  SFKVPLLQLLCKYERYNIQEDKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRR 100

Query: 99  NWPIERHIKFKNAEPEAISLRNAWMRNKATAVDLSTSDGVIKP------------ILNHF 146
            WP   H   +  + +  S+   W ++      L  +   I+P            I  H+
Sbjct: 101 YWPCVYH---RGMDTKRDSIIVQWAKSNNGDALLKGTMNHIQPGASAEELLMFKKIFQHY 157

Query: 147 RYLRVNEDRLCK--KKVGLPILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPML 204
            +L +N  R+    K++  P++ VP+N  G  IP+ RV NL +K+++    +L   NP+L
Sbjct: 158 IFLTLNA-RITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVL 216

Query: 205 SPKLEDTLHSIIN-DSKNT-RALKRVYLRSCSRAY--TGES 241
           + +    L  IIN D +NT R+L+R+Y R+   A+   GES
Sbjct: 217 NVENHGFLDEIINADYENTSRSLRRLYQRASKNAHVIAGES 257

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score = 85.5 bits (210), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 107/219 (48%), Gaps = 24/219 (10%)

Query: 53  RDVVSYETTGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKN-A 111
           +D+  +E     K+LE++I + +F W N +P  LK     ++ L ++WP E      + +
Sbjct: 46  QDISEFEKHNDHKYLEALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMS 105

Query: 112 EPEAISLRNAWMRNKATAVD-----------------LSTSDG--VIKPILNHFRYLRVN 152
            P   S    W   K  A+                  LS   G  ++  I + + +L+ +
Sbjct: 106 NPRKESQGYLWRDGKELALSNLRFEKHRWADENIIERLSPEQGTQLLHSIFHQYFFLK-S 164

Query: 153 EDRLC--KKKVGLPILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLED 210
             RLC   +K+ +PI+E+PL   G ++ +CR+ NL K++ A V   L  +N  LS + E 
Sbjct: 165 HARLCYNNRKIPVPIVEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQ 224

Query: 211 TLHSIINDSKNTRALKRVYLRSCSRAYTGESNPKDSSNI 249
            L  II  S+ TR+++R+Y R+  RAY   +  KD + +
Sbjct: 225 LLGEIITKSE-TRSMRRLYQRASRRAYVVTNEGKDPNGL 262

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score = 80.5 bits (197), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 107/252 (42%), Gaps = 42/252 (16%)

Query: 47  LAIPLLRDVVSYETTGKS-------KFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSN 99
           +A+PL   +  YE   +        K LESII++ +FQW N  P H       +  L S+
Sbjct: 42  IAVPLTESLQVYEKAQRRQDLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSH 101

Query: 100 WPIERH------IKFKNAEPEAISLRNAWMRNKATAV-----------DLSTSDG----- 137
           WP E H      I   N +  +++ +  W++   T +             STS       
Sbjct: 102 WPFENHRSLVDSICAHNGKLNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGA 161

Query: 138 -----------VIKPILNHFRYLRVNED-RLCKKKVGLPILEVPL-NVFGTEIPECRVNN 184
                      ++  + NH+++L  N       KK   P +++P+ N  G      ++  
Sbjct: 162 NLDAFTPERTFLVNSLGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAK 221

Query: 185 LLKKRIAHVKKSLLEDNPMLSPKLEDTLHSIINDSKNTRALKRVYLRSCSRAYTGESNPK 244
           L  +++  +  SL  +NP LS   E  L ++ +D    R  KR+Y+R+C+RAYT  ++  
Sbjct: 222 LFSRQLTQIYTSLFVENPPLSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDS 281

Query: 245 DSSNITFHIIDW 256
               +TF    W
Sbjct: 282 TIEPLTFRCTQW 293

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 96/227 (42%), Gaps = 47/227 (20%)

Query: 57  SYETTGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQY-EHLKSNWPIE-RHIKFKNAEPE 114
           S+      K LE ++Y ++F  LN+ P H+  +L QY   L   WP E +H   +  +P 
Sbjct: 43  SFNENPTRKTLEKLVYSVHFHLLNDPPKHVD-ILRQYPNELAKFWPYEMQHSILEMDDPN 101

Query: 115 AISLRNAWMRNKATAVD-------------------------LSTSDGV----------- 138
             S    W RN   A+D                         ++  DG+           
Sbjct: 102 LTSQTILWSRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRL 161

Query: 139 --------IKPILNHFRYLRVNEDRLCKKKVGLPILEVPLNVFGTEIPECRVNNLLKKRI 190
                   ++ I  H+ +L+ N      KK+  PI+E+ +   G +I + R++NL KK++
Sbjct: 162 PAEKIKETLRQIFEHYYFLKTNPKLCATKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKV 221

Query: 191 AHVKKSLLEDNPMLSPKLEDTLHSIINDSKNTRALKRVYLRSCSRAY 237
             +   L   NP+L+   E  L SI+ND    R  KR+Y    SR+Y
Sbjct: 222 KLISDLLYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSY 268

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 100/215 (46%), Gaps = 31/215 (14%)

Query: 56  VSYETTGKSKFLESIIYRLYFQWLNE-VPSHLKPLLNQYEHLKSNWPIERHIKFKN-AEP 113
           ++ +   +S+ LE I+ + +  W N+  P+HL+   N Y  L  +WP E H    N A P
Sbjct: 59  INSKVENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARP 118

Query: 114 EAISL-------------------RNAWMR--NKATAVD---LSTSDGVIKPILNHFRYL 149
              SL                    N W    ++    D   +S  + + K I    R+ 
Sbjct: 119 GTGSLIYLCLNNDDRFFNFYKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHT 178

Query: 150 RVNEDRLCKKKVGLPILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLE 209
            ++E      K  +PI+EVPL   G +IP CR+ NL  K++ ++ K L   +P +S   E
Sbjct: 179 TISE----VNKNMVPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKLLSLSSPAISLSHE 234

Query: 210 DTLHSIINDSKNTRALKRVYLRSCSRAYT-GESNP 243
             + +I+ D+K+ R + R+Y RS   +Y   ++NP
Sbjct: 235 KIIMNILEDTKDNRRINRLYRRSLKNSYVFDDTNP 269

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 42/84 (50%), Gaps = 11/84 (13%)

Query: 49  IPLLRD----VVSYETTGKSKFLESIIYRLYFQWLNEVPS--HLKPLLNQYEHLKSNWPI 102
           I LL D     ++ +  G+ K L+ II++ +  + N   +  HLK    +Y +L  NWP 
Sbjct: 53  IELLFDYNNAFINKQKPGQLKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPY 112

Query: 103 ERH-IKF---KNAEPEAISLRNAW 122
           ERH I F   KN  PE  +L   W
Sbjct: 113 ERHDILFAANKNV-PETKALEYLW 135

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 22/31 (70%)

Query: 160 KVGLPILEVPLNVFGTEIPECRVNNLLKKRI 190
           K+ +PI+ +PLN  G +IP+ R+ N  KK++
Sbjct: 213 KLQIPIVILPLNALGLKIPKSRLYNKFKKKL 243

>NCAS0B04870 Chr2 complement(888985..894936) [5952 bp, 1983 aa] {ON}
           Anc_8.238
          Length = 1983

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 165 ILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPK---LEDTLHSIINDSKN 221
           ILE   N+FG +IP   + N     I  +K+  LE +  +  +   +E  L  II  SK 
Sbjct: 74  ILEWVTNLFGNDIPHDIIVNTADILIQSIKEDELESDGFIEKRRESIEKDLGVIIEKSKF 133

Query: 222 TRALKRVYLRSCSRAYTGESNPKDSSNIT 250
              +K +  ++ S  +  ESN  DS  +T
Sbjct: 134 IALIKMI--QNISDYHGTESNIDDSKAVT 160

>NDAI0F01990 Chr6 (487556..490912) [3357 bp, 1118 aa] {ON} Anc_6.146
            YBR235W
          Length = 1118

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 200  DNPMLSPKLEDTLHSIINDSKNTRALKRVYLRSCSRAYTGESNPKDSSNITFH 252
            D P L P  ED+++S +NDSK+ R +       CSR    ES     +N++F+
Sbjct: 996  DKPTLVPISEDSMNSTVNDSKSRRPILPDLSPCCSR----ESLLTAMANLSFN 1044

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,104,208
Number of extensions: 1194125
Number of successful extensions: 3522
Number of sequences better than 10.0: 29
Number of HSP's gapped: 3609
Number of HSP's successfully gapped: 32
Length of query: 256
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 149
Effective length of database: 41,212,137
Effective search space: 6140608413
Effective search space used: 6140608413
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)