Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B027308.263ON53952628140.0
KNAG0G020408.263ON59149320390.0
Skud_12.1578.263ON59248920130.0
YLR089C (ALT1)8.263ON59249220110.0
Smik_12.1488.263ON59248920030.0
NCAS0B050208.263ON56849019940.0
TDEL0F039008.263ON55949319830.0
Suva_10.1738.263ON59248919870.0
NDAI0B019908.263ON58848719750.0
CAGL0L12254g8.263ON57449219140.0
SAKL0H17006g8.263ON53148619060.0
ZYRO0C01628g8.263ON53448419000.0
KLLA0F19162g8.263ON52849118660.0
TPHA0J007508.263ON52249218230.0
Kpol_392.58.263ON51249118210.0
KLTH0G13662g8.263ON51949217600.0
NCAS0B038408.263ON49749017490.0
KAFR0B055308.263ON51448917360.0
Smik_4.3578.263ON50749117270.0
YDR111C (ALT2)8.263ON50749117240.0
Skud_4.3728.263ON50748917180.0
Suva_2.2718.263ON50748917100.0
Kwal_56.237918.263ON51848617110.0
TBLA0E044408.263ON56248316950.0
KNAG0M012108.263ON52150616870.0
KAFR0B05520singletonON51048916760.0
NDAI0J013608.263ON50148916680.0
TPHA0A018008.263ON49849616310.0
Ecym_43078.263ON53448916310.0
Kpol_543.398.263ON49249216250.0
AGR085W8.263ON52149316280.0
TBLA0F030608.263ON50049315760.0
TBLA0G01630singletonON50049715290.0
Kwal_34.160181.472ON3791511356e-08
Kpol_1039.222.252ON3861821312e-07
Kwal_14.25741.321ON4432601214e-06
Skud_10.1561.321ON4601381171e-05
Ecym_32902.252ON3861431152e-05
NDAI0B045502.102ON5651611162e-05
TPHA0O014501.321ON4431731152e-05
KLLA0F03509g2.252ON3871741134e-05
Kpol_278.23.511ON4981231125e-05
KLTH0G09614g2.252ON3891821125e-05
NDAI0G057601.321ON4483551116e-05
KNAG0G005501.472ON3871231107e-05
ZYRO0A01672g2.252ON3861331108e-05
AEL170C1.321ON4582381108e-05
TPHA0D033703.511ON4971231109e-05
Ecym_62921.321ON4303261109e-05
YJL060W (BNA3)1.321ON4441381081e-04
SAKL0F02156g3.511ON4981221081e-04
NCAS0A092001.321ON4453671072e-04
KLTH0G19646g1.472ON3791221072e-04
Kwal_47.189823.511ON4961221072e-04
KLLA0F10021g3.511ON4971221072e-04
Ecym_6319singletonON3542901062e-04
Kwal_23.48882.252ON3891801053e-04
Suva_6.1361.321ON4441381053e-04
KNAG0B053201.321ON4331691053e-04
Smik_10.1801.321ON4441381053e-04
SAKL0E08492g2.252ON3841281044e-04
TPHA0F012602.252ON3921231044e-04
KLTH0H10648g1.321ON4432641045e-04
TDEL0D019001.321ON4431861036e-04
KLLA0F01617g1.321ON4442511027e-04
KAFR0B023808.204ON4431831027e-04
NDAI0B037302.252ON3861271028e-04
CAGL0J05126g1.321ON4333251028e-04
KNAG0B006603.511ON4961221028e-04
KAFR0J015802.252ON3831271000.001
CAGL0G01254g3.511ON5041221000.001
KNAG0E018502.252ON384141990.001
NCAS0E006703.511ON497162990.002
Kpol_1035.231.321ON444137990.002
NCAS0G040501.472ON384134980.002
TDEL0C040902.252ON383130980.002
ZYRO0G20636g1.321ON453138970.003
TDEL0A016008.204ON475187970.003
Smik_7.693.511ON500122960.005
YGL202W (ARO8)3.511ON500122950.005
SAKL0D06886g1.321ON447331950.005
ADL249W2.252ON387223950.005
Kwal_47.17462na 1ON492125950.006
NCAS0B064402.252ON385123940.008
KLTH0G19624gsingletonON46833940.008
KLTH0B00176g8.204ON44833940.008
SAKL0D11528g1.472ON383153930.009
KLTH0G02002g3.511ON496122930.010
TBLA0B080808.204ON444202930.010
ZYRO0C06028g3.511ON496122920.012
CAGL0C01243g2.252ON383127910.015
NDAI0I028303.511ON500122910.015
SAKL0H21824gna 1ON499125910.017
KAFR0A017101.321ON435238900.020
KAFR0D014203.511ON492122900.021
Kwal_8.5858.204ON44644900.023
Kpol_480.11.472ON380162890.025
YIL116W (HIS5)2.252ON385127890.026
KLLA0A04906gna 1ON480124890.030
Ecym_7228na 1ON488127880.035
KLTH0E07678gna 1ON492125880.040
Suva_7.613.511ON500122870.048
Skud_7.693.511ON500122870.059
SAKL0E12188g2.102ON530176870.060
ZYRO0G05346g2.102ON504145860.075
Kpol_1032.398.204ON453192850.091
Smik_9.532.252ON388131840.098
TBLA0B009902.102ON546159850.10
Skud_9.552.252ON385131830.14
AFR548C3.511ON497127820.23
Suva_9.782.252ON386124810.23
CAGL0G06028g2.102ON537164810.26
CAGL0I06578g8.204ON436179810.28
TPHA0A020808.204ON458196800.39
Ecym_55428.204ON44638780.63
KNAG0M023102.598ON66080780.76
Kwal_33.145822.102ON525166770.77
KNAG0G016808.204ON45234770.93
Suva_5.2818.204ON450189761.0
KLLA0E00969g8.204ON445145761.0
TDEL0D057903.511ON49762761.1
Kwal_26.77682.475ON422125751.3
ZYRO0B11088g8.204ON45033751.5
AGR141C8.204ON43838751.5
Smik_5.3198.204ON443179742.0
YMR066W (SOV1)2.637ON89897733.1
YER152C8.204ON44334723.4
NCAS0A038308.204ON44645714.2
Kwal_26.85958.624ON1034166705.9
KNAG0H037302.102ON523203698.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B02730
         (539 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...  1088   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   790   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   780   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   779   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   776   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   772   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   768   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   769   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   765   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   741   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   738   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   736   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   723   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   706   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   706   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   682   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   678   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            673   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   669   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   668   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   666   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   663   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   663   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   657   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   654   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   650   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   647   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   632   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   632   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   630   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   631   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   611   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              593   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    57   6e-08
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    55   2e-07
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    51   4e-06
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    50   1e-05
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    49   2e-05
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    49   2e-05
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    49   2e-05
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    48   4e-05
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    48   5e-05
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    48   5e-05
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    47   6e-05
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       47   7e-05
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    47   8e-05
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    47   8e-05
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    47   9e-05
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    47   9e-05
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    46   1e-04
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    46   1e-04
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    46   2e-04
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    46   2e-04
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    46   2e-04
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    46   2e-04
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    45   2e-04
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    45   3e-04
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    45   3e-04
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    45   3e-04
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    45   3e-04
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    45   4e-04
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    45   4e-04
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    45   5e-04
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    44   6e-04
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    44   7e-04
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    44   7e-04
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    44   8e-04
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    44   8e-04
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    44   8e-04
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    43   0.001
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    43   0.001
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    43   0.001
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     43   0.002
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    43   0.002
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    42   0.002
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    42   0.002
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    42   0.003
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    42   0.003
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    42   0.005
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    41   0.005
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    41   0.005
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    41   0.005
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    41   0.006
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    41   0.008
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    41   0.008
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    41   0.008
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    40   0.009
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    40   0.010
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    40   0.010
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    40   0.012
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    40   0.015
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    40   0.015
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    40   0.017
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    39   0.020
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    39   0.021
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    39   0.023
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    39   0.025
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    39   0.026
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    39   0.030
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    39   0.035
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    39   0.040
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    38   0.048
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    38   0.059
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    38   0.060
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    38   0.075
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    37   0.091
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    37   0.098
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    37   0.10 
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    37   0.14 
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    36   0.23 
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    36   0.23 
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    36   0.26 
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    36   0.28 
TPHA0A02080 Chr1 (424056..425432) [1377 bp, 458 aa] {ON} Anc_8.2...    35   0.39 
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    35   0.63 
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    35   0.76 
Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {...    34   0.77 
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    34   0.93 
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    34   1.0  
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    34   1.0  
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    34   1.1  
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    33   1.3  
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    33   1.5  
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    33   1.5  
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    33   2.0  
YMR066W Chr13 (401541..404237) [2697 bp, 898 aa] {ON}  SOV1Mitoc...    33   3.1  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    32   3.4  
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     32   4.2  
Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {...    32   5.9  
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    31   8.5  

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score = 1088 bits (2814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/526 (100%), Positives = 526/526 (100%)

Query: 14  NAFFTKMSPSVTILPPNTYSYYSTKSFSNPKPRKHNLNFKPAGQLTIGDLNENVLKAKYA 73
           NAFFTKMSPSVTILPPNTYSYYSTKSFSNPKPRKHNLNFKPAGQLTIGDLNENVLKAKYA
Sbjct: 14  NAFFTKMSPSVTILPPNTYSYYSTKSFSNPKPRKHNLNFKPAGQLTIGDLNENVLKAKYA 73

Query: 74  VRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQLQQQPLSFYRQVLSLLQYPTLL 133
           VRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQLQQQPLSFYRQVLSLLQYPTLL
Sbjct: 74  VRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQLQQQPLSFYRQVLSLLQYPTLL 133

Query: 134 HAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSESQGVYGIRRTVANFITERDGGEP 193
           HAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSESQGVYGIRRTVANFITERDGGEP
Sbjct: 134 HAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSESQGVYGIRRTVANFITERDGGEP 193

Query: 194 AYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEM 253
           AYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEM
Sbjct: 194 AYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEM 253

Query: 254 NGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVI 313
           NGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVI
Sbjct: 254 NGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVI 313

Query: 314 ADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGECGQRGGYME 373
           ADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGECGQRGGYME
Sbjct: 314 ADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGECGQRGGYME 373

Query: 374 IIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGEESFALDQAQRKTIHSQLSQ 433
           IIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGEESFALDQAQRKTIHSQLSQ
Sbjct: 374 IIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGEESFALDQAQRKTIHSQLSQ 433

Query: 434 RAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQEAQRLELSPDEFYCKELLEHTG 493
           RAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQEAQRLELSPDEFYCKELLEHTG
Sbjct: 434 RAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQEAQRLELSPDEFYCKELLEHTG 493

Query: 494 ICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHIEFMEKYNS 539
           ICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHIEFMEKYNS
Sbjct: 494 ICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHIEFMEKYNS 539

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/493 (75%), Positives = 429/493 (87%), Gaps = 2/493 (0%)

Query: 47  KHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANI 106
           K +  F PA Q+ I DLNENVLKAKYAVRG IP RAE+L+ QL E P SLPFDKIINANI
Sbjct: 97  KSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANI 156

Query: 107 GNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGS-SAVYKKDAILRAKKILKDIGGSV 165
           GNPQQL Q+PLSFYRQVLSLLQ+P LL++++  P + +++YK DA+ RA+K+L+DIGGSV
Sbjct: 157 GNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSV 216

Query: 166 GAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVL 225
           GAYS SQGV GIR+TVA+FIT RD  EPAYPEDIFLTAGASAAV+YLLSI CKGEKTGVL
Sbjct: 217 GAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVL 276

Query: 226 IPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINP 285
           IPIPQYPLYTATLALNNSH LPY+LDE +GWS N  EI++V+  A+  NIKP VLVVINP
Sbjct: 277 IPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINP 336

Query: 286 GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFD-GMKFHSVKGVLRRLQREIPG 344
           GNPTGAVLS++AI  I EIAAKYGIVVIADEVYQENIFD  +KFHS+K VLR+LQ+E PG
Sbjct: 337 GNPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPG 396

Query: 345 KFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVD 404
           KFD VQLASLHSTSKGVSGECGQRGG+ME+ GF+HE+RQVILKLASISLCPVVTGQALVD
Sbjct: 397 KFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVD 456

Query: 405 LMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLN 464
           LMV PP+ GEES+ LDQA+R  IHS+L +RA  LW+TFN L+GI+CQKP GAMYLFP+LN
Sbjct: 457 LMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLN 516

Query: 465 LPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWID 524
           LP++A+Q+AQ +E++ DEFYCKELLE+TGICTVPGSGFGQV GTYHLRTTFLAPG EWID
Sbjct: 517 LPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWID 576

Query: 525 SWKQFHIEFMEKY 537
            W++FH EF  KY
Sbjct: 577 LWEKFHKEFYNKY 589

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/489 (75%), Positives = 421/489 (86%)

Query: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108
           N +F PA QLT+ D+NENVLKAKYAVRG IP RAEELK QL + P SLPFDKIINANIGN
Sbjct: 102 NDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGN 161

Query: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168
           PQQLQQ+PL++YRQVLSLLQYP LL+  E +   S ++K DAI RAK +++DIGGSVGAY
Sbjct: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221

Query: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228
           S SQGV GIR++VA FIT+RD GE +YPEDIFLTAGASAAVNYLLSI C+G +TGVLIPI
Sbjct: 222 SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288
           PQYPLYTATLALNNS ALPY+LDE +GWS NP EIE V+K+A+Q+ IKP VLVVINPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348
           TGAVLS E++  I E+AAKYG VVIADEVYQENIF G KFHS+K +LR LQRE PGKFDN
Sbjct: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401

Query: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408
           VQLASLHSTSKGVSGECGQRGGYME+ GF+HE+RQVILKLASISLCPVVTGQALVDLMV 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468
           PP  GEESF LDQA+R +IH +L  RA  L+ TFNSL+GIECQKP GAMYLFPK++LP++
Sbjct: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521

Query: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528
           A+QEA+ LEL+PDEFYCK LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG+EWI  W+ 
Sbjct: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581

Query: 529 FHIEFMEKY 537
           FH EF ++Y
Sbjct: 582 FHKEFFDQY 590

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/492 (75%), Positives = 422/492 (85%)

Query: 46  RKHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINAN 105
           +  N  F PA QLT+ D+NENVLKAKYAVRG IP RAEELK QL + P SLPFD+IINAN
Sbjct: 99  KTSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINAN 158

Query: 106 IGNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSV 165
           IGNPQQLQQ+PL++YRQVLSLLQYP LL+  E +   S ++K DAI RAK +++DIGGSV
Sbjct: 159 IGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSV 218

Query: 166 GAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVL 225
           GAYS SQGV GIR++VA FIT+RD GE +YPEDIFLTAGASAAVNYLLSI C+G +TGVL
Sbjct: 219 GAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVL 278

Query: 226 IPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINP 285
           IPIPQYPLYTATLALNNS ALPY+LDE +GWS NP EIE V+K+A+Q+ IKP VLVVINP
Sbjct: 279 IPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINP 338

Query: 286 GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGK 345
           GNPTGAVLS E+I  I E+AAKYG VVIADEVYQENIF G KFHS+K +LR LQRE PGK
Sbjct: 339 GNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGK 398

Query: 346 FDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDL 405
           FDNVQLASLHSTSKGVSGECGQRGGYME+ GF+HE+RQVILKLASISLCPVVTGQALVDL
Sbjct: 399 FDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDL 458

Query: 406 MVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNL 465
           MV PP  GEESF  DQA+R +IH +L  RA  L++TFNSL+GIECQKP GAMYLFPK++L
Sbjct: 459 MVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDL 518

Query: 466 PYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDS 525
           P++A+QEA+ LEL+PDEFYCK+LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG+EWI  
Sbjct: 519 PFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKK 578

Query: 526 WKQFHIEFMEKY 537
           W+ FH EF ++Y
Sbjct: 579 WESFHKEFFDQY 590

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/489 (75%), Positives = 419/489 (85%)

Query: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108
           N  F PA QLT+ D+NENVLKAKYAVRG IP RAEELK QL + P SLPF+KIINANIGN
Sbjct: 102 NNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGN 161

Query: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168
           PQQLQQ+PL++YRQVLSLLQYP LL+  E +   S ++K DAI RAK ++++IGGSVGAY
Sbjct: 162 PQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAY 221

Query: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228
           S SQGV GIRR+VA FIT+RD GE +YPEDIFLTAGASAAVNYLLSI C+G +TGVLIPI
Sbjct: 222 SSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288
           PQYPLYTATLALNNS ALPY+LDE +GWS NP EIE V+K+A+++ IK  VLVVINPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNP 341

Query: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348
           TGAVLS E+I  I E+AAKYG VVIADEVYQENIF G KFHS+K +LR LQRE PGKFDN
Sbjct: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDN 401

Query: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408
           VQLASLHSTSKGVSGECGQRGGYME+ GF+HE+RQVILKLASISLCPVVTGQALVDLMV 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468
           PP  GEESF  DQA+R +IH +L  RA  L+KTFNSL+GIECQKP GAMYLFPK++LP+R
Sbjct: 462 PPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFR 521

Query: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528
           A+QEA+ LEL+PDEFYCK+LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG+EWI  W+ 
Sbjct: 522 AVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581

Query: 529 FHIEFMEKY 537
           FH EF + Y
Sbjct: 582 FHKEFFDHY 590

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/490 (75%), Positives = 421/490 (85%), Gaps = 1/490 (0%)

Query: 48  HNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIG 107
           HN NF PA QLT+ +LN+NVLKAKYAVRG IP RAEELK QL E P+SLPFD I+NANIG
Sbjct: 78  HN-NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIG 136

Query: 108 NPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGA 167
           NPQQL Q+PLSFYRQVLSLLQYP +L   E+K  +S ++KKDA+ RAK +L +IGG+VGA
Sbjct: 137 NPQQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGA 196

Query: 168 YSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIP 227
           YS SQGVYGIR+TVANFIT+RD GEPAYPEDIFLTAGASAAV YLLSILCKG +TGVLIP
Sbjct: 197 YSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIP 256

Query: 228 IPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGN 287
           IPQYPLYTA+LALNNSHALPY+LDE +GWS NP EIE V+  A    I+P VLVVINPGN
Sbjct: 257 IPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGN 316

Query: 288 PTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFD 347
           PTGAVLS+++I  I EIAAKYGIVVIADEVYQEN+F+ +KFHS+K VLR LQ++ PG +D
Sbjct: 317 PTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYD 376

Query: 348 NVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMV 407
            VQLASLHSTSKGVSGECGQRGGYME+ GFTHEVR VILKLASISLCPVVTGQALVDLMV
Sbjct: 377 MVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMV 436

Query: 408 SPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPY 467
           SPPK+G+ESF  DQA+RK I S+L  RA  L+K FN+L+GIECQKP GAMYLFP+L+LP+
Sbjct: 437 SPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPF 496

Query: 468 RAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWK 527
           +A+Q+AQ LE+SPDEFYCK LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG EWI+ WK
Sbjct: 497 KAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWK 556

Query: 528 QFHIEFMEKY 537
            FH +F   Y
Sbjct: 557 IFHQDFYNTY 566

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/493 (73%), Positives = 420/493 (85%)

Query: 46  RKHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINAN 105
           +K + +F PA  LT+ DLNENVLKAKYAVRG IP RAEEL+ QL   P+SLPFDKI+NAN
Sbjct: 66  KKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNAN 125

Query: 106 IGNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSV 165
           IGNPQQL Q+PLSFYRQVLS+LQYP +L   E +  S  V+K+DAI RAK+IL+D+GGSV
Sbjct: 126 IGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSV 185

Query: 166 GAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVL 225
           GAYS SQGVYGIR+TVA+FITERD GEPAYPEDIFLTAGASAAV+YLLSILC+G++TGVL
Sbjct: 186 GAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVL 245

Query: 226 IPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINP 285
           IPIPQYPLYTATLALNNSH LPY+LDE +GWS N  EIE V+ ++++  I+P VLVVINP
Sbjct: 246 IPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINP 305

Query: 286 GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGK 345
           GNPTG+VLS EAI  I ++AAKYGIVVIADEVYQENIF G +FHS+K VLR+LQ+E PG 
Sbjct: 306 GNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGI 365

Query: 346 FDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDL 405
           +DNVQL SLHSTSKGVSGECGQRGGYME+ GFTHE+RQV+LKLASISLCPVVTGQALVDL
Sbjct: 366 YDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDL 425

Query: 406 MVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNL 465
           MV PPK G+ES+  D+ +R+ IH +L  RA LL  TFNSL+GIECQKP GAMYLFP++ L
Sbjct: 426 MVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKL 485

Query: 466 PYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDS 525
           PY+AIQ AQ LE +PDEFYC++LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG EWI  
Sbjct: 486 PYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKK 545

Query: 526 WKQFHIEFMEKYN 538
           W+ FH +F ++Y 
Sbjct: 546 WEDFHKKFYDQYR 558

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/489 (74%), Positives = 421/489 (86%)

Query: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108
           N  F PA QLT+ D+NENVLKA+YAVRG IP RAEELK QL + P SLPF+KIINANIGN
Sbjct: 102 NNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGN 161

Query: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168
           PQQLQQ+PL++YRQVLSLLQYP LL+  E +   S ++K DAI RAK ++KDIGGSVGAY
Sbjct: 162 PQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAY 221

Query: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228
           S SQGV GIR++VA+FIT+RDGGE AYPEDIFLTAGASAAV YLLSI C+G +TGVLIPI
Sbjct: 222 SSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPI 281

Query: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288
           PQYPLYTATLALNNS  LPY+LDE +GWS NP EIE V+K+A+Q+ IKP VLVVINPGNP
Sbjct: 282 PQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348
           TGAVLS E+I  I E+AAKYG VVIADEVYQENIF G +F+S+K VLR LQR+ PGKFDN
Sbjct: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDN 401

Query: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408
           VQLASLHSTSKGVSGECGQRGGYME+ GF+HE+RQVILKLASISLCPVVTGQALVDLMV 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468
           PP  GEESF  DQ++R +IH +L+ RA  L++TFNSL+GIECQKP GAMYLFPK+++P++
Sbjct: 462 PPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFK 521

Query: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528
           AIQEA  LEL+PDEFYCK+LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG+EW+  W+ 
Sbjct: 522 AIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEI 581

Query: 529 FHIEFMEKY 537
           FH EF ++Y
Sbjct: 582 FHKEFFDQY 590

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/487 (74%), Positives = 415/487 (85%)

Query: 51  NFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQ 110
           +F PA QLT+ DLNENVLKAKYAVRG IP RAEELK QL   P++LPF +I+NANIGNPQ
Sbjct: 100 DFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQ 159

Query: 111 QLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSE 170
           QL+Q+PLSFYRQVLS+LQYP +L   E     + VYK+DAI RAK +L +IGGSVGAYS 
Sbjct: 160 QLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSA 219

Query: 171 SQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQ 230
           SQGVYGIR+TVANFITERDGGEPAYPEDIFLT        YLLSILC+G KTGVLIPIPQ
Sbjct: 220 SQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQ 279

Query: 231 YPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTG 290
           YPLYTATLALNNSHALPY+LDE +GWS NP EIE V++ A++  I P VLVVINPGNPTG
Sbjct: 280 YPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTG 339

Query: 291 AVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQ 350
           AVL++E+I  I EIAAKYGIVVIADEVYQENI DG+KF+S+K VLR+LQ+  PGKFDNVQ
Sbjct: 340 AVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQ 399

Query: 351 LASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPP 410
           LASLHSTSKGVSGECGQRGGYME+IGFTHEVR+VILKLASISLCPVVTGQALVDLMVSPP
Sbjct: 400 LASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPP 459

Query: 411 KRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAI 470
           K+G+ S+  DQA+R+ I S+LS RA  L++TF  L+GIECQKP GAMYLFPKL+LP++A+
Sbjct: 460 KKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAV 519

Query: 471 QEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFH 530
           QEAQ LE++PDEFYCK LL+ TGICTVPGSGFGQ  GTYHLRTTFLAPG EWI  W+ FH
Sbjct: 520 QEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFH 579

Query: 531 IEFMEKY 537
            EF + Y
Sbjct: 580 KEFYDNY 586

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/492 (71%), Positives = 413/492 (83%), Gaps = 2/492 (0%)

Query: 48  HNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIG 107
           +NL F PA Q T+ D+NE VL AKYAVRG IP RAEELK QL E P+SLPF+ IINANIG
Sbjct: 85  NNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIG 144

Query: 108 NPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGA 167
           NPQQL+Q+PLSFYRQVLSLLQYP L+  +E  P +  + K+DAI RAK++L DIGGSVGA
Sbjct: 145 NPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQT--MIKQDAIDRAKRLLDDIGGSVGA 202

Query: 168 YSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIP 227
           YS SQGV GIR+TVA+FIT RD G  AYPEDIFLTAGAS+AV+YLLSI C+GE+TGVLIP
Sbjct: 203 YSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIP 262

Query: 228 IPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGN 287
           IPQYPLYTATLAL NSHALPY+L+E  GWS +P E+E++I  ++++NIKP VLVVINPGN
Sbjct: 263 IPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGN 322

Query: 288 PTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFD 347
           PTGAVLS+EAI  I  +AAKYGI+VIADEVYQEN+F+ +KFHS+K VLR+LQ + PG +D
Sbjct: 323 PTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYD 382

Query: 348 NVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMV 407
           NVQLASLHSTSKGVSGECGQRGGYME++GFTH++RQV+LKLASISLCPVVTGQALVDLMV
Sbjct: 383 NVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMV 442

Query: 408 SPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPY 467
            PP++GEES+  DQ +R+ IH +L +RA LL   F  LDGI CQKP GAMYLFPKL LPY
Sbjct: 443 CPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPY 502

Query: 468 RAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWK 527
           +AIQEA   ++SPDEFYCK LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG +WI+ W 
Sbjct: 503 KAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWV 562

Query: 528 QFHIEFMEKYNS 539
            FH EF  K+ +
Sbjct: 563 DFHQEFYNKFKN 574

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/486 (71%), Positives = 412/486 (84%), Gaps = 1/486 (0%)

Query: 52  FKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQ 111
           F+PA +L++ DLNENVL+AKYAVRGKIP +AEELK QLA  P SLPFD+IINANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 112 LQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSES 171
           L Q+PL+FYRQVLSLLQ P +L  I  +   S +YK DAI RA ++L +IGGSVGAYS S
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEI-PREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHS 163

Query: 172 QGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQY 231
           QGVYG R+TVA+FIT+RDGGE AY EDIFLTAGASAAV+Y+LSILC+G +TGVLIPIPQY
Sbjct: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223

Query: 232 PLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGA 291
           PLYTA+LALNNSHALPY+LDE + WS NP EIE V+  ++   ++P  LVVINPGNPTGA
Sbjct: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283

Query: 292 VLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQL 351
           +LS E+I  I E+AAKYGIVVIADEVYQEN+F+G +FHS++ VL+ LQR+  GKFDN+QL
Sbjct: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343

Query: 352 ASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPK 411
           ASLHSTSKGVSGECGQRGGYME++GF+H+VRQV LKLASISLCPVVTGQALVDLMV PPK
Sbjct: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403

Query: 412 RGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQ 471
            G+ S+  DQ +R  IH  L  RA +L++TFN L+GIECQKP GAMYLFP+L+L Y+A+Q
Sbjct: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463

Query: 472 EAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHI 531
           +A+ L LSPDEFYC+ELLE TGICTVPGSGFGQV GTYHLRTTFLAPG +WI +W++FH 
Sbjct: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523

Query: 532 EFMEKY 537
           +F  +Y
Sbjct: 524 KFYNEY 529

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/484 (72%), Positives = 407/484 (84%)

Query: 54  PAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQLQ 113
           PA +L + ++NENVLKAKYAVRG IP  A EL  +L + P+SLPFD I++ANIGNPQ L+
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 114 QQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSESQG 173
           Q+PL+FYRQVLSLLQYP LL   E     S +Y+KDAI RA+++L DIG SVGAYS SQG
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168

Query: 174 VYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPL 233
           + GIR TVA FITERDGGE AY EDIFLTAGAS+AV+YLLSILCKG++TGVLIPIPQYPL
Sbjct: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228

Query: 234 YTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVL 293
           YTA+LALNNSH LPY+LDE +GWS NP EIE+V+  A++ NIKP VLVVINPGNPTGAVL
Sbjct: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288

Query: 294 SKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLAS 353
           S+E I  I  IAAKYGIVVIADEVYQEN+FDG +FHS+K +LR+LQ+  PG FDNVQLAS
Sbjct: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348

Query: 354 LHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRG 413
           LHSTSKGVSGECGQRGGYMEI GF +++RQVILKLASISLCPVVTGQALVDLMVSPPK G
Sbjct: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408

Query: 414 EESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQEA 473
           +ES+ LDQ +RK+IH  L++RA  L  TFNSL+GIECQKP GAMYLFP+L LP++AIQ A
Sbjct: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468

Query: 474 QRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHIEF 533
           +   ++PD FYCK+LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG EWI+ W+ FH  F
Sbjct: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528

Query: 534 MEKY 537
            E+Y
Sbjct: 529 YEEY 532

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/491 (69%), Positives = 410/491 (83%), Gaps = 2/491 (0%)

Query: 47  KHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANI 106
           + +   KPA +L++ D+NENVLKAKYAVRG+IP RAEEL+ QL + P+SLPF KII+ANI
Sbjct: 38  RFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANI 97

Query: 107 GNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVG 166
           GNPQQL Q+PL+FYR+VLSLLQ+P LL   E       +YK D+I RAK++L ++GGSVG
Sbjct: 98  GNPQQLDQKPLTFYREVLSLLQHPELLE--EADEALQTLYKTDSIKRAKRLLSEVGGSVG 155

Query: 167 AYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLI 226
           AYS+SQGV GIR TVA+FIT+RD GE +YPEDI+LTAGASAAV+Y+LSILCKG  TGVLI
Sbjct: 156 AYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLI 215

Query: 227 PIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPG 286
           PIPQYPLYTA+LALNNS  LPY+L E   WS +P EIE V+  A+Q  IKP  LVVINPG
Sbjct: 216 PIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG 275

Query: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKF 346
           NPTGA+LS+++I  I E+AAKYGIVVIADEVYQEN+F G KF+S+K VLR LQ+   G++
Sbjct: 276 NPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQY 335

Query: 347 DNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLM 406
           DN+QLASLHSTSKGVSGECGQRGGYME++GF H++RQV LKLASISLCPVVTGQALVDLM
Sbjct: 336 DNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLM 395

Query: 407 VSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLP 466
           VSPP+ G+ES+  DQ +R+ IH  L +RA  L++TF+ L+GIEC+KP GAMYL+PKL+LP
Sbjct: 396 VSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLP 455

Query: 467 YRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSW 526
           Y+ IQEAQ LE+ PDEFYCK LLE+TGICTVPGSGFGQV GTYHLRTTFL PG EW+++W
Sbjct: 456 YKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETW 515

Query: 527 KQFHIEFMEKY 537
           ++FH  F +KY
Sbjct: 516 EKFHKAFFDKY 526

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/492 (69%), Positives = 415/492 (84%), Gaps = 4/492 (0%)

Query: 47  KHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANI 106
           KH  NFKPA +LTI DLNENVLKAKYAVRGKIP RAE LK+QL + P+SLPF K+INANI
Sbjct: 32  KHK-NFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANI 90

Query: 107 GNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSS-AVYKKDAILRAKKILKDIGGSV 165
           GNPQQL Q+PL+FYRQVLSLLQYP +L   ET  G++  +YK+DAI RAK+IL DIG SV
Sbjct: 91  GNPQQLNQKPLTFYRQVLSLLQYPMVLD--ETFSGNTKTLYKQDAIERAKRILNDIGSSV 148

Query: 166 GAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVL 225
           G+YS SQGV+G+R+TVA +I+ RDGGE AY EDIFLTAGAS+AV+YLL+ILCKG+++GVL
Sbjct: 149 GSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVL 208

Query: 226 IPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINP 285
           IPIPQYPLYTATLALNN++ALPY+L+E +GWS N  EIENV+  A+++ I P VLVVINP
Sbjct: 209 IPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINP 268

Query: 286 GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGK 345
           GNPTGA+LS E+I  I ++AA +GIVVIADEVYQENIF G +FHS+K VLR LQR +PGK
Sbjct: 269 GNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGK 328

Query: 346 FDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDL 405
           ++NVQLASLHSTSKGVSGECGQRGGYME+ GF+ E++  ILKL SISLCPVVTGQALVDL
Sbjct: 329 YENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDL 388

Query: 406 MVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNL 465
           M  PPK+GE S+  DQ +R TIHS+L +RA  LWK FN ++G+ CQKP G+MYLFPK+++
Sbjct: 389 MTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDI 448

Query: 466 PYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDS 525
           P++A+++AQ L+++PDE YC ELLE TGICTVPGSGFGQ  GT+HLRTTFLAPG  WID 
Sbjct: 449 PHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQ 508

Query: 526 WKQFHIEFMEKY 537
           W++FH  F  KY
Sbjct: 509 WREFHQIFCNKY 520

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/491 (68%), Positives = 404/491 (82%), Gaps = 8/491 (1%)

Query: 47  KHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANI 106
           +H  N  PA +L + DLN+NVLKAKYAVRG IP RAEELK  L E    LPFD +INANI
Sbjct: 28  EHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL-EAGQKLPFDTVINANI 86

Query: 107 GNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVG 166
           GNPQQL+Q+PL+FYRQVLS+LQYP LL +       S ++KKDAI RA+K+LK+IG SVG
Sbjct: 87  GNPQQLKQKPLTFYRQVLSILQYPELLES------GSNIFKKDAIERARKLLKEIG-SVG 139

Query: 167 AYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLI 226
           +YS SQG+  IR+TVANFIT+RD GE + P DIFLTAGAS+AV+YLLSILCK EK+GVLI
Sbjct: 140 SYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLI 199

Query: 227 PIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPG 286
           PIPQYPLYTATLALNN+HALPY+LDE  GWS +  EIE VI  ++   IKP  LV+INPG
Sbjct: 200 PIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPG 259

Query: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKF 346
           NPTG++LS E++  I+E+AA +GIV+IADEVYQEN+F+  KFHS+K VLR LQ+  PG++
Sbjct: 260 NPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEY 319

Query: 347 DNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLM 406
           D VQLASLHSTSKGVSGECGQRGGYME+ GF  E++QVILKL SISLCPVVTGQALVDLM
Sbjct: 320 DTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLM 379

Query: 407 VSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLP 466
           VSPP++G+ES+  DQ +R TI + LS RA LLW+ FNS++G+ CQKP GAMYLFPK++LP
Sbjct: 380 VSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLP 439

Query: 467 YRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSW 526
           ++ +Q++Q L+++PDEFYCK LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG EWID W
Sbjct: 440 FKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRW 499

Query: 527 KQFHIEFMEKY 537
            +FH EF +KY
Sbjct: 500 NKFHAEFYDKY 510

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/492 (66%), Positives = 403/492 (81%), Gaps = 3/492 (0%)

Query: 47  KHNLNFKPAG-QLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINAN 105
           K +L+ K  G + T+ D+N+ VL AKYAVRG IP RAEEL+ +L E+P SLPF+KIINAN
Sbjct: 28  KSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINAN 87

Query: 106 IGNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSV 165
           IGNPQQL Q+PL+FYRQVLSLLQ P L+ ++ T      ++K DA+ RAKK+LK +GGSV
Sbjct: 88  IGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGE-LHKLFKPDAVERAKKMLKQVGGSV 146

Query: 166 GAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVL 225
           GAYS SQGV G R++VA FI ERDG EPA   DIFLTAGAS+AV+ +LS+ C G + G L
Sbjct: 147 GAYSASQGVAGFRQSVAEFIEERDG-EPASANDIFLTAGASSAVSAILSMFCTGSENGAL 205

Query: 226 IPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINP 285
           IPIPQYPLYTATLALN++HALPY+LDE +GWS++  ++E V+K A++  ++P  LVVINP
Sbjct: 206 IPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINP 265

Query: 286 GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGK 345
           GNPTGA+LS EAI  IL +AAKY +VVIADEVYQEN FD   F S+K VLR LQ+  PGK
Sbjct: 266 GNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGK 325

Query: 346 FDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDL 405
           +DNVQLASLHSTSKGVSGECGQRGGYME++GF+ EV+QV LKLASISLCPVVTGQALVDL
Sbjct: 326 YDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDL 385

Query: 406 MVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNL 465
           MV PPK+G+ S+ LD+ +R  IH+ L Q++ LL++TF SL+G+ CQKP GAMYLFPKL+L
Sbjct: 386 MVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDL 445

Query: 466 PYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDS 525
             +AI++A+ L ++PDE+YCKELLE TGICTVPGSGF QV GTYHLRTTFLAPG EW+DS
Sbjct: 446 SRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDS 505

Query: 526 WKQFHIEFMEKY 537
           WK+FH +F++++
Sbjct: 506 WKKFHQKFVDEH 517

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/490 (63%), Positives = 398/490 (81%), Gaps = 1/490 (0%)

Query: 48  HNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIG 107
            N +F+PA +L++ D+NENV+ AK+A+RG I  +AE+L+ QL + P+ LPFD+I  ANIG
Sbjct: 7   ENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIG 66

Query: 108 NPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGA 167
           NPQ+L Q+PL+F RQV+S+LQYP LL+  +       ++  D+  RA+++L+DIGGSVGA
Sbjct: 67  NPQELNQKPLTFARQVVSILQYPELLNNRDVLT-KEKIFNSDSFDRAERLLRDIGGSVGA 125

Query: 168 YSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIP 227
           YS SQGVYGIR+T A +IT+RDGGEP+YPEDIFLT GA++A +YLLS+LC+G +TGVLIP
Sbjct: 126 YSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIP 185

Query: 228 IPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGN 287
           IPQYPLYTATLALN S  +PY+LDE + WS N  EIE ++  +++  IKP V+VVINPGN
Sbjct: 186 IPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGN 245

Query: 288 PTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFD 347
           PTGAVLS+ AI  I +IAAKYGIVV+ADEVYQENIFDG++FHS K VLR LQ++ PGKFD
Sbjct: 246 PTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFD 305

Query: 348 NVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMV 407
           N+QLAS+HSTSKGV GECGQRGGYME++GFT EVRQ++LKLA +++C VVTGQA+VDLM+
Sbjct: 306 NIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLML 365

Query: 408 SPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPY 467
            PPK+G+ S+ LD+ +R+ I   + +RA  L+  F+ LDGIECQKP GAMYL+P L L  
Sbjct: 366 LPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSK 425

Query: 468 RAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWK 527
           +AI +A+ L L+PDEFYC ELL+ TGICTVPGSGFGQ  GTYHLRTTFLAPGIEWI+ W+
Sbjct: 426 KAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWE 485

Query: 528 QFHIEFMEKY 537
           +FH  F EKY
Sbjct: 486 KFHKHFYEKY 495

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/489 (66%), Positives = 389/489 (79%), Gaps = 4/489 (0%)

Query: 51  NFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLA--EKPNSLPFDKIINANIGN 108
           NFKPA ++T+ DLN+NVLK++YAVRG IP RAEEL+ +L   +  +SL F+ I++ANIGN
Sbjct: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86

Query: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168
           PQQL Q+PL+F RQV+S+LQYP LL+       S+ ++K DA+ RA+ +L  IGGSVGAY
Sbjct: 87  PQQLDQKPLTFSRQVISILQYPELLNQRNILV-STGIFKSDAMERAETLLCHIGGSVGAY 145

Query: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228
           S SQGVYGIR TVAN+IT RD GE A P+DIFLT GAS A +YLLS+LCK + TGVLIPI
Sbjct: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPI 205

Query: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288
           PQYPLYTAT+ L ++  LPY+L+E +GWS N  EIE V+  A+ DN+KP V+VVINPGNP
Sbjct: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265

Query: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348
           TG+VLSK+ I+ I+ I AKYGIV+IADEVYQENIFDG +FHS+K VLR LQ++ PGK+D 
Sbjct: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDA 324

Query: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408
           VQLASLHSTSKGVSGECGQRGGYME++GF  E+RQ ILKLASISLC V+TGQALVDLMV+
Sbjct: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384

Query: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468
           PPK+G+ES+ LD  +RK IH  L +RAE L+  F  L G+ECQKP GAMYLFPKL+ P  
Sbjct: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444

Query: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528
            I EA    +SPDEFYC  LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG +W + WK 
Sbjct: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504

Query: 529 FHIEFMEKY 537
           FH EF  KY
Sbjct: 505 FHEEFFSKY 513

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/491 (63%), Positives = 387/491 (78%)

Query: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108
           +LNFKPA ++T  DLN  V KA+YAVRG IPTRA+ELK +L  KP  LPFD IINANIGN
Sbjct: 17  DLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGN 76

Query: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168
           PQQL Q+PL+F RQVLS+L+YP +L     K  S  +++KDA+ RA+ +L+DIGGS+GAY
Sbjct: 77  PQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAY 136

Query: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228
           S SQGV GIR++VA FIT+RD GEPA PE+I+LT GAS+A   LLS+LCK  +TG+LIPI
Sbjct: 137 SHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPI 196

Query: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288
           PQYPLYTA+ +L N+  LPY+LDE + WS    EIE V+K A++  IKP VL+VINPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256

Query: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348
           TGAVLS++ I  I  IAAKYGI +I+DEVYQEN+F+G+KFHS+K VLR+LQR  PGKFDN
Sbjct: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDN 316

Query: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408
           VQLASLHS SKG  GECGQRGGYME++GF+ ++R  + KL SIS+C VVTGQA+VDLMV 
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVK 376

Query: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468
           PP+ G+ES+  D ++R  I  ++  RA LL +TFN L+GIECQKP GAMYLFP+L LP +
Sbjct: 377 PPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEK 436

Query: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528
           A++E++RL + PDEFYC  LLE TGICTVPGSGFGQ  GTYH+RTTFLAPG +WI  WK 
Sbjct: 437 ALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKH 496

Query: 529 FHIEFMEKYNS 539
           FH +F  KY  
Sbjct: 497 FHQDFFNKYRD 507

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/491 (63%), Positives = 386/491 (78%)

Query: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108
           +L+FKPAG++T  DLN  V KA+YAVRG IPTRA+ELK +L + P  LPFD IINANIGN
Sbjct: 17  DLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGN 76

Query: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168
           PQQL Q+PL+F RQVL++L+YP +L     +  S  ++ +DA+ RA+++L DIGGS+GAY
Sbjct: 77  PQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAY 136

Query: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228
           S SQGV GIR+TVA+FIT RDGGEPA PEDI+LT GAS+A   LLS+LCK  +TG+LIPI
Sbjct: 137 SHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPI 196

Query: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288
           PQYPLYTA+ +L N+  LPY+LDE + WS N  EIE V++ A++  I+P VL+VINPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256

Query: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348
           TGAVLS+E I  I  IAAKYGI +I+DEVYQENIF+ +KFHS+K VLR+LQ   PGKFDN
Sbjct: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDN 316

Query: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408
           VQLASLHS SKG   ECGQRGGYMEIIGF+ E+R  + KL SIS+C VVTGQA+VDLMV 
Sbjct: 317 VQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVK 376

Query: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468
           PP+ G+ES+  D  +R  I  ++  RA LL++TF  L+GIECQKP GAMYLFP+L LP +
Sbjct: 377 PPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKK 436

Query: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528
           A+ E++RL + PDEFYC  LLE TGICTVPGSGFGQ  GTYH+RTTFLAPG +WI  WK+
Sbjct: 437 ALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKE 496

Query: 529 FHIEFMEKYNS 539
           FH +F  KY +
Sbjct: 497 FHQDFFSKYRN 507

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/489 (64%), Positives = 385/489 (78%)

Query: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108
           +L+FKPA ++T  DLN +V KA+YAVRG IPTRA+ELK +L + P  LPFD IINANIGN
Sbjct: 17  DLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGN 76

Query: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168
           PQQL Q+PL+F RQVLS+L+YP +L     K  S  ++ KDA+ RA+ +LKDIGGSVGAY
Sbjct: 77  PQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAY 136

Query: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228
           S SQGV GIR+TVA+FIT RDGGEPA PEDI+LT GAS+A   LLS+LCK  +TG+LIPI
Sbjct: 137 SHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPI 196

Query: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288
           PQYPLYTA+ +L N+  LPY+LDE   WS    EIE V++ A++  I+P VL+VINPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256

Query: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348
           TGAVL++E I  I  IAAKYGI VI+DEVYQEN+F+  KFHS+K VLR+LQ   PGKFDN
Sbjct: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDN 316

Query: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408
           VQLASLHS SKG  GECGQRGGYMEI+GF+ ++R  + KL SIS+C VVTGQA+VDLMV+
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVN 376

Query: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468
           PP+ G+ES+  D+ +R  I +++  RA LL++TFN L+GIECQ P GAMYLFP+L LP +
Sbjct: 377 PPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDK 436

Query: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528
           A +E++RL + PDEFYC  LLE TGICTVPGSGFGQ  GTYH+RTTFLAPG +WI +WK 
Sbjct: 437 AFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKN 496

Query: 529 FHIEFMEKY 537
           FH  F  +Y
Sbjct: 497 FHQSFFNEY 505

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/489 (63%), Positives = 384/489 (78%)

Query: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108
           +L+FKPA +LT  DLN +V KA+YAVRG IPTRAEELK +L    NSLPF+ IINANIGN
Sbjct: 17  DLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGN 76

Query: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168
           PQQL Q+PL+F RQVLS+L+YP +L     K  S  ++ KDA+ RA+++L DIGGSVGAY
Sbjct: 77  PQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAY 136

Query: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228
           S SQGV GIR+TVA+FITERDGGEPA PEDI+LT GAS+A   LLS+LCK  +TG+L+PI
Sbjct: 137 SHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPI 196

Query: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288
           PQYPLYTA+ +L N+  LPY+LDE   WS    EIE V+  A++  I+P VLVVINPGNP
Sbjct: 197 PQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNP 256

Query: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348
           TGAVL++  I  I  IAAKYGI +I+DEVYQENIF  +KFHS+K +LR+LQ   PGKFDN
Sbjct: 257 TGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDN 316

Query: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408
           VQLASLHS SKG  GECGQRGGYMEI+GF+ ++R  + KL SIS+C V TGQA++DLMV 
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVK 376

Query: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468
           PP+ G+ES+  D+ +R  I++++  RA LL++TFN L+GI+CQKP GAMYLFPKL LP +
Sbjct: 377 PPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEK 436

Query: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528
           A++E++RL + PD  YC  LLE TGICTVPGSGFGQ +GTYH+RTTFL PG +WI  W+Q
Sbjct: 437 ALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQ 496

Query: 529 FHIEFMEKY 537
           FH +F  KY
Sbjct: 497 FHQDFFNKY 505

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/486 (65%), Positives = 393/486 (80%), Gaps = 3/486 (0%)

Query: 53  KPAG-QLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQ 111
           KP G + T+ D+NE VL AKYAVRG IP RAEELK++L E+P SLPFDKIINANIGNPQQ
Sbjct: 33  KPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQ 92

Query: 112 LQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSES 171
           L Q+PL+FYRQVL+LLQ P L+  + +       +K DA+ RAKK+LK +GGSVGAYS S
Sbjct: 93  LDQKPLTFYRQVLALLQNPDLISDLSSGE-LHKFFKPDAVERAKKMLKQVGGSVGAYSNS 151

Query: 172 QGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQY 231
           QGV G R +VA FI ERDG EPA  +DIFLT GAS AV+Y+LS+ C G + G LIPIPQY
Sbjct: 152 QGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQY 210

Query: 232 PLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGA 291
           PLYTA+LALNNSHALPY+LDE +GWS++  +IE V++ +++  I+P  LVVINPGNPTGA
Sbjct: 211 PLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGA 270

Query: 292 VLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQL 351
           +L+ + I +++++AAKY +V+IADEVYQEN F+  +F S+K VLR LQ+  PGK+DNVQL
Sbjct: 271 LLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQL 330

Query: 352 ASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPK 411
           ASLHSTSKGVSGECGQRGGYME++GF+ EV+QV LKLASISLCPVVTGQAL+DLMV PPK
Sbjct: 331 ASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPK 390

Query: 412 RGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQ 471
           +G+ S+  D+ +R  IH  L +R+ LL++ F S++G+ CQ+P GAMYLFPKL L  +AI 
Sbjct: 391 KGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIH 450

Query: 472 EAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHI 531
           +A+   L+PDE+YCKELLE TGICTVPGSGFGQV GT+HLRTTFLAPG EWIDSWK+FH 
Sbjct: 451 KAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHE 510

Query: 532 EFMEKY 537
           +F E +
Sbjct: 511 KFTEDH 516

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/483 (65%), Positives = 390/483 (80%), Gaps = 2/483 (0%)

Query: 55  AGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQLQQ 114
           A +L   DLN NV+KAKYAVRG IP+ A++LK QL + P +LPF+ +IN+NIGNPQQL Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 115 QPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSESQGV 174
           +PLSF RQVLS+L+YP LL    T   S   Y  D+I RAK +L DIG S+GAYS SQGV
Sbjct: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMG-YAPDSIERAKTLLTDIG-SIGAYSNSQGV 198

Query: 175 YGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLY 234
           +GIR+TVA+FIT RD GE AYP+DIFLTAGAS+AV+ +LSILCKG++TGVLIPIPQYPLY
Sbjct: 199 HGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLY 258

Query: 235 TATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLS 294
           TATL LN++ ALPY+LDE NGWS +  EI  V + +++  IKP  LVVINPGNPTG+VL+
Sbjct: 259 TATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLT 318

Query: 295 KEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASL 354
            EAI ++ ++AAKYG+VVIADEVYQ+NIF G +FHS+K +LR LQ+E+P K+DN+QLASL
Sbjct: 319 VEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASL 378

Query: 355 HSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGE 414
           HS SKG+ GECG RGGY E IGFT EV+QVI KL+SISLC  V GQALVDLM  PPK+GE
Sbjct: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438

Query: 415 ESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQEAQ 474
            S+ LDQ +R+TI +   +R+  L++ FNSL+G+ CQKP GAMY+FP + LP+ AI+ AQ
Sbjct: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498

Query: 475 RLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHIEFM 534
            L+++PDEFYC+ELL+ TGICTVPGSGFGQ  GTYH+RTTFLAPG+EW+  W++FHIEF 
Sbjct: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558

Query: 535 EKY 537
           EKY
Sbjct: 559 EKY 561

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/506 (62%), Positives = 392/506 (77%), Gaps = 10/506 (1%)

Query: 41  SNPKPRKHN--------LNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEK 92
           S+ K R+H         L F+PA +L   DLN+N++ A+YAVRG IP +AEEL+ QL+++
Sbjct: 15  SSSKKRQHTGDDSTVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQ 74

Query: 93  PNSLPFDKIINANIGNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAIL 152
           P+ LPF+ I  ANIGNPQQL Q+PL+F RQV+S+LQYP LL   E +  +S  YK+DA  
Sbjct: 75  PDLLPFNAITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLD-YEEQLVTSGAYKRDAFK 133

Query: 153 RAKKILKDIGGSVGAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYL 212
           RA  +L+ IGGSVGAYS +QGVYGIR +VA+FIT RD GE A P+DIFLT GAS A  YL
Sbjct: 134 RAAVLLEQIGGSVGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYL 193

Query: 213 LSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQ 272
           LSILC+   TG++IPIPQYPLYTA++ + NS  LPY+LDE +GWS    EIE  +  +++
Sbjct: 194 LSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIK 253

Query: 273 DNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVK 332
             + P V+VVINPGNPTGAVLS + I  IL IAAKYGIVV+ADEVYQ NI+ G+KFHS+K
Sbjct: 254 RGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMK 313

Query: 333 GVLRRLQREIP-GKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASI 391
            VLR LQR+ P G++DNVQLAS+HSTSKGVSGECGQRGGYME++GF++EVRQVILKLASI
Sbjct: 314 KVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASI 373

Query: 392 SLCPVVTGQALVDLMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQ 451
           S+C VVTGQALVDLM++PP+ G++S+ LD  +RK IH+ +  R  LL+ TF  L+GIECQ
Sbjct: 374 SICSVVTGQALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQ 433

Query: 452 KPNGAMYLFPKLNLPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHL 511
           +P GAMYLFPKL L  +AI+EA+ L L PDEFYC  LL+ TGICTVPGSGFGQ  GTYH+
Sbjct: 434 EPQGAMYLFPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHV 493

Query: 512 RTTFLAPGIEWIDSWKQFHIEFMEKY 537
           RTTFLAPG +WI  W+ FH  F +KY
Sbjct: 494 RTTFLAPGTQWIKDWETFHKAFYDKY 519

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/489 (62%), Positives = 393/489 (80%), Gaps = 4/489 (0%)

Query: 51  NFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEK--PNSLPFDKIINANIGN 108
           +F+PA ++++ DLN+ ++ A+YAVRG I  RAEEL+ +L  K  P+S PF++II ANIGN
Sbjct: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82

Query: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168
           PQQL Q+PL+F RQV+S+L+YP LL   +    S  +YKKDA+ RA+ +   IG SVGAY
Sbjct: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFKDVLL-SQGIYKKDALERAELLQSQIGASVGAY 141

Query: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228
           S +QGVYGIR T A FI++RD  E A  +DIFLT GAS AV YL+  LC+ E TG+LIPI
Sbjct: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201

Query: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288
           PQYPLYTA++ ++N+  LPY+LDE +GWS    EIEN +  A+++ IKP  +VVINPGNP
Sbjct: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261

Query: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348
           TGAVLS + I  I+ +AAKYGIV+IADEVYQ+NIF+G +FHS+K +LR+LQ++ PGK+DN
Sbjct: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320

Query: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408
           VQLASLHSTSKGVSGECGQRGGYMEI+GF+ EVR ++LKLASI++C VVTGQALVDLMV 
Sbjct: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380

Query: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468
           PP  G+ES+  DQ +R  IHS L +RA+ L+ TF++L+GIECQKP GAMYLFP+L LP R
Sbjct: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440

Query: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528
           AI+EA++L++  DEFYC +LLE+TGICTVPGSGFGQ  GTYH+RTTFL+PG EWID WK+
Sbjct: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500

Query: 529 FHIEFMEKY 537
           FH +FM++Y
Sbjct: 501 FHEKFMKEY 509

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/489 (61%), Positives = 395/489 (80%), Gaps = 2/489 (0%)

Query: 51  NFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQ 110
           +F+PA +L+I DLN NV+KA++AVRG IP +A+EL+ QL + P+SLPF++I  ANIGNPQ
Sbjct: 12  DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQ 71

Query: 111 QLQQQPLSFYRQVLSLLQYPTLLHAI-ETKPGSSAVYKKDAILRAKKILKDIGGSVGAYS 169
           +L Q+PL+F RQV+S+LQYP LL+   E    +  +Y  D+  RA+K+L +IGGSVGAYS
Sbjct: 72  ELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYS 131

Query: 170 ESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIP 229
            SQGVYGIR+T+AN+IT+RD GE A P DIF+T GA+AA +YLLSIL  G +TGVL+PIP
Sbjct: 132 ASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIP 191

Query: 230 QYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKK-AVQDNIKPDVLVVINPGNP 288
           QYPLYTA LAL+N+  LPY+L+E +GWSI+  EIE  IKK A+   I+P V+V+INPGNP
Sbjct: 192 QYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNP 251

Query: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348
           TG++LS+++++ I  IAAKYGIV+IADEVYQEN+F+G KFHS K VLR LQ++ P +++N
Sbjct: 252 TGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNN 311

Query: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408
           VQLASLHSTSKG+ GECGQRGGYMEIIGF ++VR +ILKLA I +CPVVTGQA++DLM+ 
Sbjct: 312 VQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMIL 371

Query: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468
           PPK+G++S+ LD  +R+ IH+ +  RA+ L+  F+ ++GI+CQKP GAMYLFP+L L  +
Sbjct: 372 PPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTK 431

Query: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528
            I EA++ E+ PDEFYC ELL  TGICTVPGSGFGQ   TYHLRTTFLAPG +WI+ W++
Sbjct: 432 VIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEK 491

Query: 529 FHIEFMEKY 537
           FH  F+++Y
Sbjct: 492 FHKAFLKRY 500

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/496 (59%), Positives = 387/496 (78%), Gaps = 4/496 (0%)

Query: 47  KHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANI 106
           +H  +F P  ++T+ DLN  ++K +YAVRG IP RAEELK QL + P SLPF+KIINANI
Sbjct: 4   EHFTDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANI 63

Query: 107 GNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSA---VYKKDAILRAKKILKDIGG 163
           GNPQQL Q+PLSF R+VLS+LQYP +L   E+K  +     VY+KD + RA+K+L +IGG
Sbjct: 64  GNPQQLGQKPLSFIRKVLSILQYPDILED-ESKLQTLIELRVYQKDVVRRARKLLGEIGG 122

Query: 164 SVGAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTG 223
           SVGAYS SQGV GI++TVA++IT+RD GE AYPEDIFLT GAS+AV+++L + C G  TG
Sbjct: 123 SVGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTG 182

Query: 224 VLIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVI 283
           VLIPIPQYPLYTAT+ L  + A+ Y+L+E + WS+N +E+EN I+++++  IKP  +V+I
Sbjct: 183 VLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVII 242

Query: 284 NPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIP 343
           NPGNPTG++L+++ I +I+ I+AKYG+++IADEVYQEN+F G +FHSVK VLR+LQR+  
Sbjct: 243 NPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYL 302

Query: 344 GKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALV 403
           G ++ VQLASLHSTSKG+ GECGQRGGYME+IG T +VR  ++KL SIS+C VVTGQAL+
Sbjct: 303 GFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALI 362

Query: 404 DLMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKL 463
           D++VSPP+ G+ES+ +DQ +R  I + L  R++ L + F SL+G+EC +P GAMYLFPK 
Sbjct: 363 DMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKF 422

Query: 464 NLPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWI 523
             P + I  AQ+L    D  YCKELLEHTGICTVPGSGFGQ   TYHLRTTFL PG  WI
Sbjct: 423 IFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWI 482

Query: 524 DSWKQFHIEFMEKYNS 539
           D W++FH EF E+Y S
Sbjct: 483 DLWRKFHTEFCERYRS 498

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/489 (61%), Positives = 384/489 (78%), Gaps = 5/489 (1%)

Query: 50  LNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNP 109
           + F+P   L + DLN NVL+AKYAVRGKIP RA EL+RQL+  P+SLPF KII ANIGNP
Sbjct: 48  IRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNP 107

Query: 110 QQLQQQPLSFYRQVLSLLQYPTLLHA-IETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168
           QQL Q+PLSF R+VLSLL+ P LL   +E     + +YK DA+ RAK++++D+  S+GAY
Sbjct: 108 QQLGQKPLSFSREVLSLLESPNLLQMPMEVL---NLIYKPDAVRRAKRMMRDLQTSIGAY 164

Query: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228
           S SQGV G R+TVA +++ RDG EPA  EDIFLT GAS   + ++ +LCKG+++GVLIPI
Sbjct: 165 SHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223

Query: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288
           PQYPLYTAT+ LNN+ ALPY+LDE +GWS+N  ++E +I ++++  +KP  LVVINPGNP
Sbjct: 224 PQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNP 283

Query: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348
           TGA+L  E++  I  IAAKY IVVIADEVYQEN+F+G+KF+S+K VLR LQR     F N
Sbjct: 284 TGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSN 343

Query: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408
           VQL SLHSTSKG+SGECGQRGGYME++GF+ ++R+VILK+ASI LC  V GQALVDLM+S
Sbjct: 344 VQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLS 403

Query: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468
            PK G+ES+  D ++R +I + L +R++ LW+TFN+L+G+EC+KP G+MYLFP+L LP +
Sbjct: 404 RPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQK 463

Query: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528
           AI+ A+ L++ PDEFYC ELL  TGICTVPGSGFGQ   T HLRTTFL PG EWI+SW+ 
Sbjct: 464 AIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWEL 523

Query: 529 FHIEFMEKY 537
           FH  F +KY
Sbjct: 524 FHKSFYDKY 532

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/492 (61%), Positives = 381/492 (77%), Gaps = 3/492 (0%)

Query: 50  LNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNP 109
           ++F PA +L++ DLN++ + A YAVRG IP RAE+L  Q+   P SLPFDKII ANIGNP
Sbjct: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60

Query: 110 QQLQQQPLSFYRQVLSLLQYPTLLHAIE--TKPGSSAVYKKDAILRAKKILKDIGGSVGA 167
           QQ+ Q+PL+F RQVLS+L+YP +L+  E   K     VY++D I RA+K+L  IGGSVGA
Sbjct: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120

Query: 168 YSESQGVYGIRRTVANFITERDGGEP-AYPEDIFLTAGASAAVNYLLSILCKGEKTGVLI 226
           YS SQGV G R+TVA+FI +RDG +  A P DIFLT GAS+AV+YLLSILC G + GVLI
Sbjct: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180

Query: 227 PIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPG 286
           PIPQYPLYTATL L+NS A+PY+L E   WS N  EIE  IK+++ + +KP  +V+INPG
Sbjct: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240

Query: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKF 346
           NPTGA+LS+  +  I+ I+AKYGI +IADEVYQENIF G +FHS++ VL  LQ E PG +
Sbjct: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300

Query: 347 DNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLM 406
           DNVQLASLHSTSKG  GECGQRGGYME+IGF  EV  ++LKLASIS+C VVTGQAL+DL+
Sbjct: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360

Query: 407 VSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLP 466
             PP+ G+ S+ LDQ +R  I   L  RA+ L+  F SL+G+ECQ+P GAMYLFPKL LP
Sbjct: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420

Query: 467 YRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSW 526
            +AI++A +LE+ PDE+YC+ELL+ TGICTVPGSGFGQ  GTYHLRTTFL PG EWI+ W
Sbjct: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480

Query: 527 KQFHIEFMEKYN 538
           ++FH +F E+++
Sbjct: 481 REFHQQFYERFS 492

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/493 (63%), Positives = 386/493 (78%), Gaps = 7/493 (1%)

Query: 47  KHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANI 106
           K    F PA  +T+ D+NENV+KAKYAVRGKIPTRAEEL+R+L E P SLPF KII ANI
Sbjct: 32  KDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANI 91

Query: 107 GNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGS--SAVYKKDAILRAKKILKDIGGS 164
           GNPQQL Q+PL+FYRQV+SL+Q P LL      P       +K D ++RA+++L+D GGS
Sbjct: 92  GNPQQLGQKPLTFYRQVISLMQNPQLLEM----PAEWLQQAFKADVVVRARRMLQDAGGS 147

Query: 165 VGAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGV 224
           VGAYS SQGV G RRTVA FI  RDG  PA P++++LTAGAS+AV+ LLS  CKG +TGV
Sbjct: 148 VGAYSASQGVKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGV 206

Query: 225 LIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVIN 284
           LIPIPQYPLYTAT+  NN+ ALPY+L+E +GWS NP E+E VI  + + NI P  LVVIN
Sbjct: 207 LIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVIN 266

Query: 285 PGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPG 344
           PGNPTG+VLS + + +IL +AAKYGIVVIADEVYQ+N+F   KFHS++ VL+ LQ   P 
Sbjct: 267 PGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPT 326

Query: 345 KFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVD 404
            + NVQLASLHS SKG+SGECGQRGGYME+IGF  E+R+V +KLASISLCPVVTGQALVD
Sbjct: 327 LYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVD 386

Query: 405 LMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLN 464
           LMV PP +G+ S+     + ++I+ +L +R++LLWKTF SL+GIEC  P GA+YLFPKL+
Sbjct: 387 LMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLH 446

Query: 465 LPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWID 524
           LP +AI+ AQ+L +  DE YC ELL+ TGICTVPG+GFGQ+ GTYH+RTTFL PG +WI+
Sbjct: 447 LPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIE 506

Query: 525 SWKQFHIEFMEKY 537
           SWK FH +F +KY
Sbjct: 507 SWKDFHKKFYDKY 519

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/493 (60%), Positives = 377/493 (76%), Gaps = 8/493 (1%)

Query: 52  FKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQ 111
           F PA + ++ D+NE++LKA+YA+RG IP RAEEL  QL E   SLPF KI+ ANIGNPQQ
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 112 LQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSES 171
           L QQPL+F RQV+SL+Q+P LL + +    +  +Y KD+I RA K+L  IGGSVGAYS S
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLLKSKDILL-AQKIYSKDSIERATKLLNSIGGSVGAYSSS 126

Query: 172 QGVYGIRRTVANFITERD-GGEPA------YPEDIFLTAGASAAVNYLLSILCKGEKTGV 224
           QGV  IR+ VA FI +RD   +P          ++FLTAGAS AV+++L +  K E  GV
Sbjct: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186

Query: 225 LIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVIN 284
           L+PIPQYPLYTA + L  S  LPY+L+E N WS +P +IE ++  A++ NIKP  LVVIN
Sbjct: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246

Query: 285 PGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPG 344
           PGNPTGA+L+K++I+ I++IAA+YGIV+IADEVYQEN+++  +FHS K VL  L++  P 
Sbjct: 247 PGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306

Query: 345 KFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVD 404
           K+DNVQLASLHS SKGV+GECGQRGGYMEI GF+++V++V+LK+ASIS+C VVTGQ LVD
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366

Query: 405 LMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLN 464
           LMV+PP+ G+ES+ LDQ +R  IHS L  ++  L+  F  L GI CQKP GAMYLFP+L+
Sbjct: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426

Query: 465 LPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWID 524
           L   AI  A  L L PDEFYC +LLE+TGICTVPGSGFGQ  GTYHLRTTFL PGIEWI+
Sbjct: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486

Query: 525 SWKQFHIEFMEKY 537
           SW++FH+EFMEKY
Sbjct: 487 SWEKFHLEFMEKY 499

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/497 (57%), Positives = 363/497 (73%), Gaps = 18/497 (3%)

Query: 54  PAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQLQ 113
           PA + ++ D+++++L  +YA+RG IPTRA+EL+ QL   PN LPF KII ANIGNPQQL+
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 114 QQPLSFYRQVLSLLQYPTLLHA----IETKPGSSAVYKKDAILRAKKILKDIGGSVGAYS 169
           Q+PL+F RQVLSL++YP L+++    +E K     +Y  DAI RA+ IL  IGGSVGAYS
Sbjct: 68  QEPLTFQRQVLSLVEYPNLVNSKNILVENK-----IYAPDAIKRAETILNSIGGSVGAYS 122

Query: 170 ESQGVYGIRRTVANFITERDGGEPAYPED---------IFLTAGASAAVNYLLSILCKGE 220
            SQG+  IR+ VA  I +RD  E    ++         IFLT GA+ AV+Y+L +  K E
Sbjct: 123 SSQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDE 182

Query: 221 KTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVL 280
             GVL+PIPQYPLYTA + L NS  LPY+L+E   WS +P EIE +IK A+  NIKP  L
Sbjct: 183 NCGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTL 242

Query: 281 VVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQR 340
           V+INPGNPTGA+LS E+I  I+ IAAKYGIV+IADEVYQ NI+   KFHS K +L  L+ 
Sbjct: 243 VIINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKL 302

Query: 341 EIPGKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQ 400
           + P K+DNVQLASLHS SKGV+GECGQRGGY E++GF+ E++++ILKLASI +C VVTGQ
Sbjct: 303 QYPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQ 362

Query: 401 ALVDLMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLF 460
            LVDLM  PP++G+ S+ LDQ +R  I S L  ++  L+  F+ L GI CQKP GAMYLF
Sbjct: 363 ILVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLF 422

Query: 461 PKLNLPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGI 520
           P+L+L    I EA+   L PDEFYC +LLE+TGICTVPGSGFGQ  GTYH+RTTFL  GI
Sbjct: 423 PRLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGI 482

Query: 521 EWIDSWKQFHIEFMEKY 537
           EWI  W++FH+EFM +Y
Sbjct: 483 EWIKLWEKFHLEFMNQY 499

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 69/151 (45%), Gaps = 9/151 (5%)

Query: 168 YSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIP 227
           Y   QG + +R+ +A   +  D       E++ LT GA AA N+L      G+    +  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNED--VTLSEENVILTNGAIAA-NFLTHYTLAGKGDHFICI 111

Query: 228 IPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGN 287
            P Y   ++   +  +      L +   +  N +E+E +IK   +       +V+  P N
Sbjct: 112 SPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMIKPNTK------CIVLNTPNN 165

Query: 288 PTGAVLSKEAIVSILEIAAKYGIVVIADEVY 318
           P  +V+  E +  I E+A K+GIVV  DEVY
Sbjct: 166 PLSSVIPTETLREIAELADKHGIVVFCDEVY 196

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 89/182 (48%), Gaps = 15/182 (8%)

Query: 183 NFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNN 242
           N + +  G EP   +++ L  G+   ++ L+   C+ E   +L   P Y +Y+    +N+
Sbjct: 71  NRLDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANIND 130

Query: 243 SHALPY-FLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSI 301
              +    + E N + +N  E+ + +K    ++ K  +L + +PGNPTG +++K+ I  I
Sbjct: 131 VEIVECPLITEDNSFQMNVPEVLSTLK----NDPKIKLLFITSPGNPTGKLVNKKDIEFI 186

Query: 302 LEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGV 361
           LE     G+VV+ DE Y       + F   +G    + + +  K+ N+ +    S S G+
Sbjct: 187 LENWTN-GLVVV-DEAY-------IDFADAEGTTYSMAKLVT-KYPNLTVLQTLSKSFGL 236

Query: 362 SG 363
           +G
Sbjct: 237 AG 238

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 109/260 (41%), Gaps = 61/260 (23%)

Query: 256 WSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIAD 315
           W++N  E+E  I        K   L++  P NP G V ++E ++ I EI  K+ +V+I+D
Sbjct: 183 WTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISD 236

Query: 316 EVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGECGQRGGYMEII 375
           EVY E+++   +F  +      L  EI G+          + + G +G+     G+   I
Sbjct: 237 EVY-EHLYFTPEFTRIA----TLSPEI-GQI---------TLTVGSAGKSFAATGWR--I 279

Query: 376 GFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGEESF------ALDQAQRKTIHS 429
           G+   +   +LK AS+         A   +  S P   +E+       ALD    + +  
Sbjct: 280 GWVVSLNPELLKYASM---------AHTRICFSSPSPLQEACANSLNTALDNGYFEKMRQ 330

Query: 430 QLSQRAELLWKTFNSLDGIECQKPNGAMYL---FPKLNLP-------------------Y 467
           +   + ++  + F+ L G+   +P G  ++   F K+ +P                   Y
Sbjct: 331 EYINKFKIFTRVFDEL-GLPYTEPEGTYFVLVDFSKVKIPDNYPFPEELRSKGKDFRISY 389

Query: 468 RAIQEAQRLELSPDEFYCKE 487
             + E   + + P EFY KE
Sbjct: 390 WLVNELGVVAIPPTEFYIKE 409

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 68/138 (49%), Gaps = 19/138 (13%)

Query: 197 EDIFLTAGASAAV-NYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHAL------PYF 249
           E++ +T GA+  + + L+ +L  G++  V++  P +  Y   + L     +      P  
Sbjct: 132 ENVTVTTGANEGILSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 189

Query: 250 LDEMNG----WSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIA 305
           LD+ N     W+I+  + EN I        K   +++  P NP G V ++E + ++  I 
Sbjct: 190 LDQRNTKGEEWTIDFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNIC 243

Query: 306 AKYGIVVIADEVYQENIF 323
            K+ +V+I+DEVY+   F
Sbjct: 244 VKHNVVIISDEVYEHLFF 261

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 74/143 (51%), Gaps = 11/143 (7%)

Query: 178 RRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTAT 237
           R   + F +E  G  P   ++I L  G+   V+ L+   C  +   VL+  P Y +Y+  
Sbjct: 71  RNNTSAFKSE--GLAPISYKNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVF 128

Query: 238 LALNNSHALPY-FLDEMNGWSINPIEIENVIKK-AVQDNIKPDVLVVINPGNPTGAVLSK 295
             +N++  +    + E N +    ++++NV++  +  D+IK  +L +  PGNPTGA +S 
Sbjct: 129 AMINDTEVVECPLITEDNSFD---MDLDNVLETLSNDDSIK--LLFITTPGNPTGASIST 183

Query: 296 EAIVSILEIAAKYGIVVIADEVY 318
           + I  +L   +  GIVV+ DE Y
Sbjct: 184 QKIEMLLNNWSA-GIVVV-DEAY 204

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 78/161 (48%), Gaps = 12/161 (7%)

Query: 168 YSESQGVYGIRRTVANFITERDGGEPAYPE---DIFLTAGASAAVNYLLSILCKGEKTGV 224
           YSE+QG+  +   +  FIT+ +   P Y E   DI L  G+S ++  +   LC    T +
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNT-PPYNETLYDIMLANGSSDSMFKVFETLCDESTTVL 195

Query: 225 LIPIPQYPLYTATLALNNSHALPYFLD---EMNGWSINPIE--IENVIKKAVQDNI-KPD 278
           +      P+ +  +A   +  +P  L+   E  G  I  +E  ++N   K+   ++ KP 
Sbjct: 196 MEEFTFVPVISNVMA-TGAKCIPLKLNLNYEDQGIDIEYLENLLDNWGGKSNTKHLSKPK 254

Query: 279 VLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADEVY 318
           +L  I+ G NP G  LS E    I  IA ++ ++++ D+ Y
Sbjct: 255 ILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 79/173 (45%), Gaps = 26/173 (15%)

Query: 165 VGAYSESQGVYGIRRTVANFITERDGGEPAY-----PEDIFLTAGASAAV-NYLLSILCK 218
           V  YS ++G    R T+   +T  D   P Y     PE++ +T GA+  +   L+ IL +
Sbjct: 84  VNQYSPTRG----RPTLIKSLT--DLYSPLYKLTLKPENVLVTTGANEGILACLMGILNQ 137

Query: 219 GEKTGVLIP-----IPQYPLYTATLA---LNNSHALPYFLDEMNGWSINPIEIENVIKKA 270
            ++  V  P     IP   L    +    +N    L   + +   W+++  + ENVI   
Sbjct: 138 NDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITN- 196

Query: 271 VQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIF 323
                K   +++  P NP G V ++E +  I +I  K+ +++I+DEVY    F
Sbjct: 197 -----KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYF 244

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 83/174 (47%), Gaps = 17/174 (9%)

Query: 192 EPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSH--ALPYF 249
           +P   +++ L  G+  +++ L+   C   K  +LI    Y +YT    +N+     +P  
Sbjct: 83  KPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLL 142

Query: 250 LDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYG 309
           L E + + I+    E  I + +Q++    ++ + +PGNPTG  +    I  IL    + G
Sbjct: 143 LSEEDKFQID----EEKILETLQNDPSIKLVFITSPGNPTGTFIDVNRIEKILS-QWQTG 197

Query: 310 IVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSG 363
           +VV+ DE Y +   +G    S KG L  L      K++N+ +    S S G++G
Sbjct: 198 LVVV-DEAYID-FVEG----SDKGSLAPL----ATKYENIAVLQTLSKSFGLAG 241

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 58/123 (47%), Gaps = 7/123 (5%)

Query: 198 DIFLTAGASAAVNYLLSILC-KGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGW 256
           DI LT G +      L + C KG+     + + +   ++++LA   +  +  F   ++  
Sbjct: 132 DIILTTGNTNGWESTLRVFCNKGD-----VILAEAHSFSSSLASAEAQGITTFPIPIDEH 186

Query: 257 SINPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIAD 315
            I P ++E ++        KP +L  I  G NPTG  L+ E  V I  IA K+  ++I D
Sbjct: 187 GIIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIED 246

Query: 316 EVY 318
           E Y
Sbjct: 247 EPY 249

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 84/182 (46%), Gaps = 27/182 (14%)

Query: 193 PAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPY-FLD 251
           P   +++ L  G+  +++ L+   C   K  +LI  P Y +Y+    +N+   +    + 
Sbjct: 84  PLSADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIV 143

Query: 252 EMNGWSINPIEIENVIKKAVQD-NIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKY-- 308
           E N + +N    + VI+    D NIK  +  V +PGNPTGA++    I SI +I +++  
Sbjct: 144 EDNSFQMNT---DKVIETLQGDSNIK--IAFVTSPGNPTGALID---IASIEKILSQWQS 195

Query: 309 GIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGECGQR 368
           GIV I DE Y       + F S  G    L  + P       LA L + SK   G  G R
Sbjct: 196 GIVAI-DEAY-------IDFCSTGGSAAPLVNKYP------NLAVLQTLSKSF-GLAGVR 240

Query: 369 GG 370
            G
Sbjct: 241 LG 242

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 77/355 (21%), Positives = 144/355 (40%), Gaps = 50/355 (14%)

Query: 165 VGAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAV-NYLLSILCKGEKTG 223
           V  YS ++G   +  ++    +   G E    E+I +T GA+  + + L+ +L  G++  
Sbjct: 89  VNQYSPTRGRASLLNSLIKLYSPFYGKE-LKQENITITTGANEGILSCLMGLLNAGDE-- 145

Query: 224 VLIPIPQYPLYTATLALNNSHAL------PYFLD----EMNGWSINPIEIENVIKKAVQD 273
           V++  P +  Y + + L     +      P  LD    E   W+I+  +  N I      
Sbjct: 146 VIVFEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTEWTIDFEQFRNAITP---- 201

Query: 274 NIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKG 333
             K   ++V +P NP G V +KE +  + EI  +  +++I+DEVY+      + F+    
Sbjct: 202 --KTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVYE-----FLYFNDSFT 254

Query: 334 VLRRLQREIPGKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISL 393
            +  L  EI       QL     ++       G R G+  +I    E+ Q + K A   +
Sbjct: 255 RIATLSPEIG------QLTLTVGSAGKTFAATGWRIGW--VISQNPELLQYVSK-AHTRI 305

Query: 394 C---PVVTGQALVDLMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIEC 450
           C   P    +A  + +           AL+    + +  +  Q+ ++    F  L G+  
Sbjct: 306 CFASPSPLQEACANSIND---------ALESGYFEKMRKEYVQKFKIFNAVFEEL-GLPY 355

Query: 451 QKPNGAMYL---FPKLNLPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGF 502
            KP G  ++   F K+ +P       + L+   D      L+   G+  +P + F
Sbjct: 356 TKPEGTYFVLADFSKVKIPEDYPWPEEILDKGKDFRISHWLINELGVVAIPPTEF 410

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 197 EDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGW 256
           +++ +T GA  A N+LL     G+   V+   P Y    +   +  +      L E + +
Sbjct: 80  DNVLVTNGAIGA-NFLLYYTLVGKGDHVICVHPTYSQLYSVPKMFGAEVTLLELSEKDSF 138

Query: 257 SINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
             N     + +KKA++ N K  ++++ NP NP G V+S E + SI E+  +  + +  DE
Sbjct: 139 LPNL----DTLKKAIKSNTK--LIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDE 192

Query: 317 VYQ 319
           VY+
Sbjct: 193 VYR 195

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 67/133 (50%), Gaps = 9/133 (6%)

Query: 188 RDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALP 247
           +D  +P   E++ L  G+  +++ ++   C   K  +L+  P Y +Y+    +N+   + 
Sbjct: 78  KDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVK 137

Query: 248 Y-FLDEMNGWSINPIEIENVIKKAVQD-NIKPDVLVVINPGNPTGAVLSKEAIVSILEIA 305
              +   N +  N  E   VIK A  D +IK  ++ + +PGNPTGA +    I  IL+  
Sbjct: 138 CPLITSDNSFQANTDE---VIKTAQNDPSIK--LIFITSPGNPTGAKVETSRIEKILQNW 192

Query: 306 AKYGIVVIADEVY 318
            + G+VV+ DE Y
Sbjct: 193 DR-GMVVV-DEAY 203

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 104/238 (43%), Gaps = 36/238 (15%)

Query: 274 NIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKG 333
           N K   +++ +P NP G V ++E ++ +  I  + GI +I+DEVY E+++   +F  +  
Sbjct: 210 NEKTKAVIINSPHNPIGKVFTREELLKLGNICVEKGIYIISDEVY-EHLYFTDEFTRIA- 267

Query: 334 VLRRLQREIPGKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISL 393
               L  EI          S H+ + G +G+     G+   IG+     + +L LAS   
Sbjct: 268 ---TLSEEI----------SQHTLTVGSAGKSFAATGWR--IGWVISRNKELLALAS--- 309

Query: 394 CPVVTGQALVDLMVSPPKRGEE--SFALDQAQRKTIHSQ----LSQRAELLWKTFNSLDG 447
                 +A V +  S P   +E  + A++ A + T ++       ++ E   K F+ L G
Sbjct: 310 ------KAHVRICFSSPAPLQEACAVAIEHALKTTYYADTRAAYQKKYERFQKPFDDL-G 362

Query: 448 IECQKPNGAMYL---FPKLNLPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGF 502
           +   +  G+ +L   F +L LP       +  +   D      L+   G+  +P S F
Sbjct: 363 LPYTRAEGSYFLLVDFSRLPLPADYHFPEELADKGRDFRVAYWLINELGLVAIPCSSF 420

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 198 DIFLTAGASAAVNYLLSILC-KGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGW 256
           D  LT G +      L I C KG+     + + +   ++++LA   +  +  F   ++  
Sbjct: 132 DSILTTGNTNGWESTLRIFCNKGD-----VILAEAHSFSSSLASAEAQGVITFPVPIDSD 186

Query: 257 SINPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIAD 315
            I P ++E+++      + KP +L  I  G NPTG+ LS E   +I +IA K+  ++I D
Sbjct: 187 GIIPEKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIED 246

Query: 316 EVY 318
           E Y
Sbjct: 247 EPY 249

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 67/326 (20%), Positives = 129/326 (39%), Gaps = 65/326 (19%)

Query: 197 EDIFLTAGA-SAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLA--------LNNSHALP 247
           E+I +T GA  A +  L++++  G++  V+ P     ++   +A        L N +   
Sbjct: 99  ENILVTTGAIQALLESLMALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQGK 158

Query: 248 YFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAK 307
             + E N W ++       ++ A  D  K  ++++ NP NP G V +++ ++ +  +   
Sbjct: 159 KRILEANDWILD----RETLRAAFTDKTK--LMIINNPNNPLGKVFNRDELLEMATLCVN 212

Query: 308 YGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGE--- 364
            G  +IADEVY+   F       +  +   + ++              + + G +G+   
Sbjct: 213 NGAYIIADEVYEFLQFTPNPLSRISNLSEAIAQK--------------TITIGSAGKIFR 258

Query: 365 -CGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGEESFALDQAQ 423
             G R G+M I      V +V      +  C     Q    L +          AL+   
Sbjct: 259 VTGWRVGWM-ISKNRELVEKVTAVHVRMGFCSPSISQVASGLGIQR--------ALECGY 309

Query: 424 RKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYL---FPKLNLP-------------- 466
             ++ ++  ++  +++K  + L G+   KP GA ++   F K+ +P              
Sbjct: 310 FLSMPNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIPEDYQFPEYLKNRAR 368

Query: 467 -----YRAIQEAQRLELSPDEFYCKE 487
                Y   QE   L L   EFYC+E
Sbjct: 369 DFFISYWLTQEFCILLLPCSEFYCEE 394

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 67/138 (48%), Gaps = 19/138 (13%)

Query: 197 EDIFLTAGASAAV-NYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHAL------PYF 249
           E++ +T GA+  + + L+ +L  G++  V++  P +  Y   + L     +      P  
Sbjct: 116 ENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 173

Query: 250 LDEMNG----WSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIA 305
           LD+ N     W+I+  + E  I        K   +++  P NP G V ++E + ++  I 
Sbjct: 174 LDQRNTRGEEWTIDFEQFEKAITS------KTKAVIINTPHNPIGKVFTREELTTLGNIC 227

Query: 306 AKYGIVVIADEVYQENIF 323
            K+ +V+I+DEVY+   F
Sbjct: 228 VKHNVVIISDEVYEHLYF 245

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           D+  TAG + A    L + C     G  I    Y  ++++L    +  +  F   ++ + 
Sbjct: 135 DVLATAGNTNAWESTLRVFCN---RGDTILAEAYS-FSSSLYAAEAQGVNVFPVPLDEFG 190

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++E+++     +  KP +L  I  G NPTG+ LS +    I  IA K+  ++I DE
Sbjct: 191 IIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIEDE 250

Query: 317 VY 318
            Y
Sbjct: 251 PY 252

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 81/367 (22%), Positives = 152/367 (41%), Gaps = 46/367 (12%)

Query: 150 AILRAKKILKDIGGSVGAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAV 209
           AI  A+K L DI   V  YS ++G   +   +    T   G E    E++ +T GA+  +
Sbjct: 73  AIKEAQKAL-DIP-LVNQYSPTRGRVSLLNALIKQYTPIYGSE-LKQENVTITTGANEGI 129

Query: 210 -NYLLSILCKGEKTGVLIPIPQYPLYTATLAL----------NNSHALPYFLDEMNGWSI 258
            + L+ +L  G++  V++  P +  Y + + L          N    L   + E   W++
Sbjct: 130 LSCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWTV 187

Query: 259 NPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVY 318
           +  + +N I        K   +++  P NP G V ++E ++ I  I  +  +++I+DEVY
Sbjct: 188 DMEQFKNAITS------KTKAVIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVY 241

Query: 319 QENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFT 378
            E+++   +F  +      L  EI       QL     ++       G R G+  +I   
Sbjct: 242 -EHLYFTDEFTRIA----TLSPEIG------QLTLTVGSAGKTFAATGWRIGW--VISLN 288

Query: 379 HEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGEESFALDQAQRKTIHSQLSQRAELL 438
            E+ Q + K A   +C   +   L +   +      ES   ++ +++ I     Q+ ++ 
Sbjct: 289 SELLQYVSK-AHTRIC-FASPSPLQEACANSINDALESNYFEKMRQEYI-----QKFKIF 341

Query: 439 WKTFNSLDGIECQKPNGAMYL---FPKLNLPYRAIQEAQRLELSPDEFYCKELLEHTGIC 495
              F  L G+   KP G  ++   F K+ +P       + L    D      L+   G+ 
Sbjct: 342 TSVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILNKGKDFRISHWLINELGVV 400

Query: 496 TVPGSGF 502
            +P + F
Sbjct: 401 AIPPTEF 407

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 62/122 (50%), Gaps = 7/122 (5%)

Query: 197 EDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGW 256
           +++ +T GA  A N+L+     G    ++   P Y   ++  ++  +      L+  +G+
Sbjct: 82  DNVLITNGAIGA-NFLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLEAEDGY 140

Query: 257 SINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           + N  ++    K  V+ N K   +V+ NP NP G+V+S E +  I++ A +  I ++ DE
Sbjct: 141 TPNIQKL----KSKVRANTK--YIVLNNPNNPLGSVISTEKMTEIIDYAERNEIFIVCDE 194

Query: 317 VY 318
           VY
Sbjct: 195 VY 196

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           ++  T G + +    L I C     G  I   QY  +++++    +  +  F   ++   
Sbjct: 135 NVLATTGNTGSWESTLRIFCN---RGDTILAEQY-TFSSSVYAAEAQGINVFPVPLDADG 190

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           + P  +E ++     D  KP +L  I  G NPTG+ LS +  V I  IA K+ +++I DE
Sbjct: 191 LIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIEDE 250

Query: 317 VY 318
            Y
Sbjct: 251 PY 252

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           D+  T G + A   +L I C     G  I   Q+  ++++++   +  +  F   ++   
Sbjct: 134 DVLATIGNTGAWESVLRIFCN---RGDTILAEQF-AFSSSISAAEAQGVNVFPIPLDEHG 189

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++E ++    +   KP +L  +  G NPTG+ LS +    I  IA K+  ++I DE
Sbjct: 190 IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFIIIEDE 249

Query: 317 VY 318
            Y
Sbjct: 250 PY 251

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 116/290 (40%), Gaps = 53/290 (18%)

Query: 196 PEDIFLTAGASAAV-NYLLSILCKGEKTGVLIPIPQYPLYTATL--------ALNNSHAL 246
           PE+I +T GA+  +   L+S+L  G++  VL P     +Y   +         L     L
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 247 PYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAA 306
                + + W+++  +  + I +      K   +++ +P NPTG V ++E ++++  I  
Sbjct: 159 KTRRTKGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICV 212

Query: 307 KYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGECG 366
           +  + +I+DEVY+   F                       + V+LASL      ++   G
Sbjct: 213 EKNVYIISDEVYENLYFTP---------------------ECVKLASLSPEISNITLTIG 251

Query: 367 QRGGYMEI----IGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGEE---SFAL 419
             G    +    IG+       +LKLAS +   +           SPP+         AL
Sbjct: 252 SAGKIFAVTGWRIGWIISENVELLKLASSAHIKICFSSP------SPPQLACAHAIDIAL 305

Query: 420 DQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYL---FPKLNLP 466
           +      +     ++ E+L   F  L G+    P G+ ++   F KL +P
Sbjct: 306 NSDYFDRMRKDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 84/180 (46%), Gaps = 23/180 (12%)

Query: 193 PAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSH--ALPYFL 250
           P   E++ L  G+   ++ L+   C   K  +LI  P Y +Y+    +N+     +P  +
Sbjct: 84  PLTHENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVV 143

Query: 251 DEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGI 310
           ++ N + +   + E VI+  +Q++    ++ + +PGNPTGA++  E I  +L    + G 
Sbjct: 144 ED-NSFQM---DTEKVIE-TLQNDPSIKLVFITSPGNPTGALIKPENIEKLLS-QWQSGF 197

Query: 311 VVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGECGQRGG 370
           VV+ DE Y       + F +  G +  L  + P       LA L + SK   G  G R G
Sbjct: 198 VVV-DEAY-------IDFCTTGGSVAPLVNKYP------NLAVLQTLSKSF-GLAGIRLG 242

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 66/138 (47%), Gaps = 19/138 (13%)

Query: 197 EDIFLTAGASAAV-NYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHAL------PYF 249
           E++ +T GA+  + + L+ +L  G++  V++  P +  Y   + L     +      P  
Sbjct: 116 ENVVVTTGANEGILSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 173

Query: 250 LDEMNG----WSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIA 305
           LD+ N     W+I+  + E  I        K   +++  P NP G V + + + ++  I 
Sbjct: 174 LDQRNTRGEEWTIDFEQFEKAITS------KTKAVIINTPNNPIGKVFTHDELTTLGNIC 227

Query: 306 AKYGIVVIADEVYQENIF 323
            K+ +V+I+DEVY+   F
Sbjct: 228 VKHNVVIISDEVYEHLYF 245

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 81/169 (47%), Gaps = 24/169 (14%)

Query: 168 YSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAV-NYLLSILCKGEKTGVLI 226
           YS ++G   + + +A+  T   G + +  ++I +  GA+ A+ + L+ +L KG++  V  
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYGQQLS-ADNITVHTGANEAIFSCLMGLLNKGDEVIVFE 135

Query: 227 PIPQYPLYTATLALNNSHALPYFLDEMNGWSINP-IEIENVIKKAVQDNIKPDVL----- 280
           P     +    LA      +P          INP  E+++ + +  +  I  D+L     
Sbjct: 136 PFFDQYISNIELAGGVVRYVP----------INPPRELDDRVTRGTEWEIDWDILEKTIN 185

Query: 281 -----VVIN-PGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIF 323
                V+IN P NP G V ++E ++ + +I     IV+I+DEVY+   F
Sbjct: 186 SRTKCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYF 234

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 67/138 (48%), Gaps = 19/138 (13%)

Query: 197 EDIFLTAGASAAV-NYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHAL------PYF 249
           E++ +T GA+  + + L+ +L  G++  V++  P +  Y + + L     +      P  
Sbjct: 116 ENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELCGGKVVYVPINPPKE 173

Query: 250 LDEMNG----WSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIA 305
           LD  N     W+I+  + E  I        K   +++  P NP G V ++E + ++  I 
Sbjct: 174 LDLRNTRGEEWTIDFEQFEKAITP------KTKAVIINTPHNPIGKVFTREELTTLGNIC 227

Query: 306 AKYGIVVIADEVYQENIF 323
            K+ +++I+DEVY+   F
Sbjct: 228 VKHNVIIISDEVYEHLYF 245

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 62/128 (48%), Gaps = 9/128 (7%)

Query: 193 PAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPY-FLD 251
           P   E+I L  G+  +++ L+ + C   K  ++I  P Y +Y+    +N+   +    + 
Sbjct: 84  PLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVA 143

Query: 252 EMNGWSINPIEIENVIKKAVQD-NIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGI 310
           E N +    ++   V++   QD  IK  ++ + +PGNPT A++    I  +L      G 
Sbjct: 144 EDNSFQ---MDTSKVLETLAQDPTIK--LIFITSPGNPTAALIDTAEIEKVLNNWT--GG 196

Query: 311 VVIADEVY 318
           +V+ DE Y
Sbjct: 197 LVVVDEAY 204

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 64/123 (52%), Gaps = 7/123 (5%)

Query: 197 EDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPY-FLDEMNG 255
           +++ L  G+   ++ L+   CK     +++  P Y +Y+    +N+   +    + E N 
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNS 144

Query: 256 WSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIAD 315
           + ++       +KK   D I+  +L + +PGNPTG +++ + I+ +LE   K G+VV+ D
Sbjct: 145 FQMDVKRTLETLKK--DDLIR--LLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV-D 198

Query: 316 EVY 318
           E Y
Sbjct: 199 EAY 201

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 107/264 (40%), Gaps = 61/264 (23%)

Query: 252 EMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIV 311
           E   W+++  E+   I        K   L++  P NP G V ++E ++ I +I  +  +V
Sbjct: 179 EGTEWTVDYDELRAAITP------KTKALILNTPHNPVGKVFTREELLQIGQICVENNVV 232

Query: 312 VIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGECGQRGGY 371
           +I+DEVY E+++   +F  V      L  EI G+          + + G +G+     G+
Sbjct: 233 IISDEVY-EHLYFTPEFTRVA----TLSPEI-GQI---------TLTIGSAGKSFAATGW 277

Query: 372 MEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGEES------FALDQAQRK 425
              IG+   +   +L+ AS+         A   +  + P   +E+       ALD    K
Sbjct: 278 R--IGWIVSLNPELLEYASM---------AHTRICFASPSPLQEACANALPIALDNGYFK 326

Query: 426 TIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYL---FPKLNLP---------------- 466
            +  +   +  +  + F+ L G+   KP G  ++   F K+ +P                
Sbjct: 327 KMREEYIHKFNIFTRVFDEL-GLPYTKPEGTYFVLVDFSKVKIPEDYPFPEELRSKAKDF 385

Query: 467 ---YRAIQEAQRLELSPDEFYCKE 487
              Y  I E   + + P EFY KE
Sbjct: 386 RISYWLINELGVVAIPPTEFYIKE 409

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 86/186 (46%), Gaps = 20/186 (10%)

Query: 148 KDAILRAKKILKDIGGSVGAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASA 207
           K AI  AKK + DI   V  YS ++G   +  ++    +     E    E++ +T GA+ 
Sbjct: 69  KFAITEAKKAV-DIP-LVNQYSPTRGRVSLLESLIKLYSPLYNAE-LKAENVTVTTGANE 125

Query: 208 AV-NYLLSILCKGEKTGVLIP-----IPQYPLYTATLA---LNNSHALPYFLDEMNGWSI 258
            + + L+ IL  G++  V  P     IP   L    +    +N    +   + +   W++
Sbjct: 126 GILSCLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTV 185

Query: 259 NPIEIENVIKKAVQDNIKPDVLVVIN-PGNPTGAVLSKEAIVSILEIAAKYGIVVIADEV 317
           +  +  N    A+ D  K    V+IN P NP G V ++E +  I EI  K  +V+I+DEV
Sbjct: 186 DYEQFAN----AITDKTKA---VIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEV 238

Query: 318 YQENIF 323
           Y+   F
Sbjct: 239 YEHLYF 244

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 52/251 (20%), Positives = 102/251 (40%), Gaps = 57/251 (22%)

Query: 265 NVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFD 324
           +++ K + +  K   +++  P NP G V ++E +  + +I  K  I +I+DEVY E+++ 
Sbjct: 189 DILNKTINERTK--CIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYF 245

Query: 325 GMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQV 384
           G +F  +  + +             ++  L + S G +G+     G+   IG+       
Sbjct: 246 GDEFTRIATISK-------------EIGDL-TLSVGSAGKSFAATGWR--IGWVVSRNAE 289

Query: 385 ILKLASISLCPVVTGQALVDLMVSPPKRGEESFA------LDQAQRKTIHSQLSQRAELL 438
           +L   S         +A   +  S P   +E+ A      L     + +  +  ++  +L
Sbjct: 290 LLSYVS---------KAHTRICFSSPSPFQEACAHSIDIGLHNGYFENMREEYKEKFAIL 340

Query: 439 WKTFNSLDGIECQKPNGAMYL--------------FPK--------LNLPYRAIQEAQRL 476
            + F+ L G+   KP+G  ++              FP+          L Y  + E   +
Sbjct: 341 TRVFDEL-GLPYTKPDGTYFVCVDFSKVQIPDEYPFPRELNERAKDFKLSYWLVNELGVV 399

Query: 477 ELSPDEFYCKE 487
            + P EFY KE
Sbjct: 400 AIPPTEFYIKE 410

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 72/183 (39%), Gaps = 32/183 (17%)

Query: 167 AYSESQGVYGIRRTVANFITER------DGGEPAYPEDIFLTAGASAAV-NYLLSILC-- 217
            Y  ++G + +R T+  F  E       + G  + PE + LT+GAS  V N LL      
Sbjct: 52  TYGSNEGAHWVRSTICKFNNEEIFKFGENYGARSAPECLNLTSGASYGVLNILLQCTLPH 111

Query: 218 KGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKP 277
                   I  P Y L          H     ++EM   SI+   +E+ +  A  D+IK 
Sbjct: 112 NNYTRQAFIISPTYFLINDCFIDAGFHGKLTAINEMGTDSIDFDTLESNL--AELDSIKA 169

Query: 278 DV---------------------LVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           DV                       V    NP+G   S    + +LE+A KY I++I D+
Sbjct: 170 DVGTQCITKNENSKGKKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDILIITDD 229

Query: 317 VYQ 319
           VY 
Sbjct: 230 VYD 232

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 193 PAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPY-FLD 251
           P   E++ L  G+  +++ ++   C   K  +L+  P Y +Y+    +N+   +    L 
Sbjct: 85  PLTSENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLY 144

Query: 252 EMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIV 311
           + N + ++   +  V+    Q++    +L + +PGNPTGA +  E I ++L+     G+V
Sbjct: 145 KNNSFQMDTESVLTVL----QNDPLIKLLFITSPGNPTGARIETERIETVLQNWTD-GLV 199

Query: 312 VIADEVY 318
           V+ DE Y
Sbjct: 200 VV-DEAY 205

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 67/325 (20%), Positives = 134/325 (41%), Gaps = 53/325 (16%)

Query: 197 EDIFLTAGASAAV-NYLLSILCKGEKTGVLIP-----IPQYPLYTATLALNNSHALPYFL 250
           +++ +T GA+  + + L+ IL  G++  V  P     IP   L    +     H  P  +
Sbjct: 105 QNVLVTTGANEGILSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHP-PKEM 163

Query: 251 DEMNG----WSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAA 306
              N     W I+   +E         N K   +++  P NP G V +++ +  + ++  
Sbjct: 164 KTRNTTGDEWQIDWDALEKTF------NNKTKAVIINTPHNPIGKVFTEQELTKLAQLCV 217

Query: 307 KYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGECG 366
           ++  VVI+DEVY E+++    F  +  +             N  +A+L + + G +G+  
Sbjct: 218 EHNTVVISDEVY-EHLYFTESFPRIANI-------------NEDIANL-TLTVGSAGKSF 262

Query: 367 QRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGEESFA--LDQAQR 424
              G+   IG+       +L   S         +A   +  + P   +E+ A  ++ A +
Sbjct: 263 AATGWR--IGWIISKNDQLLNYVS---------KAHTRICFASPSPLQEACAGSIEHALK 311

Query: 425 ----KTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYL---FPKLNLPYRAIQEAQRLE 477
                 +  +  ++ E+L   F+ L G+   +P G  ++   F K+ +P   +   + LE
Sbjct: 312 IDYFPKMREEYRKKFEILTTAFDKL-GLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLE 370

Query: 478 LSPDEFYCKELLEHTGICTVPGSGF 502
            + D      L+   GI  +P + F
Sbjct: 371 KAKDFRISYWLINEIGIVAIPPTEF 395

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           D+  T G + A    L + C  +K  V++   +   +++ LA   +  +  F   ++   
Sbjct: 132 DVVATTGNTNAWESTLRVFC--DKGDVILA--EAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++E ++    +   KP +L  I  G NPTG+ LS +    I ++A K+  ++I DE
Sbjct: 188 IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDE 247

Query: 317 VY 318
            Y
Sbjct: 248 PY 249

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 193 PAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPY-FLD 251
           P   E+  L  G+  +++ ++   C   K  +L+  P Y +Y+    +N+   +    + 
Sbjct: 83  PLTDENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLIT 142

Query: 252 EMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIV 311
           E N + I+  EI N++  A    IK  ++ + +PGNPTGA +  + I  +L+     G+V
Sbjct: 143 EDNSFQIDATEILNIL--ANDPLIK--LVFITSPGNPTGAKIEIDRIEYLLK-NWDQGLV 197

Query: 312 VIADEVY 318
           ++ DE Y
Sbjct: 198 IV-DEAY 203

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           D+  T G + A    L + C     G +I + +   ++++LA   +  +  F   ++   
Sbjct: 132 DVVATTGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLASAEAQGIITFPVPIDAHG 187

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++E ++    +   KP +L  I  G NPTG+ L+ E    I  IA K+  ++I DE
Sbjct: 188 IIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDE 247

Query: 317 VY 318
            Y
Sbjct: 248 PY 249

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 68/141 (48%), Gaps = 7/141 (4%)

Query: 179 RTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATL 238
           R  ++  T  +   P    +I L  G+  +++ ++   C   +  +L+  P Y +Y+   
Sbjct: 70  RNRSSTFTADECTRPLTSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCA 129

Query: 239 ALNNSHALPY-FLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEA 297
            +N+   +    + E N + ++  ++ +++       IK  +L + +PGNPTGA +    
Sbjct: 130 KINDVEVVTCPLITEDNSFQMDSDKVLDILNN--DQEIK--LLFITSPGNPTGAQIETAR 185

Query: 298 IVSILEIAAKYGIVVIADEVY 318
           I  +L+   + G+VV+ DE Y
Sbjct: 186 IEKVLQNWDR-GLVVV-DEAY 204

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 69/162 (42%), Gaps = 10/162 (6%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           D+  TAG + A    L + C     G +I + +   +++ LA   +  +  F   ++   
Sbjct: 133 DVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSCLAAAQAQGITTFPVPIDDKG 188

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++E ++        KP +L  I  G NPTG  L+ E    I  IA K+  ++I D 
Sbjct: 189 IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDA 248

Query: 317 VYQENIFDGMKFHSVKGVLRRLQ-REIPGKFDNVQLASLHST 357
            Y     D  +    K  + R Q RE    F    LASL  T
Sbjct: 249 PYYFLQMDKYERDLQKRAVTRAQPRESHKDF----LASLDKT 286

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 62/137 (45%), Gaps = 15/137 (10%)

Query: 196 PEDIFLTAGASAAV-NYLLSILCKGEKTGVLIP-----IPQYPLYTATLA---LNNSHAL 246
           PE++ +T GA+  + + L+ I+  G++  V  P     IP   L    +    +N    L
Sbjct: 115 PENVLVTTGANEGILSCLMGIINPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKEL 174

Query: 247 PYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAA 306
              + +   W+++  E    I        K   +++  P NP G V ++E +  +  I  
Sbjct: 175 DNRVTKGTEWTVDFDEFTRAITP------KTKAVIINTPHNPIGKVFTREELTKLGNICV 228

Query: 307 KYGIVVIADEVYQENIF 323
           +  +++IADEVY+   F
Sbjct: 229 ENNVIIIADEVYEHLYF 245

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 62/134 (46%), Gaps = 7/134 (5%)

Query: 193 PAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDE 252
           P + +D  L    + A N+L+     G    V+   P Y    +   +  +      L +
Sbjct: 74  PEFNKDNVLVTNGAIAANFLIYYTLVGPGDHVICVDPTYAQLYSVPKMFGAEVSLLKLQK 133

Query: 253 MNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVV 312
            +G+  N   IE  +KK ++ N K  ++++ NP NP G+ +S E +  I ++  +  I +
Sbjct: 134 EDGFIPN---IE-TLKKMIKSNTK--LIIINNPNNPLGSAISTETLNDICQLCEENNIYL 187

Query: 313 IADEVYQENIFDGM 326
             DEVY+  IF  M
Sbjct: 188 HCDEVYKP-IFHSM 200

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 63/130 (48%), Gaps = 13/130 (10%)

Query: 193 PAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDE 252
           P   E++ L  G+  +++ ++   C   K  ++   P Y +Y+   ++N+   +   L  
Sbjct: 81  PLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPL-- 138

Query: 253 MNGWSINPIEIENVIKKAVQDNIKPDVLV----VINPGNPTGAVLSKEAIVSILEIAAKY 308
               S N  +++    +AV D +K D L+    + +PGNPTGA +    I  IL+     
Sbjct: 139 --VTSDNSFQVDT---EAVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQ-NWDQ 192

Query: 309 GIVVIADEVY 318
           GI+V+ DE Y
Sbjct: 193 GILVV-DEAY 201

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 62/138 (44%), Gaps = 15/138 (10%)

Query: 191 GEPAYPEDIFLTAGASAAV-NYLLSILCKGEKTGVLIP-----IPQYPLYTATLA---LN 241
           G+    E++ +T GA+  + + L+ IL  G++  V  P     IP   L    +    +N
Sbjct: 117 GQELKDENVTITTGANEGILSSLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPIN 176

Query: 242 NSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSI 301
               +   + E   W+I+  E+            K   L++  P NP G V +KE +  I
Sbjct: 177 PPKDMDQRIVEGKDWTIDYEELAKAFTS------KTKALILNTPHNPIGKVFTKEELTKI 230

Query: 302 LEIAAKYGIVVIADEVYQ 319
             +  +  +V+I+DEVY+
Sbjct: 231 GNLCVENNVVIISDEVYE 248

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 72/187 (38%), Gaps = 38/187 (20%)

Query: 168 YSESQGVYGIRRTVANFITE------RDGGEPAYPEDIFLTAGASAAVNYLLSILCK--- 218
           Y   +G   +R  +  F  +      RD    + PE + L++GAS  V   LSIL +   
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGV---LSILLQATL 107

Query: 219 ---GEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIK------- 268
              G      I  P Y L           +    +DE    SI+   +E  ++       
Sbjct: 108 AHTGYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFT 167

Query: 269 ---------------KAVQDNIKPDVLVVI-NPGNPTGAVLSKEAIVSILEIAAKYGIVV 312
                          KAV   I   V+  I    NPTG   S E  + ++EIA KY +++
Sbjct: 168 EEEDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLI 227

Query: 313 IADEVYQ 319
           IAD+VY 
Sbjct: 228 IADDVYD 234

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           D+F TAG + A    L + C     G +I + +   ++++LA   +  +  F   ++   
Sbjct: 134 DVFATAGNTNAWESTLRLFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPVPIDADG 189

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++  ++     +  KP +L  I  G NPTG  ++     +I +IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 317 VY 318
            Y
Sbjct: 250 PY 251

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           D+  TAG + A    L + C     G +I +  +  ++++LA   +  +  F   ++   
Sbjct: 134 DVLATAGNTNAWESTLRVFCN---RGDVILVEAHS-FSSSLASAEAQGVITFPVPIDADG 189

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++  V++       KP +L  I  G NPTG  ++     +I +IA KY  +++ DE
Sbjct: 190 IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDE 249

Query: 317 VY 318
            Y
Sbjct: 250 PY 251

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 70/331 (21%), Positives = 133/331 (40%), Gaps = 74/331 (22%)

Query: 196 PEDIFLTAGASAAV-NYLLSILCKGEKTGVLIPIPQYPLYTATLA----------LNNSH 244
           P ++ +T GA+ A+ + L+ +L +G++  V++  P +  Y + +           L+   
Sbjct: 118 PSNVQVTTGANEAILSCLVGLLNQGDE--VIVFEPFFDQYISNIEIPGGKVTYVPLHPPK 175

Query: 245 ALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEI 304
            L   +     W+++  E+   I        K   L++  P NP G V ++E ++ I  I
Sbjct: 176 ELENRVTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNI 229

Query: 305 AAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLASLHSTSKGVSGE 364
             +  +V+I+DEVY+      + F S    +  L  EI     N+ L      S G +G+
Sbjct: 230 CVENNVVIISDEVYEH-----LYFTSEFTRIATLSPEI----GNLTL------SVGSAGK 274

Query: 365 CGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKRGEES------FA 418
                G+   IG+       +LK AS+         A   +  + P   +E+       A
Sbjct: 275 TFAATGWR--IGWIVSQNAELLKYASM---------AHTRICFASPSPFQEACAKSIEIA 323

Query: 419 LDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYL---FPKLNLP--------- 466
           L     + +  +   + ++  + F+ L G+   +P G  ++   F K+ +P         
Sbjct: 324 LQNNYFEKMRQEYINKFDIFTRVFDEL-GLPYTQPEGTYFVLVDFSKVKIPEDYPFPEEL 382

Query: 467 ----------YRAIQEAQRLELSPDEFYCKE 487
                     Y  I E   + + P EFY +E
Sbjct: 383 LSKAKDFRISYWLINELGVVAIPPTEFYIQE 413

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 95/223 (42%), Gaps = 28/223 (12%)

Query: 170 ESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIP 229
           E +G+    R  A+   E +G  P   ++I L  G+  +++ ++   C   +  V++  P
Sbjct: 62  ELKGLLASYRNAASAFRE-EGLAPLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPP 120

Query: 230 QYPLYTATLALNNSHALPY-FLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288
            Y +Y     +N+   +    +   N + I+    E+ I + +  +    V+ + +PGNP
Sbjct: 121 TYGMYKVCADINDVGYVEVPLISSDNSFQID----EDRILEQLNLDKSIKVVFITSPGNP 176

Query: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348
           TGA +    +  +L      GIVV+ DE Y       + F + K  L  L  + P     
Sbjct: 177 TGACIEVGRVEKLLR-NWTAGIVVV-DEAY-------IDFSADKPSLSPLVNKHP----- 222

Query: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASI 391
             L  L + SK  SG  G R      +GFT    Q+   L ++
Sbjct: 223 -NLVVLQTLSKA-SGLAGIR------LGFTFASTQIATALNAM 257

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 8/125 (6%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           DI  T G++   +  L I C     G  + + +Y  Y++++   ++  L      ++G  
Sbjct: 132 DIITTTGSTQGWDASLRIFCN---KGDTVLLEEY-TYSSSVEAADAQGLNCIPMPLDGEG 187

Query: 258 INPIEIENVI---KKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVI 313
           I P ++E ++        D   P +L  I  G NPTG  LS      I  +A KY +++I
Sbjct: 188 IIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIII 247

Query: 314 ADEVY 318
            DE Y
Sbjct: 248 EDEPY 252

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 63/123 (51%), Gaps = 7/123 (5%)

Query: 197 EDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPY-FLDEMNG 255
           E++ L  G+  +++ ++   C   K  +L+  P Y +Y+    +N+   +    + E N 
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNS 147

Query: 256 WSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIAD 315
           + +N  ++ +++K    ++    ++ + +PGNPTG  +  + I  +L+     G+VV+ D
Sbjct: 148 FQLNSDKVLDILK----NDPLIKLVFITSPGNPTGVKIETKRIEKVLQ-NWDNGLVVV-D 201

Query: 316 EVY 318
           E Y
Sbjct: 202 EAY 204

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 26/33 (78%)

Query: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQ 319
           NPTGA+ S+ + + +LE+A KY I++I+D+VY 
Sbjct: 198 NPTGAIYSRSSRLKLLELARKYDILIISDDVYD 230

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 26/33 (78%)

Query: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQ 319
           NPTGA+ S+ + + +LE+A KY I++I+D+VY 
Sbjct: 199 NPTGAIYSRSSRLKLLELARKYDILIISDDVYD 231

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 67/153 (43%), Gaps = 9/153 (5%)

Query: 167 AYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLI 226
            Y   +G   +R  VA+  +++   E    +D  L    +   N+L+S    G    V+ 
Sbjct: 54  TYGAIKGSDELRSLVASLYSDK---EVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVIC 110

Query: 227 PIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPG 286
             P Y   ++   +  +      L+  N +  +  +++++IK   +       +V+ NP 
Sbjct: 111 VDPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNTK------CIVLNNPN 164

Query: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQ 319
           NP G+V+    +  I  +A K  I VI DEVY+
Sbjct: 165 NPLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           D+  T G + +    L I C     G  I   +Y  +++++    +  +  F   ++   
Sbjct: 135 DVLATIGNTGSWESTLRIFCN---RGDTILAEKY-TFSSSVYAAEAQGVNVFPVPLDADG 190

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           + P  +E ++     +  KP +L  I  G NPTG+ LS +    I  IA K+  ++I DE
Sbjct: 191 LIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDE 250

Query: 317 VY 318
            Y
Sbjct: 251 PY 252

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 77/202 (38%), Gaps = 30/202 (14%)

Query: 167 AYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAV-NYLLSILC--KGEKTG 223
            Y   +G   +R+ V N I +      + PE I LT+GAS  + N LL       G    
Sbjct: 50  TYGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYGILNILLQTTLPHTGYTKQ 109

Query: 224 VLIPIPQYPL---------------------YTATLALNNSHALPYFLDEMNGWSINPIE 262
             I  P Y L                     YT+         L YF  E+     N  +
Sbjct: 110 AFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQNSTD 169

Query: 263 I-ENVIKKAVQDNIKPDVLVVI-NPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQ- 319
           I +N  K  +Q  I   V   I    NP+G     E  + +++IA KY +++I D+VY  
Sbjct: 170 IIQN--KNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVYDL 227

Query: 320 -ENIFDGMKFHSVKGVLRRLQR 340
            +  FD     +V   L  L R
Sbjct: 228 LDYNFDSNATSNVAPRLVHLDR 249

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           ++  + G + A    L I C     G ++   +Y  +++ LA   +  +      ++ + 
Sbjct: 131 EVIASVGNTNAWESTLRIFCD---RGDVVLFEEYS-FSSCLAACEAQGVTTIPIPIDAFG 186

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++E+++     +  KP +L  I  G NPTG  L  +   +I  IA K+  +++ DE
Sbjct: 187 IVPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDE 246

Query: 317 VY 318
            Y
Sbjct: 247 PY 248

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 7/127 (5%)

Query: 193 PAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPY-FLD 251
           P   +++ L  G+  +++ ++   C   K  +L   P Y +Y+    +N+   L    + 
Sbjct: 83  PLTEDNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIY 142

Query: 252 EMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIV 311
           E N +  +    + VI     D +   V +  +PGNPTGA +    I+ ILE  +  G  
Sbjct: 143 EDNSFQPDS---QKVISILSSDPLIKLVFLT-SPGNPTGAKIDSNIIIKILE--SWDGGF 196

Query: 312 VIADEVY 318
           V+ DE Y
Sbjct: 197 VVVDEAY 203

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           DI  TAG + A    L + C     G +I + +   +++ LA   +  +  F   ++   
Sbjct: 133 DIIATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSCLAAAQAQGITTFPIPIDDNG 188

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++E ++        KP +L  I  G NPTG  L    +  I  IA K+  +++ D 
Sbjct: 189 IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDA 248

Query: 317 VY 318
            Y
Sbjct: 249 PY 250

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 8/125 (6%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           DI  T G++ A +  L I C    T +L    +   Y++++   ++  L      M+   
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDTVLL----EEFTYSSSVEAADAQGLNCIPVPMDNQG 188

Query: 258 INPIEIENVIKKAVQDNI---KPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVI 313
           I P ++E ++            P +L  I  G NPTG  LS+     I  +A KY I+++
Sbjct: 189 IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIV 248

Query: 314 ADEVY 318
            D+ Y
Sbjct: 249 EDDPY 253

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 50/238 (21%), Positives = 97/238 (40%), Gaps = 36/238 (15%)

Query: 274 NIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKG 333
           N K   +++  P NP G V ++  +  + +I  K  +V+I+DEVY+   F        K 
Sbjct: 187 NSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYF--------KD 238

Query: 334 VLRRLQREIPGKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISL 393
              R+    P      ++  L + + G +G+     G+   IG+   + Q +L  A+   
Sbjct: 239 SFTRIATLSP------EIGQL-TLTVGSAGKSFAATGWR--IGWALSLNQELLSYAA--- 286

Query: 394 CPVVTGQALVDLMVSPPKRGEESF--ALDQAQR----KTIHSQLSQRAELLWKTFNSLDG 447
                 +A   +  + P   +E+   A + A++    K    Q  ++ E+     N L G
Sbjct: 287 ------KAHTRICFASPSPLQEAVANAFNDAEKVEYFKETRLQYIRKYEIFTNVLNEL-G 339

Query: 448 IECQKPNGAMYL---FPKLNLPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGF 502
           +   +P G  ++   F K+ +P       + L  + D      L+   G+  +P + F
Sbjct: 340 LPYTEPEGTYFILVNFSKVKIPPDYKYPEELLNKAKDFRISYWLMNELGVVAIPPTEF 397

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           ++ +TAG ++A    L I C    T     + +   ++++L+   +  +  F   ++   
Sbjct: 132 ELLVTAGNTSAWESTLRIFCNRGDT----ILAEAHSFSSSLSAAQAQGIITFPVPIDDKG 187

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++  ++     +  KP +L  I  G NPTG+ L  E    + +IA K+  +++ DE
Sbjct: 188 IIPEKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDE 247

Query: 317 VY 318
            Y
Sbjct: 248 PY 249

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 29/44 (65%)

Query: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHS 330
           NP+GA  S+E  + +L++A +Y I++I+D+VY    F G +  S
Sbjct: 200 NPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHGQRTDS 243

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 74/162 (45%), Gaps = 30/162 (18%)

Query: 167 AYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLI 226
           +Y   +G   +R ++A+       G     +DI LT GA  A N+L      G    V+ 
Sbjct: 54  SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGA-NFLAFYTLVGAGDHVIC 107

Query: 227 PIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIE---------NVIKKAVQDNIKP 277
             P Y         +  +++P    EM G  ++ + ++           +K  +++N K 
Sbjct: 108 VEPTY---------SQLYSVP----EMFGAEVDLLTLKKEDDFLPNLQTLKSMIKNNTK- 153

Query: 278 DVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQ 319
            ++++ NP NP G+V+ K+ +  I ++  +  I + +DEVY+
Sbjct: 154 -LIIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 192 EPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLD 251
           +P   +++ L  G+  +++ ++   C   K  +L+  P Y +Y+    +N+   +   L 
Sbjct: 83  KPLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLT 142

Query: 252 EMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIV 311
             +G     ++ E V+     D++   ++ V +PGNPTGA +    I  +L+     G+V
Sbjct: 143 VSDGSF--QMDTEAVLTILKNDSL-IKLMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLV 198

Query: 312 VIADEVY 318
           V+ DE Y
Sbjct: 199 VV-DEAY 204

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 7/124 (5%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           D+  TAG++ A +  L + C   +T   + + +Y  Y+++L    +  L     +M+   
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET---VLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183

Query: 258 INPIEIENVIKK---AVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIA 314
           I   ++  +++    AVQ      +  + N  NPTG  L +E    ++ +A++Y  ++I 
Sbjct: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243

Query: 315 DEVY 318
           D+ Y
Sbjct: 244 DDPY 247

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 62/127 (48%), Gaps = 12/127 (9%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           D+ +TAG++ A +  L + C    + +L    +   Y++++    +  +     E++G  
Sbjct: 129 DVLITAGSTQAWDASLRLFCNPGDSVLL----ESWTYSSSVEAAEAQGMYCVGVEIDGHG 184

Query: 258 INPIEIENVIKKAVQDNIKP-----DVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIV 311
           + P ++E +++    D++ P      +L VI  G NP G  L+ E    I  I  KY +V
Sbjct: 185 VVPEKLEWLLQN--WDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKPLIYNIIQKYDMV 242

Query: 312 VIADEVY 318
           +I D+ Y
Sbjct: 243 LIEDDPY 249

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 56/125 (44%), Gaps = 8/125 (6%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           DI  T G++   +  L I C    T +L    +   Y++++   ++  L      ++G  
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL----EDYTYSSSVEAADAQGLNCVPMPLDGEG 187

Query: 258 INPIEIENVIKKAVQ---DNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVI 313
           I P ++E ++        +   P +L  I  G NPTG  LS      I  +A +Y I++I
Sbjct: 188 IVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIII 247

Query: 314 ADEVY 318
            D+ Y
Sbjct: 248 EDDPY 252

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           D+  TAG + A    L + C     G +I + +   ++++LA   +  +  F   ++   
Sbjct: 134 DVVATAGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLAAAEAQGIIAFPVPIDADG 189

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++  ++        KP +L  I  G NPTG  ++     +I +IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIVEDE 249

Query: 317 VY 318
            Y
Sbjct: 250 PY 251

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 5/122 (4%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWS 257
           D+  TAG +      L + C     G +I + +   ++++LA   +  +  F   ++   
Sbjct: 134 DVLATAGNTNGWESTLRVFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPIPIDAGG 189

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++  ++        KP +L  I  G NPTG  ++     +I +IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 317 VY 318
            Y
Sbjct: 250 PY 251

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 68/176 (38%), Gaps = 44/176 (25%)

Query: 168 YSESQGVYGI----RRTVANFITERDGGEPAYPE-DIFLTAGASAAVNYLLSILCKGEKT 222
           YSE++G+  +    ++ V  F        PAY   D+ L  G+S ++  +   LC     
Sbjct: 132 YSETRGLPSVVEFSKKIVKRF------NPPAYDNWDVLLANGSSDSLFKIFETLCD---E 182

Query: 223 GVLIPIPQYPLYTATLALNNSHA-------------------LPYFLDEMNGWSINPIEI 263
           GV + + ++        +  S                     + Y  D +  W + P + 
Sbjct: 183 GVTVLMEEFTFSPTIFNVTASGGKVVPIKVEITHDPETQGIDVQYLCDLLENWEVGPYKH 242

Query: 264 ENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADEVY 318
            +          KP VL  I  G NPTG  LS E   +I E+A  +  +++ D+ Y
Sbjct: 243 LS----------KPRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPY 288

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 30/145 (20%)

Query: 193 PAYP-EDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFL- 250
           PAY   ++ +  G+S A+  +  +LC  + T +L      P+  + + L  +  +P  + 
Sbjct: 117 PAYGGWNVCMANGSSDAMYKVFEVLCDEDSTVMLEEFTFSPV-ISNIKLQGASVVPVKMQ 175

Query: 251 ----------------DEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVL 293
                           D ++ WS+ P +  N          KP  L  +  G NPTG  L
Sbjct: 176 LSADPEQQGIDVDRLADLLDNWSVGPYKHLN----------KPKALYTVATGQNPTGMTL 225

Query: 294 SKEAIVSILEIAAKYGIVVIADEVY 318
           S      I EIA K+  +++ D+ Y
Sbjct: 226 SPTKRRRIYEIAQKHDFLIVEDDPY 250

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 76/192 (39%), Gaps = 43/192 (22%)

Query: 167 AYSESQGVYGIRRTVANFITE------RDGGEPAYPEDIFLTAGASAAVNYLLSILCKGE 220
            Y  ++G   +R  +  F+ E      RD    + PE + LT+GAS  V   L+IL +  
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGV---LNILLQAT 106

Query: 221 --KTGV----LIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIK------ 268
              TGV     I  P Y L                +DE    SI+   +E  +K      
Sbjct: 107 LPHTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESID 166

Query: 269 -KAVQDNIKPDVLVVINP--------------------GNPTGAVLSKEAIVSILEIAAK 307
              V +N K ++ ++ NP                     NP+G   + E    ++E+A K
Sbjct: 167 PNPVNENGK-ELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARK 225

Query: 308 YGIVVIADEVYQ 319
           Y +++I D+VY 
Sbjct: 226 YDMLIITDDVYD 237

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 37.0 bits (84), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 62/131 (47%), Gaps = 13/131 (9%)

Query: 192 EPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHAL--PYF 249
           +P   +++ L  G+  +++ ++   C   K  +L+  P Y +Y+    +N+   +  P  
Sbjct: 83  KPLSADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLT 142

Query: 250 LDEMNGWSINPIEIENVIKKAVQDNIKP--DVLVVINPGNPTGAVLSKEAIVSILEIAAK 307
           + + N + +N   +  ++      N  P   ++   +PGNPTGA +    I  +L+    
Sbjct: 143 VSD-NSFQMNTEAVLTIL------NNDPLIKIMFATSPGNPTGAKIKTCLIEEVLQ-KWD 194

Query: 308 YGIVVIADEVY 318
            GIVV+ DE Y
Sbjct: 195 NGIVVV-DEAY 204

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 67/159 (42%), Gaps = 10/159 (6%)

Query: 168 YSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIP 227
           YS++QG+  I   +   I       P    D+ L  G+S ++  L   L   E T VL+ 
Sbjct: 112 YSQTQGLAPILDFLK-LIVANCNNPPYQNWDLLLANGSSDSMFKLFDTLT-DETTTVLVE 169

Query: 228 IPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEI-------ENVIKKAVQDNIKPDVL 280
              +    + +    +  +P  L+  +  S   I +       EN      +   +P +L
Sbjct: 170 EFTFSPVLSNITATGASCVPLQLNFTSNPSNQGINVTYLQHLLENWQSGPYKHLNRPSIL 229

Query: 281 VVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADEVY 318
             I+ G NPTG  +S E    I ++A KY  +++ D+ Y
Sbjct: 230 YTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 63/131 (48%), Gaps = 13/131 (9%)

Query: 192 EPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLD 251
           +P   +++ L  G+  +++ ++   C   K  +L+  P Y +Y+    +N+   +   L 
Sbjct: 83  KPLRADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPL- 141

Query: 252 EMNGWSINPIEIENVIKKAVQDNIKPDVLV----VINPGNPTGAVLSKEAIVSILEIAAK 307
                S N  +++    +A    +K D L+    V +PGNPTGA +    I  IL+   +
Sbjct: 142 ---TVSDNSFQMDT---EAALTILKNDPLIKLIFVTSPGNPTGAKIKTCLIEKILQ-NWE 194

Query: 308 YGIVVIADEVY 318
            G+VV+ DE Y
Sbjct: 195 NGLVVV-DEAY 204

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 12/127 (9%)

Query: 198 DIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNS--HALPYFLDEMNG 255
           D+  T G ++A    L + C     G  I   +Y   ++ +A       A P  LDE NG
Sbjct: 132 DVLATVGNTSAWESTLRVFCN---RGDTILAEEYTFSSSLVAAEAQGVRAYPVPLDE-NG 187

Query: 256 WSINPIEIENVIK--KAVQDNI-KPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIV 311
             + P  +  ++   +   D + +P +L  +  G NPTG  LS +   ++  +A ++ ++
Sbjct: 188 --MVPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLL 245

Query: 312 VIADEVY 318
           ++ DE Y
Sbjct: 246 IVEDEPY 252

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 197 EDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHAL--PYFLDEMN 254
           +++ L  G+  +++ ++   C   K  +L+  P Y +Y+    +N+   +  P  + + N
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSD-N 146

Query: 255 GWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIA 314
            + +   ++E V+     D +   V V  +PGNPTGA +    I  +L+   + G+VV+ 
Sbjct: 147 SFQM---DVEAVLTILENDPLIKLVFVT-SPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV- 200

Query: 315 DEVY 318
           DE Y
Sbjct: 201 DEAY 204

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 72/164 (43%), Gaps = 18/164 (10%)

Query: 168 YSESQGVYGIRRTVANFITERDGGEPAYPED---IFLTAGASAAVNYLLSILCKGEKTGV 224
           Y+E  G+  IR      + + +  +PAY  D   + L++G+  ++       C  EK+ V
Sbjct: 125 YNEVPGLPQIRNFAKYLVNKIN--KPAYSADQWDVLLSSGSCDSMFKFFECFC-DEKSTV 181

Query: 225 LIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNI--------- 275
           L+    +    + +    +  +P  ++     S   I+++ + +  + DN          
Sbjct: 182 LMEEFTFTPVISHVKATGAECIPLKMNLTKDPSTQGIDVDYLTQ--LLDNWSSGPYKHLN 239

Query: 276 KPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADEVY 318
           KP +L  I  G NPTG  +  E    I E+A K+  +++ D+ Y
Sbjct: 240 KPRILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPY 283

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 71/179 (39%), Gaps = 30/179 (16%)

Query: 167 AYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGE------ 220
            Y   +G   +R+ + +F   R  G  + PE + L++G+S      LS+L          
Sbjct: 52  TYGPDEGALWVRQQICDF-NNRLFGSDSKPEFLNLSSGSSYGC---LSVLLHTTLPHTNF 107

Query: 221 KTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIK--KAVQDNIKPD 278
                I  P Y L           +    +DE    SIN  ++ + ++  + +  N   D
Sbjct: 108 TRQAFIISPTYFLINDCFIDAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEELYGNSNGD 167

Query: 279 VLVVINP------------------GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQ 319
           V ++ NP                   NP+G   S E    ++EIA +Y +++I D+VY 
Sbjct: 168 VSIIQNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVYD 226

>TPHA0A02080 Chr1 (424056..425432) [1377 bp, 458 aa] {ON} Anc_8.204
           YER152C
          Length = 458

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 73/196 (37%), Gaps = 47/196 (23%)

Query: 167 AYSESQGVYGIRRTVANF-------ITERDGGEPAYPEDIFLTAGASAAV-NYLLSILCK 218
            Y  ++G   +R T+  F           D    + PE + LT+GAS  V N LL   C 
Sbjct: 50  TYGSNEGSLWVRDTICEFNNYKAFKFKASDKNVKSKPEYLNLTSGASYGVLNILLQ--CT 107

Query: 219 GEKTG----VLIPIPQYPLYTATL----------ALNNSHALPYFLDEMNGWSINPIEIE 264
              TG      I  P Y L               A+N      + L  +    I   E  
Sbjct: 108 LPHTGYTRQAFIITPTYFLINDCFFDAGFGNKLTAINEVGNDSFDLKMLEDKLIYFEEQV 167

Query: 265 NVIKKAVQDNIKPDVLVVINP---------------------GNPTGAVLSKEAIVSILE 303
           NV K  +++N   D  V+ NP                      NP+    + E  V++++
Sbjct: 168 NVNK--IEENCNDDFAVLRNPLKAEQDQKKIYRYVIYLIPTYSNPSSHTYNMETRVALID 225

Query: 304 IAAKYGIVVIADEVYQ 319
           +A KY +++I D+VY 
Sbjct: 226 LARKYDMLIITDDVYD 241

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 25/38 (65%)

Query: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFD 324
           NP+G   S    + ++E+A KY I++I+D+VY   ++D
Sbjct: 199 NPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVYD 236

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 24  VTILPPNTYSYYSTKSFSNPKPRKHNLNFKPAGQLTIGDLNENVLKAKYAVR-----GKI 78
           VT L PN  +Y+S  +  N  PR+H++       + +   +   +  ++ +R     G +
Sbjct: 236 VTALSPNLSNYHSNTTMYNGDPRRHSMVVTSDDNVMLASTSRGSISHQFNLRNIAQQGNL 295

Query: 79  PTRAEELKRQLAEKPNSLPF 98
           P + +E     ++ P S PF
Sbjct: 296 PMQGQEHSGATSKTPASPPF 315

>Kwal_33.14582 s33 complement(728649..730226) [1578 bp, 525 aa] {ON}
           YHR137W (ARO9) - aromatic amino acid aminotransferase II
           [contig 102] FULL
          Length = 525

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 78/166 (46%), Gaps = 24/166 (14%)

Query: 168 YSESQGVYGIRRTVANFITERDGGEPAYPE-DIFLTAGASAAVNYLLSILC-KGEKTGVL 225
           Y+ ++G+  +     +FI+  +   PAY + D+ L  G S ++  +   LC +GE   VL
Sbjct: 126 YTATRGMPPLIDFCKDFISYVN--PPAYADWDLTLANGTSDSLFKIFETLCDQGE--AVL 181

Query: 226 IPIPQYPLYTATLALNNSHA-----LPYFLD-----EMNGWSINPIE--IENVIKKAVQD 273
           +       +T    L+N  A     +P  L+     ++ G  I  +   ++N ++     
Sbjct: 182 VE-----EFTFAPTLSNIRAAGGVPVPVKLNISADPQVQGIDIGHLTELLDNWVQGPYAH 236

Query: 274 NIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADEVY 318
             +P +L  I  G NPTG  LS+E    I ++A K+  +++ D+ Y
Sbjct: 237 LSRPKLLYTIPTGQNPTGMTLSREKRQQIYDLAEKHDFIIVEDDPY 282

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 286 GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQ 319
            NP+G   S E    +L++A KY +++IAD+VY 
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVYD 238

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 70/189 (37%), Gaps = 40/189 (21%)

Query: 168 YSESQGVYGIRRTVANFITER----DGGEPAY--PEDIFLTAGAS-AAVNYLL--SILCK 218
           Y   +G   +R  +  F+ ++    DGG PA   PE + L  GAS   +N LL  ++   
Sbjct: 50  YGSDEGALWVREQICEFLNDQVFRFDGGSPARTRPEYLNLDNGASYGMLNILLQTTLPHN 109

Query: 219 GEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNI--- 275
           G      I  P Y L    L           L  +N    + I+ E+++    Q      
Sbjct: 110 GYTRQAFIITPTYFLINDCLT---DAGFNGKLTAINEKGHDSIDFESLLAALDQHEASAA 166

Query: 276 ---------KPDVLV----------------VINPGNPTGAVLSKEAIVSILEIAAKYGI 310
                     P  ++                +    NP+G   S E    ++EIA KY +
Sbjct: 167 AATNSAAGSDPTAMIQGSKLTKKIYKYVMYCIPTFANPSGNTYSLETRRRLIEIARKYDM 226

Query: 311 VVIADEVYQ 319
           +VI D+VY 
Sbjct: 227 LVITDDVYD 235

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 61/145 (42%), Gaps = 22/145 (15%)

Query: 196 PEDIFLTAGASAAVNYLL---SILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDE 252
           PE I LTAGAS  V  +L   ++   G      I  P Y L   T            +DE
Sbjct: 84  PEHINLTAGASYGVMNILEQTTLPHTGYTRQAFIVSPTYFLINETFIDAGFGGKLTAIDE 143

Query: 253 MNGWSINPIEIENVIK--KAVQDNIKPDVLVVINP-----------------GNPTGAVL 293
           +    I+   ++  ++   ++ ++   ++ ++  P                  NP G   
Sbjct: 144 LGHGKIDFDTLQQKLEYFDSISNDNSSELQLITAPNANKKVYRYVIYLVPTYSNPGGQTY 203

Query: 294 SKEAIVSILEIAAKYGIVVIADEVY 318
           S E  V ++E+A K+ +++++D+VY
Sbjct: 204 SLETRVKLIELARKHDMLIVSDDVY 228

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           I P ++E ++ +      +P +L  I  G NPTG  L+ +    I  IA K+  ++I DE
Sbjct: 187 IIPEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDE 246

Query: 317 VY 318
            Y
Sbjct: 247 PY 248

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 53/125 (42%), Gaps = 18/125 (14%)

Query: 203 AGASAAVNYLLSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYF-------LDEMNG 255
            GA A  + LLS+        V IP P +P +      N    + Y+       LD + G
Sbjct: 122 TGALAVASKLLSLFMS---RSVWIPNPSWPNHANVFQNNGFKEINYYSYYKDGSLD-IEG 177

Query: 256 WSINPIEIENVIKKAVQDNIKPDVLVV-INPGNPTGAVLSKEAIVSILEIAAKYGIVVIA 314
           W      I+++ K A ++   P  +V+     NPTG   SKE    IL+   +  ++ I 
Sbjct: 178 W------IQDLEKHAQKEGEDPQCIVLHACCHNPTGIDPSKEQWQRILDKIHELNLIPII 231

Query: 315 DEVYQ 319
           D  YQ
Sbjct: 232 DMAYQ 236

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQ 319
           NP+G   + E    ++EIA KY ++++AD+VY 
Sbjct: 205 NPSGQTYTLETRRRLIEIARKYDMLILADDVYD 237

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 25/38 (65%)

Query: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFD 324
           NP+G+  S E    ++E+A +Y +++I+D++Y    +D
Sbjct: 191 NPSGSTYSLETRTRLVELARRYDMLLISDDIYDLLAYD 228

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 71/179 (39%), Gaps = 27/179 (15%)

Query: 168 YSESQGVYGIRRTVANFITER-----DGGEPAYPED-IFLTAGAS-AAVNYLL--SILCK 218
           Y   +G   +R  +  F+ ++     DG       D + L +GAS   +N LL  ++   
Sbjct: 50  YGSDEGALWVREQICTFLNDQVFKFDDGARTRTQVDHLNLNSGASYGMLNILLQTTLPHN 109

Query: 219 GEKTGVLIPIPQYPLYTATL----------ALN-NSH------ALPYFLDEMNGWSINPI 261
           G      I  P Y L               A+N  SH      +L   LD   G S    
Sbjct: 110 GYTRQAFIITPTYFLINDCFRDAGFKGRITAINEKSHDSIDFESLVAALDHHEGESQPDS 169

Query: 262 EIENVIKKAVQDNIKPDVLVVI-NPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQ 319
             E +   A+   I   VL  I    NP+G   S E    +++IA KY ++VI+D+VY 
Sbjct: 170 TTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVYD 228

>YMR066W Chr13 (401541..404237) [2697 bp, 898 aa] {ON}
           SOV1Mitochondrial protein of unknown function
          Length = 898

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 286 GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMK-FHSVKGVLRRLQR-EIP 343
           GN T A +  +  + ++E   + GI+ + DE  QE +  G+K F + K     L   EIP
Sbjct: 344 GNVTEANILTDRFIKLVE---EVGIIRMKDE--QEELPTGVKNFQNEKHATEFLNELEIP 398

Query: 344 GKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHE 380
              D + +   H   + +         YMEI G T E
Sbjct: 399 SDHDYISIVDFHLYKRNIPMAAQLISKYMEIPGTTQE 435

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 286 GNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQ 319
            NP+G   S E    +++IA KY +++I D+VY 
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVYD 228

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 29/45 (64%), Gaps = 2/45 (4%)

Query: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSV 331
           NP+G   S +  + ++E+A +Y +++I+D+VY  ++ D  +F  V
Sbjct: 199 NPSGNTYSLKTKLKLIELARRYDMLIISDDVY--DLLDYEQFLDV 241

>Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {ON}
           YPL125W (KAP120) - karyopherin [contig 67] FULL
          Length = 1034

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 70/166 (42%), Gaps = 15/166 (9%)

Query: 277 PDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLR 336
           PD  + I P    G     E + ++LEI   Y +++ A++ ++ + F G+ F  +   L 
Sbjct: 710 PDAFMNIMPYLQHGIKNQTEILPTLLEIVRSYALLLPAEQFFEADCFQGI-FSHLSKYLM 768

Query: 337 RLQRE----IPGKFDNVQLASLHSTSKGVSGECGQRGGYMEIIG--FTHE------VRQV 384
           +L+ +    +   FD + LA              + G    I    F+ E        Q+
Sbjct: 769 KLRDDSFDILLSIFDVLALARNDQNEGAFLNFMFKSGSLNSIFDALFSEEQISLYQAGQL 828

Query: 385 ILKLASIS-LCPVVTGQALVDLMVSPPKRGEESFALDQAQRKTIHS 429
           +  LA I+   P    Q + +   + P  GE+S  L  ++RK +HS
Sbjct: 829 LQSLARIAYFNPASILQMVEEYRQTLPS-GEQSSYLSPSERKIVHS 873

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
           YHR137W
          Length = 523

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 75/203 (36%), Gaps = 56/203 (27%)

Query: 168 YSESQGVYGIRRTVANFITERDGGEPAYP-EDIFLTAGASAAVNYLLSILCKGEKTGVLI 226
           YS ++G+  +     +F+ +R G  P Y   D  L  G+S ++  +  IL     T VL+
Sbjct: 115 YSATEGLDPLLNFTKSFL-QRIGNTPLYNGWDTILANGSSDSLYKVFDILAD-RNTTVLV 172

Query: 227 PIPQYPLYTATLALNNSHALP-----------------------------YFLDEMNGWS 257
               +     T+    +H +P                             Y  D +  W+
Sbjct: 173 EEFTFVPVVGTILGTGAHIVPMKLNLDEVTSDNFNNDKQFDPNHEGIDVEYLADLLENWA 232

Query: 258 INPIEIENVIKKAVQDNIKPDVLVVINPG-NPTGAVLSKEAIVSILEIAAKYGIVVIADE 316
           + P        K +    KP ++  +  G NPTG  LS E    I  +A ++  +++ D+
Sbjct: 233 VGP-------HKHLP---KPTLMYTVVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDD 282

Query: 317 VY-------------QENIFDGM 326
            Y              EN +DG+
Sbjct: 283 PYGYLRLPHFNRETPSENKYDGI 305

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,323,754
Number of extensions: 2458994
Number of successful extensions: 6299
Number of sequences better than 10.0: 139
Number of HSP's gapped: 6424
Number of HSP's successfully gapped: 139
Length of query: 539
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 425
Effective length of database: 40,409,475
Effective search space: 17174026875
Effective search space used: 17174026875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)