Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B027208.260ON29822982153020.0
NCAS0B050108.260ON2952299286110.0
KNAG0G020308.260ON2998302383840.0
Suva_10.1718.260ON2958299883770.0
YLR087C (CSF1)8.260ON2958300083090.0
Skud_12.1558.260ON2959300882960.0
Smik_12.1468.260ON2958300082900.0
NDAI0B019808.260ON2959299781740.0
CAGL0L12210g8.260ON2981301975430.0
TDEL0F038708.260ON2942300671720.0
ZYRO0C01694g8.260ON3006304365600.0
Kpol_392.78.260ON2995303665600.0
TBLA0E044208.260ON3148260457710.0
TPHA0J007308.260ON3046308156890.0
SAKL0H17072g8.260ON2997306654890.0
Kwal_YGOB_56.238088.260ON2941303047560.0
KLTH0G13728g8.260ON2966306047520.0
Kwal_56.23810singletonOFF2763281044080.0
Ecym_43108.260ON2943159022150.0
KLLA0F19096g8.260ON2923159520490.0
AGR088W8.260ON2887153119820.0
Kwal_56.23808singletonOFF62611205e-07
Kpol_541.68.821ON1608111841.0
ZYRO0B11638g8.228ON147862793.6
KLTH0H00572g5.66ON63199767.5
TBLA0E012904.134ON839142768.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B02720
         (2982 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  5898   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  3321   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  3234   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  3231   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  3205   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  3200   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  3197   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  3153   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  2910   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  2767   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2531   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2531   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  2227   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  2196   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2118   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1836   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1835   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  1702   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   857   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   793   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   768   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    51   5e-07
Kpol_541.6 s541 (15728..20554) [4827 bp, 1608 aa] {ON} (15728..2...    37   1.0  
ZYRO0B11638g Chr2 (913485..917921) [4437 bp, 1478 aa] {ON} simil...    35   3.6  
KLTH0H00572g Chr8 complement(60065..61960) [1896 bp, 631 aa] {ON...    34   7.5  
TBLA0E01290 Chr5 complement(282103..284622) [2520 bp, 839 aa] {O...    34   8.0  

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 5898 bits (15302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2877/2982 (96%), Positives = 2877/2982 (96%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            MASSSEFQSVPISGGKNFSW              SVIFYVGRAIAYITSLILEWLLWKRA
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120
            HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120

Query: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180
            NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH
Sbjct: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180

Query: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240
            SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL
Sbjct: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240

Query: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300
            QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA
Sbjct: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300

Query: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360
            VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ
Sbjct: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360

Query: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420
            KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA
Sbjct: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420

Query: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480
            HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV
Sbjct: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480

Query: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540
            KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF
Sbjct: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540

Query: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600
            SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN
Sbjct: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600

Query: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660
            DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI
Sbjct: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660

Query: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRXXX 720
            YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFR   
Sbjct: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRLLL 720

Query: 721  XXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780
                     EFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV
Sbjct: 721  NTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780

Query: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDNGDVYSDGESGMD 840
            IRYLANVKMNYFGDFFNFITSEEYTGITR                 DNGDVYSDGESGMD
Sbjct: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSDNEDNGDVYSDGESGMD 840

Query: 841  DAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELII 900
            DAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELII
Sbjct: 841  DAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELII 900

Query: 901  DLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRMF 960
            DLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRMF
Sbjct: 901  DLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRMF 960

Query: 961  GLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVINDM 1020
            GLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVINDM
Sbjct: 961  GLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVINDM 1020

Query: 1021 TSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYGL 1080
            TSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYGL
Sbjct: 1021 TSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYGL 1080

Query: 1081 DIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKKE 1140
            DIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKKE
Sbjct: 1081 DIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKKE 1140

Query: 1141 LYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFGSTNTPNQ 1200
            LYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFGSTNTPNQ
Sbjct: 1141 LYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFGSTNTPNQ 1200

Query: 1201 ASTHHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLSSTVYEEN 1260
            ASTHHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLSSTVYEEN
Sbjct: 1201 ASTHHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLSSTVYEEN 1260

Query: 1261 IVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLDKLDFEMS 1320
            IVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLDKLDFEMS
Sbjct: 1261 IVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLDKLDFEMS 1320

Query: 1321 QRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCELWSATAEK 1380
            QRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCELWSATAEK
Sbjct: 1321 QRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCELWSATAEK 1380

Query: 1381 QVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLTA 1440
            QVN              QLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLTA
Sbjct: 1381 QVNSIDTISTDITIDESQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLTA 1440

Query: 1441 ANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLK 1500
            ANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLK
Sbjct: 1441 ANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLK 1500

Query: 1501 EKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRIIKVNLS 1560
            EKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRIIKVNLS
Sbjct: 1501 EKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRIIKVNLS 1560

Query: 1561 SFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSVKGNFSDEX 1620
            SFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSVKGNFSDE 
Sbjct: 1561 SFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSVKGNFSDEL 1620

Query: 1621 XXXXXXXXXXNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKLTNRILN 1680
                      NKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKLTNRILN
Sbjct: 1621 LRLKELIPLLNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKLTNRILN 1680

Query: 1681 GKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKPT 1740
            GKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKPT
Sbjct: 1681 GKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKPT 1740

Query: 1741 VLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKSPKKKLKDV 1800
            VLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKSPKKKLKDV
Sbjct: 1741 VLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKSPKKKLKDV 1800

Query: 1801 EIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQ 1860
            EIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQ
Sbjct: 1801 EIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQ 1860

Query: 1861 QYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASESXXX 1920
            QYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASES   
Sbjct: 1861 QYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASESFKL 1920

Query: 1921 XXXXXXXXXXQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFETHALVLSMSDI 1980
                      QTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFETHALVLSMSDI
Sbjct: 1921 LKALKPFLLPQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFETHALVLSMSDI 1980

Query: 1981 DTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQVES 2040
            DTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQVES
Sbjct: 1981 DTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQVES 2040

Query: 2041 NHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIXXXXXXXXXXXXXXIGMNMS 2100
            NHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDI              IGMNMS
Sbjct: 2041 NHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIKASKLKKEKKGSSSIGMNMS 2100

Query: 2101 SFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSAT 2160
            SFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSAT
Sbjct: 2101 SFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSAT 2160

Query: 2161 FYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQ 2220
            FYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQ
Sbjct: 2161 FYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQ 2220

Query: 2221 SFQVFQELKTSLIQPXXXXXXXXXXPKIKSLAPFLSNIKSVNCQFKYDGGVFKVFSFEDI 2280
            SFQVFQELKTSLIQP          PKIKSLAPFLSNIKSVNCQFKYDGGVFKVFSFEDI
Sbjct: 2221 SFQVFQELKTSLIQPNTSTTENNTEPKIKSLAPFLSNIKSVNCQFKYDGGVFKVFSFEDI 2280

Query: 2281 ESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEH 2340
            ESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEH
Sbjct: 2281 ESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEH 2340

Query: 2341 IHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAK 2400
            IHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAK
Sbjct: 2341 IHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAK 2400

Query: 2401 VQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFM 2460
            VQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFM
Sbjct: 2401 VQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFM 2460

Query: 2461 FTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKH 2520
            FTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKH
Sbjct: 2461 FTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKH 2520

Query: 2521 LTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRA 2580
            LTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRA
Sbjct: 2521 LTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRA 2580

Query: 2581 FTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYH 2640
            FTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYH
Sbjct: 2581 FTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYH 2640

Query: 2641 MFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMR 2700
            MFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMR
Sbjct: 2641 MFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMR 2700

Query: 2701 QDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLE 2760
            QDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLE
Sbjct: 2701 QDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLE 2760

Query: 2761 VLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKREIDEDTVSAISVADYMEYA 2820
            VLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKREIDEDTVSAISVADYMEYA
Sbjct: 2761 VLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKREIDEDTVSAISVADYMEYA 2820

Query: 2821 SKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTH 2880
            SKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTH
Sbjct: 2821 SKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTH 2880

Query: 2881 VKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPP 2940
            VKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPP
Sbjct: 2881 VKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPP 2940

Query: 2941 LEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNSG 2982
            LEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNSG
Sbjct: 2941 LEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNSG 2982

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 3321 bits (8611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1615/2992 (53%), Positives = 2142/2992 (71%), Gaps = 51/2992 (1%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            M + S+FQ VP++  +NFSW              S IFY+GR IAYI + ILEWLLWK A
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120
             +KVNI+SLRISLLGGRIFFKNVTIIHKD TIS+L+G +TWRYWL  TRKP +   S D 
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120

Query: 121  NGV--TMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFN 178
                 T  KN QLPCRFV++ EG EIF+YN+T +YDNII +FSKEER +F+KFL+EQI +
Sbjct: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQILS 180

Query: 179  DHSSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSL 238
            D             S+T +S  D++    D  ES  + +S  +  NDR+F + ++D  S 
Sbjct: 181  D-------------SATVKSMDDSQF---DTSESTSTDKSESSATNDRVFQEEETDTSS- 223

Query: 239  FLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHN 298
            FL+  P++  V R SL  GNKFTPSL+I+S++    ++D+ QPKEKLDLYK KL+ E  N
Sbjct: 224  FLRFLPIQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELIN 283

Query: 299  FAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLF 358
               T+K NIG+ E++ +KFK+DRGK+S +W  FT + GI+ +PL  T   +++NE  D F
Sbjct: 284  TEATLKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKF 343

Query: 359  IQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPH 418
              KW+GL+LYKGT      +D+DDI+FDF NHEYAKFSS++K PK  FT ++D+PG VPH
Sbjct: 344  QAKWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPH 403

Query: 419  GAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTES 478
            GAHPT S +DGPDVGN+GAPP +SLDIQIFGGS+C+GPW QRQ + +  +L+P VSRT  
Sbjct: 404  GAHPTISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAK 463

Query: 479  PVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDL 538
            PVKR  PG  RIYT  ++ ++IMDD TWRI TRE SKD  FL+HY+ETN +YRPFGWIDL
Sbjct: 464  PVKRLTPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDL 523

Query: 539  RFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLV 598
            +FSKE+    TFAL PT +GFKN+I IHL +NE RSSVNHDIL+KCK+FDFDID S+PL 
Sbjct: 524  KFSKETTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLG 583

Query: 599  WNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAY 658
            WND ATWTI++NS+Q+E F+LREHITLIADTLTDF+SGEPTPYELFRP    INWK+D Y
Sbjct: 584  WNDEATWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGY 643

Query: 659  FIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRX 718
             +YLNVNDHNIVNNPLDFNENCYLS HGD+L ++  IP   ITA+  +I+Y I TPMFR 
Sbjct: 644  SLYLNVNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRL 703

Query: 719  XXXXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYG 778
                       EFMK+KEVGRSYDF   GSYL+YS+LD+DNVDTI + C S+GTTLQCYG
Sbjct: 704  LLNTPPWNTLNEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYG 763

Query: 779  FVIRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDNGDVYSDGESG 838
            FV+RYL NVKMNYFGDFF+F+TSEEYTG  R                       +    G
Sbjct: 764  FVVRYLINVKMNYFGDFFHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDT--MQG 821

Query: 839  MDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGEL 898
             D    + +   T L+RSDL+RT NETDL+ TF+VW+GA++LPETIYNCD C  L FGEL
Sbjct: 822  NDAPGRRRL--HTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGEL 879

Query: 899  IIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHR 958
            +IDLRS NYYMDLLA++ D  ++RY  K P +IF+++  +N E     G LS L+IHGHR
Sbjct: 880  VIDLRSCNYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHR 939

Query: 959  MFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVIN 1018
            M+GLPP EPTYFC+WDFD+G L++ S+ +FL+GF +SF+RIGFG+ DLENILLY KE  +
Sbjct: 940  MYGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYD 999

Query: 1019 DMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMY 1078
            DMTS+TVN +++SV L+     +  +    ++ FT IDFE+  YS+RLDLIIP+L+ S++
Sbjct: 1000 DMTSVTVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLF 1059

Query: 1079 GLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQK 1138
              + DG   +LF   TKV +T+F Q ++F  HR  QR YI L+DA +HR SF+LPQ +Q 
Sbjct: 1060 IKEEDGTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQD 1119

Query: 1139 KELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFGSTNTP 1198
             E Y EL+G+I PSSSLP L +P++P T DFI+ED LGE+  LL+  + FRMPF   +  
Sbjct: 1120 AEQYQELFGAIAPSSSLPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYA 1179

Query: 1199 NQASTHH-EEDMDPLEFSNSTVSTEKNYQC--DNLVIDIEYISVEINPSISTYIESLSST 1255
               S    EED+DPLEF N+     +N +C  D+ +ID+ +IS+EI P I   I +    
Sbjct: 1180 TDVSDDETEEDIDPLEF-NTPSEAIQNDKCERDSFIIDVSFISIEICPDILDSIGTFLML 1238

Query: 1256 VYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLDKL 1315
               ENIVQ+IDDIEI T+  LS  +EG   +TN+K+ +LY D++WG R   G+ +YLD++
Sbjct: 1239 FSTENIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRI 1298

Query: 1316 DFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCELWS 1375
            DF M ++ +E+++EK L+E+T+L K RS+R ++++  +    +ERPPALSLV+EG E+WS
Sbjct: 1299 DFAMCEKTVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWS 1358

Query: 1376 ATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLI 1435
            +T E QVN              QLEWLF + + Q   +Q++I T +++Q     SR++LI
Sbjct: 1359 STVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELI 1418

Query: 1436 SKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGV 1495
            S LTAA+++YQISHDPYVITKPAFITRLS+GHVRENRSWKIITRLRHILTY+P DW S +
Sbjct: 1419 SSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTI 1478

Query: 1496 ENYLKE-KSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRI 1554
               L + K+     +AK +F+SVFSNWRNWEFSD+ARSYIY +LFL   + +   + ++ 
Sbjct: 1479 NRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHTTKKS 1538

Query: 1555 IKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSVKG 1614
            I + ++SFF+T Y+AGY+++ NF++T  N++ E   P +++ +SRE + N+TG++G+ KG
Sbjct: 1539 ITIKIASFFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKG 1598

Query: 1615 NFSDEXXXXXXXXXXXNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKL 1674
              SD+               +  +   S +  +  KSFKLN L+L E+ E+Q+ IG ++L
Sbjct: 1599 KLSDKIIMIKNLLPSL----KITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRL 1654

Query: 1675 TNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVES 1734
             +R+   ++S+L + PK+  S A S+ +Y +R+E  + H N TL E Q+RDFSL  T ES
Sbjct: 1655 VSRVFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTES 1714

Query: 1735 WSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQL---SISDRLAEGENK 1791
            WS KPT+LV++QC+  H+ +M  T  LV S+KE+++ +  I++ L   + ++++ + E+ 
Sbjct: 1715 WSYKPTILVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESH 1774

Query: 1792 SPKKKLKDVEIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDF 1851
             PK K+  +   + C  +N+SFE+MPISPF+IRHE K+ D+ F +FGS  +++ VWD D 
Sbjct: 1775 GPKPKVNTI---LTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADI 1831

Query: 1852 FLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDE 1911
            +L S LTKQQYFR SFGD Q+  N++   + I +  +SAS++KLT S+  +++ SFLQDE
Sbjct: 1832 YLTSHLTKQQYFRFSFGDLQLKGNMVNDPYHI-NLYLSASILKLTVSDVQKLIPSFLQDE 1890

Query: 1912 RTASESXXXXXXXXXXXXXQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFETH 1971
            +  +ES             + +         +  W +DT+I YFG+L PI + YF+FE  
Sbjct: 1891 KILTESIEDFITLDLFGLSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELR 1950

Query: 1972 ALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMME 2031
             L+ S++ + ++   + D    Q S+ENV+F IK+R +P  LS++LDFSI  S +QK   
Sbjct: 1951 MLLASLTKMGSDIPNQSD-ISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKN 2009

Query: 2032 LDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIXXXXXXXXXXX 2091
               ++Q+ES+HFR+ LSP SLVRL+W   Q      YYK+    + WD+           
Sbjct: 2010 TSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDL--RSKLNNIPK 2067

Query: 2092 XXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFS 2151
               + +N+ SFH+LSYNFC+GW+F   + S PG++LG++RLFSAYE   GKLTLVD FFS
Sbjct: 2068 APDLPLNVPSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFS 2127

Query: 2152 VARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTF 2211
            +A G +S  F+    E +  NRSYLPNMQI+YW K +G M+D+F+RFHGEALDV+FL+++
Sbjct: 2128 IANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSY 2187

Query: 2212 ITVIESMLQSFQVFQELKTSLIQ--PXXXXXXXXXXPKIKSLAPFLSNIKSVNCQFKYDG 2269
            + VIES L S Q FQELK  LI   P           ++ +L+PFL+NI+S++CQFKYDG
Sbjct: 2188 LDVIESALTSVQTFQELKKDLIPGLPKKQKVNDDKTLELNTLSPFLANIRSISCQFKYDG 2247

Query: 2270 GVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAV 2329
            GVFK+FS ED E+  EPSFE+ +P V+ID NYKH     K HWIR+L+ I STHN L+A 
Sbjct: 2248 GVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAK 2307

Query: 2330 CAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQ 2389
            CAPL+++F E I  MVKKHSS+ +     + LSK  SQN+DYKRLLD FDIA K+TS++Q
Sbjct: 2308 CAPLLSDFFERIQGMVKKHSSSEE-----STLSKPSSQNLDYKRLLDSFDIALKITSAKQ 2362

Query: 2390 KLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSKETSTS 2449
            +LSLSCEPKAKVQAD+GF SFI  + TN+LD  EPL+FSLS++KT+ASIKHIFS+ETSTS
Sbjct: 2363 QLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTS 2422

Query: 2450 FGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKG 2509
             G+D +D+  MFTHPD+IN++GT LIS ++L+FNVKQLQNLYLF+DIW+LS  ++  P  
Sbjct: 2423 IGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPAN 2482

Query: 2510 KSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSLKLKRTWVASD 2569
                 K ++  L++ Q S+    IPW FTLIFTN+ G  DLGPSLGV+S++LKRTW A+D
Sbjct: 2483 DIVKAKTDSS-LSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATD 2541

Query: 2570 HYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNID 2629
            HY++ R+V+ AFTD  S  SKGRLSGIFEL GASW+SEV+WP +   + +PLV++++NID
Sbjct: 2542 HYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNID 2601

Query: 2630 NLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAANI 2689
             +S KAAFDYHMFLIG I+  +  LHSEKD+ G MPDLLKV F CE I +CSTALVAANI
Sbjct: 2602 EISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANI 2661

Query: 2690 LDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKL 2749
            LD+YNT MRMRQDNKI Y+ETLRES+  E++  P NY DILRSLNLLQTDVS +I+ L +
Sbjct: 2662 LDIYNTAMRMRQDNKISYIETLRESNEAESKP-PINYTDILRSLNLLQTDVSVDIYTLNI 2720

Query: 2750 QVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKREIDEDTVS 2809
            Q+SPI LFD+EVLVI IE+ISAR+ T +G+KL T LE++VYD  V+LSTSK E+DE TVS
Sbjct: 2721 QISPITLFDVEVLVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVS 2780

Query: 2810 AISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLGP 2869
             ISV +Y++YASKI GGTIIE+PKL ++MT++QEE SDILEYLY C F+DK++V+WNLGP
Sbjct: 2781 KISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGP 2840

Query: 2870 VNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEEPRIDMP 2929
            +NFIKEMWTTH++A+AVRRSQ V   D Q++E+V+KRIKEEEN S+ KYV +E PRIDMP
Sbjct: 2841 INFIKEMWTTHIRAIAVRRSQVVGVLDGQSEEDVEKRIKEEENFSRFKYVALEPPRIDMP 2900

Query: 2930 QIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNS 2981
            QIRDLGDATPP+EWFGVNRKR PAFTHQT V  VQKLV++AE++YA++L +S
Sbjct: 2901 QIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILGSS 2952

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 3234 bits (8384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1609/3023 (53%), Positives = 2124/3023 (70%), Gaps = 77/3023 (2%)

Query: 5    SEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRAHIKV 64
            S+F S+ +  GK+FSW              +V+FYVGRAIA+  S I EWLLWKR  +KV
Sbjct: 6    SQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKV 65

Query: 65   NIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSY--HLESKDSNG 122
            NIESLR+SLLGGRIFFKN+TII KDYTIS L G ++WRYWL + R P +   L ++D +G
Sbjct: 66   NIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAEDDDG 125

Query: 123  VTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDHSS 182
             ++++NE+L CR +L CEG E+F+YNRT +YDN I +FSKEER KF++FL+E +F D +S
Sbjct: 126  ASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTDRAS 185

Query: 183  YSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFLQT 242
              S   + +  S  +   + K     + ES +   +     NDRIF   ++ K+ LFL  
Sbjct: 186  TESSNGSSSEESKAQDEVEIK----SYTESSFDESNESQMANDRIFHDEETGKN-LFLNY 240

Query: 243  FPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFAVT 302
             P++I+V  AS   GNKFTPSL+I+S++   G++DYCQPKEKLD+YK KL ++  N +V+
Sbjct: 241  LPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVS 300

Query: 303  VKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQKW 362
            +K NIGY EE+LLKFK+  GKLS+LW  F   T  + +PLGL+++KK R      F QKW
Sbjct: 301  LKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKW 360

Query: 363  QGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGAHP 422
            +GLSLYK  +FE   +DLDDI+FD   HEYAKF+S++KCP+AI TYE+DIPG VPHGAHP
Sbjct: 361  RGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHP 420

Query: 423  TNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPVKR 482
            T S IDGPD+GNNGAPPT  L+IQ+FGGS+CYGPW QRQ+ FI S+LAP +SR + PVK 
Sbjct: 421  TLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKP 480

Query: 483  RVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRFSK 542
              PG  R+YT  KL I + +D TWRI TRE SKD  FL+HYK TN+DYRPFGW+DL+FSK
Sbjct: 481  LQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSK 540

Query: 543  ESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWNDR 602
            +SYA F FAL  T +G +N + IHL  +EIRSSVNHDI +K K  DFD+++ +PL WN++
Sbjct: 541  DSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEK 600

Query: 603  ATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFIYL 662
            A WTI++ S+QLETFLLREHITLIADT++DF++GEPTPYELFRP    INWK+D Y IYL
Sbjct: 601  AKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYL 660

Query: 663  NVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRXXXXX 722
            NVNDHNIVNNPLDFNENCYLS HGD L +++T+P + I A+  +I+YNI TPMFR     
Sbjct: 661  NVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNA 720

Query: 723  XXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFVIR 782
                   EFMK+KEVGR+YDF   G+YL+Y+ELDVDNVD I+IIC S+ T L CYGFVIR
Sbjct: 721  PPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIR 780

Query: 783  YLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDNGDVYSDGESGMDDA 842
            YL N+KMNYFGDFF+F+TSEEYT   +                 D     SD +   ++ 
Sbjct: 781  YLMNIKMNYFGDFFHFVTSEEYT--EKISSKGYGEGSLFEKYSDDASTFVSDFDKNNEED 838

Query: 843  ISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELIIDL 902
               ++P       +D+RR  NETDL+LTF++W+GA++LPETIYNCD C AL FGEL ID+
Sbjct: 839  DKVKVPRGP----ADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDV 894

Query: 903  RSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRMFGL 962
            RS+NYYMDLLASL+D ++ +Y+   P +IF++V   N    +   ++S+++IHGHRM+GL
Sbjct: 895  RSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGL 954

Query: 963  PPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVINDMTS 1022
            PP EPTYFCKWDFD+G + + SE DF+KG +TSF +IGFGF DLEN+LLY KEV++DMT+
Sbjct: 955  PPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTA 1014

Query: 1023 LTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYGLDI 1082
            +TVN ++  + + N        L   ++ F +IDFE+  YS+R+D+ IP LK+S+YG + 
Sbjct: 1015 VTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNY 1074

Query: 1083 DG-KKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKKEL 1141
            +  K+   FNF TK++ T+F   KN  +HR++QR+YIT+NDA FHR  F+LP S+Q   +
Sbjct: 1075 EASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVI 1134

Query: 1142 YNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFGSTNTPNQA 1201
            Y +LYGSIVPSSSLP L LP+L +T +FI++DFL EY +   D  I  +P+  +   N  
Sbjct: 1135 YQKLYGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEY-NTTSDCIILNLPYPDSTNLNSD 1193

Query: 1202 STHHEEDMDPLEFSNSTV--STEKNYQCDNLVIDIEYISVEINPSISTYIESLSSTVYEE 1259
            S +   D  P   S++ +  S     + DN VID  YIS+ I+P +  YIE L +  Y +
Sbjct: 1194 SFNSYPDTAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPELFFYIEKLLNHFYGD 1253

Query: 1260 NIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLDKLDFEM 1319
            +  QVID IEI  +K LS FQEG SSI N K+R+L+ D++WG+RD  GIELYLD LDFEM
Sbjct: 1254 DDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGIELYLDTLDFEM 1313

Query: 1320 SQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCELWSATAE 1379
            ++++IEK+REK L E+T L K  SIRAS++ + S    + +PPALSL+VEG + WS TA+
Sbjct: 1314 NEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTTAK 1373

Query: 1380 KQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLT 1439
            K +N              Q+ WLF F  +Q + + +++ T   VQ   T SR++LIS+LT
Sbjct: 1374 KVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLT 1433

Query: 1440 AANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYL 1499
             A+++YQISHDPYVITKPAFITRLS+GHVRENRSWKIITRLRHI+TY+P DW   V   L
Sbjct: 1434 VASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQL 1493

Query: 1500 KEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRIIKVNL 1559
            KE+  N   +AK +FMSVFS+WRNWEFSDVARSYIY ++FL NQAEK ++++ +  K   
Sbjct: 1494 KERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQKTVNKGWKAAF 1553

Query: 1560 SSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSVKGNFSDE 1619
             S ++T YTAG  +D +F++T +N+VFE+TP  TE+G ++EK+IN+TG++GS+KG  SD+
Sbjct: 1554 VSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGNLGSIKGKISDK 1613

Query: 1620 XXXXXXXXXXXNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKLTNRIL 1679
                        ++++   +S    + +  +SFKLN  LLF+ +++  V GE+ LTN I 
Sbjct: 1614 MFKLHNLMNLVQQQEDPALKS----ISSFSRSFKLNIALLFDSSDLLFVFGETSLTNTIH 1669

Query: 1680 NGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKP 1739
            +GK S L ++PK       S++LYAKR ET + HRN+ L ENQ+   +LSA  +S  S P
Sbjct: 1670 SGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGIALSAAADSIISHP 1729

Query: 1740 TVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAE--GENKSPKKKL 1797
            +++ + QC   +++ M +T  +V  ++E +    N+ K+   +D L +    N SPK   
Sbjct: 1730 SIVANFQCDDINLRVMPQTEVIVTFLQEFIAKF-NLVKESFETDDLPKPTPTNDSPKPTP 1788

Query: 1798 KD------VEIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDF 1851
                    V+++  C  SNVS +IMPI PF  R ETKK + KF    +QN   ++WD+D 
Sbjct: 1789 TKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDL 1848

Query: 1852 FLRSDLTKQQYFRISFGDFQITYNLIEGEFI--IVDANVSASMIKLTFSEPNRILSSFLQ 1909
            +L S LTKQQYFR+S G+  + Y    G  +  I + +VSAS++KLTFSEP+R+L SFLQ
Sbjct: 1849 YLGSHLTKQQYFRLSLGNIIVGYT--NGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQ 1906

Query: 1910 DERTASESXXXXXXXXXXXXXQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFE 1969
            DER  S S             + E    PA  K + W L+ DIKY GIL+P+STT+FVFE
Sbjct: 1907 DEREVSRSVKKLQVLGNLFSSEPEINTIPAGAK-IDWRLNADIKYLGILIPVSTTFFVFE 1965

Query: 1970 THALVLSMSDID-TEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQK 2028
             H L+ S++D+D  E Y E DE   QVS++N++FLIKDR IPS LSR++D S   S IQK
Sbjct: 1966 MHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQK 2025

Query: 2029 MMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDI---XXXXX 2085
            +ME   S+Q+ES H R   SPYSLVR++WGG Q L L ++Y+     +LWD         
Sbjct: 2026 IMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPKKEKKV 2085

Query: 2086 XXXXXXXXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTL 2145
                       +   S H+LSYNFC+GW+F     +  G++LG++RLFSAYE G GKLTL
Sbjct: 2086 EEDKTTSFFSTLTFGSCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTL 2145

Query: 2146 VDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDV 2205
            VDAFFSV+ G TS TFY   +E +  NRS+LPN+QI YW+K +  MKDVFIR HGE LDV
Sbjct: 2146 VDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDV 2205

Query: 2206 SFLTTFITVIESMLQSFQVFQELKTSLIQPXXX-----------------------XXXX 2242
            +FL++F+ +IE+ LQS QVFQELK  L+ P                              
Sbjct: 2206 NFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQSEARSEEEEEESEEHNRRETVPGKEKK 2265

Query: 2243 XXXPKIKSLAPFLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYK 2302
               P+ K +APFLS+I+ VNCQFKYDGG+FKV+SFEDIES+L+PSFE+++PGV ID +YK
Sbjct: 2266 EDAPR-KDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYK 2324

Query: 2303 HNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLS 2362
            +NIG +KPH IR L+ + STHN LFA CAPL+    + I  MVKKHSS  K E     +S
Sbjct: 2325 NNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVKKHSSKKKPEP-KQRVS 2383

Query: 2363 KAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDET 2422
            + PSQNIDYKRLL+ FDI FK+ SSEQKLSLSCEPKAKVQA+VGFDSF+  I+TN+LD +
Sbjct: 2384 R-PSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTS 2442

Query: 2423 EPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYF 2482
            EPL+F+L +K T+++I+HIFS+E S SFGLDLID+ FMFTHP+IINM+G  LIS+V++YF
Sbjct: 2443 EPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYF 2502

Query: 2483 NVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHLTL----PQPSNLYGEIPWSFT 2538
            NVKQLQNLYLF+DIWKLS+ +RP P  K      E+ H+ +      P ++   IPW FT
Sbjct: 2503 NVKQLQNLYLFLDIWKLSNLLRPKPMKKP-----EDHHVAIDAPPSSPMDVGNIIPWCFT 2557

Query: 2539 LIFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFE 2598
            LIF NING  DLGPSLG+LSL +++ W ASDHY+ KRQ++ A+ D +   +KGRLSGI E
Sbjct: 2558 LIFANINGKVDLGPSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVE 2617

Query: 2599 LDGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEK 2658
            LDGA W +EV+WPK      YPLV +S  I N+SLK AFDYHMFLIGT+    F LHSE+
Sbjct: 2618 LDGALWAAEVNWPKYDDP--YPLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSER 2675

Query: 2659 DIVGTMPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLE 2718
            D  G MPDLLKV  TCE I++CSTALVAAN+LDLYNT+MRMRQD  + YLETLRES+T +
Sbjct: 2676 DTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTD 2735

Query: 2719 TRGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAG 2778
            T+   D Y+DIL+ LNL+QTDV  +I+ L +Q+SPI+LFD+EVLV+NI N+ A   T AG
Sbjct: 2736 TKETVD-YKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAG 2794

Query: 2779 EKLKTILELEVYDGYVALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAM 2838
            EKL+T L L++Y+ + +LS+SK E+DED VS ISV DYM YASKI GGTI ++PKL I+M
Sbjct: 2795 EKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISM 2854

Query: 2839 TSWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQ 2898
             ++Q+ NSDILEY Y+ TF DKIAV+WNLGPVNFIKEMWTTH+KALAVRRSQ+++ T   
Sbjct: 2855 HTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLVGTTGD 2914

Query: 2899 TDEEVQKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQT 2958
             + +V+KR+++EE +SKL Y+ IEEP+ID PQI+DLGDATP LEWFG+NRK+ P FTHQT
Sbjct: 2915 EEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQT 2974

Query: 2959 VVVPVQKLVHAAEKQYASLLDNS 2981
            V+VPVQKL+H+AEK+YA+++ +S
Sbjct: 2975 VIVPVQKLIHSAEKEYANIVGHS 2997

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 3231 bits (8377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1553/2998 (51%), Positives = 2118/2998 (70%), Gaps = 58/2998 (1%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            M + S+ + VP++  K+FSW              + IFY+GR  AY+ S ILEWLLWKRA
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120
             IK+N+E+LRISLLGGRI+FK++++IHKDYTIS+L+G+LTW+YWLL  RK       K+S
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120

Query: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180
            +G    KN +LPC+F+L CEG E F+YNRT +YDN+INL SK+ER KF+K+L+E  F + 
Sbjct: 121  SG----KNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEP 176

Query: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240
             S              + +S  KL DED  ES Y++ S  +  NDR + +    K    L
Sbjct: 177  FS--------------DGSSADKL-DEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGL 221

Query: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300
              FP+E++++R SL  GNKFTPS++I+S E+G GIID   PKE+LDLY+ K  +E  NF 
Sbjct: 222  SFFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFE 281

Query: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360
            +++K NIGY + + LKFK+D GK+S+LWK F  +  ++T+P+ + +R KK     D F Q
Sbjct: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPV-IPRRGKKAGPSDDAFFQ 340

Query: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420
            KW+GLSLYK +  +  T DLDDI+FDF +HEYAKF+S++KCPK   +Y+ D+PG VPHGA
Sbjct: 341  KWKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGA 400

Query: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480
            HPT  +IDGPDVGNNGAPP  +LD+QI GGSICYGPW QRQ++ +  +L+P VSRT  P+
Sbjct: 401  HPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPI 460

Query: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540
            K+  PGS R+YT  +++I IM+DTTWRI TRE SKD  FL+HYK+T+++YRPFGW+DLRF
Sbjct: 461  KKLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRF 520

Query: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600
             K++YA F  ++ PT EGFKND ++H  + EIRSSVNHDIL+K K FD D D+ YPL WN
Sbjct: 521  CKDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWN 580

Query: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660
                W I+M S QLE FLLREHITL+ADTL+DF++G+PTPYELFRP    +NW+MD Y I
Sbjct: 581  SNTIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSI 640

Query: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRXXX 720
            YLNVNDHNIVNNPLDFNENCYLSLHGD L I++T+P E I   + +++Y I+TPMFR   
Sbjct: 641  YLNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMML 700

Query: 721  XXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780
                     EFMK+KEVGRSYDF+ KG YLLYSELD+DNVD+++I C S  T L CYGFV
Sbjct: 701  NTPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFV 760

Query: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDNGDVYSDGESGMD 840
            +RYL NVKMNYFG+FFNF+TSEEYTG+                      D      S  +
Sbjct: 761  MRYLINVKMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKN 820

Query: 841  DAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELII 900
            DA      +   +KRSDL+RT NETD++ TFSVW+GA+ILPETIY+ D C AL F EL++
Sbjct: 821  DA-----EDNGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVV 875

Query: 901  DLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRMF 960
            D RS NYYMD++A L  T ++R+  K   ++F  +  +N    +  G LSDL+IHGHRM+
Sbjct: 876  DFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMY 935

Query: 961  GLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVINDM 1020
            GLPP EPTYFC+WD ++G LN+NS+ +FLKGF TSF ++GFG+ DLENILLY  E INDM
Sbjct: 936  GLPPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDM 995

Query: 1021 TSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYGL 1080
            TSLTV+A+ I+++L + V      +  + + FT IDFE+  YS R+D+ +P L +S+  +
Sbjct: 996  TSLTVHAERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCV 1055

Query: 1081 DIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKKE 1140
              DG      NF TK+  T+F Q K+  + RS QR YI +ND+ +HR  FLLP  +Q  +
Sbjct: 1056 MGDGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSD 1115

Query: 1141 LYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFG---STNT 1197
             Y +LYG+I PSSS+P L LP LP T+D+I+ED +GEY +LL+    F+  F    ST  
Sbjct: 1116 TYQKLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLEATNPFKDLFAETPSTVE 1175

Query: 1198 PNQAS---THHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLSS 1254
            P +AS      EE  DPLEF     + E N++ DN VID+ YI ++I+P +  + +SL  
Sbjct: 1176 PLRASFTEDDDEEAADPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLE 1235

Query: 1255 TVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLDK 1314
              Y E++VQV+DDIEI  +K LS  QEG  SI+NI + V Y ++ W E    G ELYLD+
Sbjct: 1236 QFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDR 1295

Query: 1315 LDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCELW 1374
            ++++MS++++EK+R    LE+ +LAK +++RA+++++ + +  ++RPPALSL +EG E+W
Sbjct: 1296 INYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVW 1355

Query: 1375 SATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKL 1434
            S+T ++QVN              Q+EWLF + ++Q   +Q + T++NS+Q   + ++ +L
Sbjct: 1356 SSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTEL 1415

Query: 1435 ISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESG 1494
            ISKLTAA+++YQISHDPYVITKPAFI RLSKGHVRENRSWKIITRLRHILTY+P DW++ 
Sbjct: 1416 ISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTN 1475

Query: 1495 VENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRI 1554
            ++  LKE+  +   +AK +FMSVFS WRNWEFSDVARSYIYG+LFL + A+    S++++
Sbjct: 1476 IDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKL 1535

Query: 1555 IKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSVKG 1614
            +K  + SF+LT Y  GY+++ NFV+ +AN+V + TPP T    +RE+ I +TG +GSVKG
Sbjct: 1536 LKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSSNREETIEITGKVGSVKG 1595

Query: 1615 NFSDEXXXXXXXXXXXNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKL 1674
             FSD+               E  +  P  +   + K FK+N +LL +K+E+Q+V+ ++K+
Sbjct: 1596 KFSDKLLKLQDLIPLVVAVTEDDKSDPKAE---LSKQFKMNTVLLVDKSEIQVVMDKTKV 1652

Query: 1675 TNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVES 1734
             +R + G+VSLL ++ K++ S AGS+++++++SE  + H +T L E Q+ DFS+ AT E+
Sbjct: 1653 MSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTEA 1712

Query: 1735 WSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKSPK 1794
            WS KPT+LV+ QCA  H ++M+ T  +VN++ E+ ++V  + +Q+    +    +NKS  
Sbjct: 1713 WSHKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPK---SKNKS-- 1767

Query: 1795 KKLKDVEIEVV--CQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFF 1852
             +     I  V  C  SNVS EIMP+SPFYIRHE K+ D+ F +FGS  +++ +WDTDFF
Sbjct: 1768 -QFVGSRINTVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFF 1826

Query: 1853 LRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDER 1912
            + S  TK+QY R SFGD +I     +  + +++ ++S SMIKLTFSEP RI++SFLQDE+
Sbjct: 1827 MTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEK 1886

Query: 1913 TASESXXXXXXXXXXXXXQTEGRLQPATTKEM-RWLLDTDIKYFGILVPISTTYFVFETH 1971
             AS+                    +  T  +M  W LDT+I YFGILVP+++TYFVFE H
Sbjct: 1887 LASQGINLLSSLNSLFLTTDPMNAKKETPAKMINWTLDTNISYFGILVPVASTYFVFELH 1946

Query: 1972 ALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMME 2031
             L+LS+++ +     E+     Q+SIEN++FLIK+R +P  LS++LDFSI  ST+Q+  +
Sbjct: 1947 MLLLSLTNTNNGLLPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTAD 2006

Query: 2032 LDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIXXXXXXXXXXX 2091
             + SFQVES+HFR+ LSP SL+RL+WG  + L +  YY ++   ++W+I           
Sbjct: 2007 TEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNI--RMFTGKSDK 2064

Query: 2092 XXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFS 2151
               I +N  S H+LSY FCIGW+F       PG+M G++RLFSAYE  +GK T+VDAFFS
Sbjct: 2065 PKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFS 2124

Query: 2152 VARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTF 2211
            V+ G TS+TF+   +E E  NRS+LPNMQI+YW K+ G +KD F RFHGEALDV+FL +F
Sbjct: 2125 VSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSF 2184

Query: 2212 ITVIESMLQSFQVFQELKTSLIQPXXXXXXXXXXPKI--------KSLAPFLSNIKSVNC 2263
            + VI+S LQS + FQELK +++            P           SLAPFL NI+SVNC
Sbjct: 2185 MDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNC 2244

Query: 2264 QFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTH 2323
             FKYDGGVF+V++++DIE+  EPSFELK+P V I+  YKH+    KPH IR L+ +  TH
Sbjct: 2245 NFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTH 2304

Query: 2324 NTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFK 2383
            NTL+A CAPL+ EF E +  M+KKHS+  K      N +K  +QN+DYKRLLD FD+A K
Sbjct: 2305 NTLYAGCAPLLMEFSESLQNMIKKHSTGEK----KPNFTKPSTQNVDYKRLLDQFDVAVK 2360

Query: 2384 LTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFS 2443
            LTS++Q+LSLSCEPKAKVQADVGF+SF+  + TN  D  +PL FSL++++TKASIKHIFS
Sbjct: 2361 LTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFS 2420

Query: 2444 KETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFI 2503
            +E STSF +  +DL  +FTHPD+I+MYGT L+S+V ++FNVKQLQNLYLF+DIW+ SS +
Sbjct: 2421 REVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSIL 2480

Query: 2504 RPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSLKLKR 2563
               P  + NN +     L+     ++  EIPW FTLIFTN++G  DLGPSLGV+SL+ +R
Sbjct: 2481 HTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQR 2540

Query: 2564 TWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVN 2623
            TW+A+DHY +KRQ++ AFTD +S  S+GRLSG+FE+  ASW+SEV WP E   + +PLV+
Sbjct: 2541 TWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVS 2600

Query: 2624 VSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTA 2683
             S+NID++++KAAFDYHMFLIGTI+  +F LH+EKD  G +PDLL+V+F+ + I + STA
Sbjct: 2601 TSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTA 2660

Query: 2684 LVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTN 2743
            LVAANILD+YNT++RMRQDNKI Y+ETLR+S+  E++  P  Y+DILRSL LL+TD+S N
Sbjct: 2661 LVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESK-QPILYKDILRSLKLLRTDLSVN 2719

Query: 2744 IHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKREI 2803
            I  LK+Q+SPI+LFD+EVLV+ I+ +S R+ T +G+KLKT L+L+V D   ALSTSK E+
Sbjct: 2720 ISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEEL 2779

Query: 2804 DEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAV 2863
            DE+  ++I++ DYM YASKI GGTII++PKL + MT+ QEE ++ LEYL+ C+F DKI+V
Sbjct: 2780 DEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISV 2839

Query: 2864 KWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEE 2923
            +WNLGP+NFIKEMWTTHVKALAVRRSQ    +  QT+EE+++ IK EEN SK  Y+ +EE
Sbjct: 2840 RWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTEEELEESIKREENASKFNYIALEE 2899

Query: 2924 PRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNS 2981
            P+I++PQIRDLG+ATPP+EWFGVNRKRLP FTHQT V+PVQKLV+ AEKQY  +LD++
Sbjct: 2900 PQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKILDDT 2957

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 3205 bits (8309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1550/3000 (51%), Positives = 2113/3000 (70%), Gaps = 62/3000 (2%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            M + S+ + VP++  K+FSW              ++IFY+GR  AY+ S ILEWLLWKRA
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120
             IK+N+E+LR+SLLGGRI FKN+++IHKDYTIS+L+G+LTW+YWLL  RK      +K S
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120

Query: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180
            +G    K  +LPC+  + CEG EIF+YNRT +YDN+INL SK+ER KF+K+L+E  F + 
Sbjct: 121  SG----KKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEP 176

Query: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240
             S              + +S  KL DED  ES Y++ S  +  NDR + +    K    L
Sbjct: 177  FS--------------DGSSADKL-DEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLL 221

Query: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300
               P+E++  R SL  GNKFTPS++I+S E G GIID   PKE+LDLY+ K  +E  NF 
Sbjct: 222  MFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFE 281

Query: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360
            +++K NIGY + + LKFKIDRGK+S+LWK F  +  I+T+P+   + KK      D F  
Sbjct: 282  ISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYH 341

Query: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420
            KW+GLSLYK +  +    DLDD++FD  NHEYAKF+S++KCPK    Y+ D+PG VPHGA
Sbjct: 342  KWKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGA 401

Query: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480
            HPT  +IDGPDVGNNGAPP  +LD+QI GGSICYGPW QRQ++ +  +L+P VSRT  P+
Sbjct: 402  HPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPI 461

Query: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540
            K+  PGS RIYT  +++ISIM+DTTWRI TRE SKD  FLKHYKETN++YRPFGW+DLRF
Sbjct: 462  KKLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRF 521

Query: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600
             K++YA F  ++ PT +GF+N+ ++H  + EIRSSVNHDIL+K K FD D D+ YPL WN
Sbjct: 522  CKDTYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWN 581

Query: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660
             +A W I+M S QLE FLLREHITL+ADTL+DF++G+PTPYELFRP    +NW+M+ Y I
Sbjct: 582  SKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSI 641

Query: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRXXX 720
            YLNVNDHNIVNNPLDFNENCYLSLHGD L I+VT+P E I   + +++Y I+TPMFR   
Sbjct: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMML 701

Query: 721  XXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780
                     EFMK+KEVGR+YDF+ KGSYLLYSELD+DNVDT+ I C S+ T L CYGFV
Sbjct: 702  NTPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFV 761

Query: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDNGDVYSDGESG-M 839
            +RYL NVKMNYFG+FFNF+TSEEYTG+                      D+ S  +SG  
Sbjct: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGDVTTKSSV------ADLASTVDSGYQ 815

Query: 840  DDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELI 899
            + ++  E  ++  +KRSDL+RT NETD++ TFSVWDGA+ILPETIY+ D C AL F EL+
Sbjct: 816  NSSLKNESEDKGPMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELV 875

Query: 900  IDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRM 959
            +D RS NYYMD++A L  T ++R+  K   ++F  +  +N    +  G LSDL+IHGHRM
Sbjct: 876  VDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRM 935

Query: 960  FGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVIND 1019
            +GLPP EPTYFC+WD ++G L ++S+ +F+KGF  SF +IGFG+ DLENILLY  E IND
Sbjct: 936  YGLPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETIND 995

Query: 1020 MTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYG 1079
            MTSLTV+ ++I + LK+ V      +  + + FT IDFE+  YS R+D+ IP L +S+  
Sbjct: 996  MTSLTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNC 1055

Query: 1080 LDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKK 1139
            +  DG       F TK+  T+F Q K+  + RS QR YIT++D+ +HR  FLLP  +Q  
Sbjct: 1056 VMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDS 1115

Query: 1140 ELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFG---STN 1196
            + Y  LYG+I PSSS+P L LP LP T+D+I+ED +GEY +LL+    F+  F    ST 
Sbjct: 1116 DTYQNLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLETTNPFKNIFAETPSTM 1175

Query: 1197 TPNQAS---THHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLS 1253
             P++AS     ++E+ DP  F     + ++N++ DN V+D+ YI ++++P +  + +SL 
Sbjct: 1176 EPSRASFSEDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLL 1235

Query: 1254 STVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLD 1313
              +Y EN+VQV+DDIEI  +K LS  QEG +SI+NI + + Y ++ W E    G ELYLD
Sbjct: 1236 EQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLD 1295

Query: 1314 KLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCEL 1373
            ++D++MS++++EK+R   LLE+  LAK +++R +++++ +    ++RPPALSL +EG E+
Sbjct: 1296 RIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEV 1355

Query: 1374 WSATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRK 1433
            WS+T ++QVN              Q+EWLF + ++Q   +Q + T+ NS+Q   + S+ +
Sbjct: 1356 WSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTE 1415

Query: 1434 LISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWES 1493
            LISKLTAA+++YQISHDPYVITKPAFI RLSKGHVRENRSWKIITRLRHILTY+P DW+S
Sbjct: 1416 LISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQS 1475

Query: 1494 GVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSM-R 1552
             ++  LKEK      +AK +FMSVFS WRNWEFSDVARSYIYG+LF T + EKHKQ++ +
Sbjct: 1476 NIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLF-TAENEKHKQNLIK 1534

Query: 1553 RIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSV 1612
            +++K  + SF+LT Y  GY+++ NFV+ +AN+V + TPP T    +RE+ I +TG +GSV
Sbjct: 1535 KLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLPSNREETIEITGRVGSV 1594

Query: 1613 KGNFSDEXXXXXXXXXXXNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGES 1672
            KG FSD                E  +  P      + K FK+N +LL +K+E+QLV+ ++
Sbjct: 1595 KGKFSDRLLKLQDLIPLIAAVGEDDKSDPK---KELSKQFKMNTVLLVDKSELQLVMDQT 1651

Query: 1673 KLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATV 1732
            KL +R + G+VSLL ++ K++ S AGS+++++++SE  + H +  L E Q+RDFS+ AT 
Sbjct: 1652 KLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFSVLATT 1711

Query: 1733 ESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKS 1792
            E+WS KPT+L++ QCA  H ++M+ T  LV ++ E+ +++      + I +R+       
Sbjct: 1712 EAWSHKPTILINNQCADLHFRAMSSTEQLVTAITEIRESL------MMIKERIKFKPKSK 1765

Query: 1793 PKKKLKDVEIEVV--CQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTD 1850
             K +  D +I  V  C  SNVS E+MP+SPFYIRHE K+ D+ F +FGS  +++ +WDTD
Sbjct: 1766 KKSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTD 1825

Query: 1851 FFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQD 1910
            FF+ S  TK+QY R SFGD +I   +    + +++ ++S SMIKLTFSEP RI++SFLQD
Sbjct: 1826 FFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQD 1885

Query: 1911 ERTASESXXXXXXXXXX-XXXQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFE 1969
            E+ AS+                   + + A +  + W LDT I YFG+LVP+++TYFVFE
Sbjct: 1886 EKLASQGINLLYSLKPLFFSSNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFE 1945

Query: 1970 THALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKM 2029
             H L+LS+++ +     E+ +   Q SIEN++FLIK+R +P  LS++LDFSI  ST+Q+ 
Sbjct: 1946 LHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRT 2005

Query: 2030 MELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIXXXXXXXXX 2089
            ++ + SFQVES+HFR+ LSP SL+RL+WG  + L L++YY  +   ++W+          
Sbjct: 2006 VDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDK 2065

Query: 2090 XXXXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAF 2149
                 I  N  S H+LSY FCIGW+F     S PG+MLG++RLFSAYE  +GK T+VDAF
Sbjct: 2066 SKEMPI--NFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAF 2123

Query: 2150 FSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLT 2209
            FSVA G TS+TF+   +E +  NRS+LPNMQI+YW K+ G +KD F RFHGEALDV+F+ 
Sbjct: 2124 FSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVP 2183

Query: 2210 TFITVIESMLQSFQVFQELKTSLI--------QPXXXXXXXXXXPKIKSLAPFLSNIKSV 2261
            +F+ VIES LQS + FQELK +++        +               SLAPFL NI+SV
Sbjct: 2184 SFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNSYASTSVESASSSLAPFLDNIRSV 2243

Query: 2262 NCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGS 2321
            N  FKYDGGVF+V+++EDIE+  EPSFE+K+P V I+  YKH+   +KPH  R L+ +  
Sbjct: 2244 NSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLITVDP 2303

Query: 2322 THNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIA 2381
            THNTL+A CAPL+ EF E + +M+KKHS++ K      N +K  SQN+DYKRLLD FD+A
Sbjct: 2304 THNTLYAGCAPLLMEFSESLQKMIKKHSTDEK-----PNFTKPSSQNVDYKRLLDQFDVA 2358

Query: 2382 FKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHI 2441
             KLTS++Q+LSLSCEPKAKVQADVGF+SF+  + TN  D  +PL FSL+++ TKASIKHI
Sbjct: 2359 VKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHI 2418

Query: 2442 FSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSS 2501
            FS+E STSF +  +DL  +FTHPD+I+MYGTGL+S++ ++FNVKQLQNLYLF+DIW+ SS
Sbjct: 2419 FSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSS 2478

Query: 2502 FIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSLKL 2561
             +   P  ++ N + E   LT    ++   EIPW FTLIFTN++G  DLGPSLG++SL+ 
Sbjct: 2479 ILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVDLGPSLGMISLRT 2538

Query: 2562 KRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPL 2621
            +RTW+A+DHY +KRQ++ AFTD +S  S+GRLSG+FE+  ASW+SEV WP EK  + +PL
Sbjct: 2539 QRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPL 2598

Query: 2622 VNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICS 2681
            V+ S+NID++++KAAFDYHMFLIGTIS   F LH+EKD  G +PDLL+V+F+ + I + S
Sbjct: 2599 VSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSS 2658

Query: 2682 TALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVS 2741
            TALV ANILD+YNT++RMRQDNKI Y+ETLR+S+  E+R  P  Y+DILRSL LL+TD+S
Sbjct: 2659 TALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESR-QPILYKDILRSLKLLRTDLS 2717

Query: 2742 TNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKR 2801
             NI   K+Q+SPI+LFD+EVLVI I+ +S R+ T +G+KLKT L+L+V D   ALSTSK 
Sbjct: 2718 VNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKE 2777

Query: 2802 EIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKI 2861
            E+DE+  ++I++ DYM YASKI GGTII++PKL + MT+ QEE ++ LEYL+ C+F DKI
Sbjct: 2778 ELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKI 2837

Query: 2862 AVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPI 2921
            +V+WNLGPV+FIKEMWTTHVKALAVRRSQ    +  QT+EE+++ IK+EE  SK  Y+ +
Sbjct: 2838 SVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTEEELEESIKKEEAASKFNYIAL 2897

Query: 2922 EEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNS 2981
            EEP+I++PQIRDLGDATPP+EWFGVNRK+ P FTHQT V+PVQKLV+ AEKQY  +LD++
Sbjct: 2898 EEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKILDDT 2957

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 3200 bits (8296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1548/3008 (51%), Positives = 2115/3008 (70%), Gaps = 77/3008 (2%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            M + S+ + VP++  K+FSW              ++IFY+GR  AY+ + ILEWLLWKRA
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120
            +IK+N+E+LR+SLLGGRI FK++++IHKDYTIS+L+G+LTW+YWLL  RK      +KDS
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120

Query: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180
                + KN +LPC+F L CEG EIF+YNRT +YDN+INL SK+ER KF+K+L+E  F + 
Sbjct: 121  ----LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE- 175

Query: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240
                         S  + +S  KL DED  ES Y++ S  +  NDR + +    K   FL
Sbjct: 176  -------------SFSDGSSADKL-DEDLSESAYTTNSDASIINDRDYQETDIGKLPKFL 221

Query: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300
            +  P+E++ +R SL  GNKFTPS++I+S E+G G+ID   PKE+LDLY+ K  +E  NF 
Sbjct: 222  KFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFE 281

Query: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360
            +++K NIGY + + LKFK+D GK+S+LWK F  +  I+T+P+   + KKK     D F Q
Sbjct: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQ 341

Query: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420
            KW+GLSLYK    +    DLDDI+FDF NHEYAKF+S++KCPK    Y+ D+ G VPHGA
Sbjct: 342  KWKGLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGA 401

Query: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480
            HPT  +IDGPDVGNNGAPP  +LD+QI GGSICYGPW QRQ++ +  +L+P VSRT  PV
Sbjct: 402  HPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPV 461

Query: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540
            K+  PGS RIYT  ++++ IM+DTTWRI TRE SKD  FL+HYKET+++YRPFGW+DLRF
Sbjct: 462  KKLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRF 521

Query: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600
             K++YA F   L PT EGF+N+ ++H  + EIRSSVNHDIL+K K F+ D D+ YPL WN
Sbjct: 522  CKDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWN 581

Query: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660
             +A W I+M S QLE FLLREHITL+ADTL+DF++GEPTPYELFRP    +NW+M+ Y I
Sbjct: 582  SKAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSI 641

Query: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRXXX 720
            YLNVNDHNIVNNPLDFNENCYLSLHGD L I++T+P E I   + +I+Y I+TPMFR   
Sbjct: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMML 701

Query: 721  XXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780
                     EFMK+KEVGR+YDF+ KGSYLLYSELD+DNVDT+ I C S  T L CYGFV
Sbjct: 702  NTPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFV 761

Query: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDNGDVYSDGESG-M 839
            +RYL NVKMNYFG+FFNF+TSEEYTG+                      D+ S  +SG  
Sbjct: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVL------DLASTLDSGYQ 815

Query: 840  DDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELI 899
            + ++  E  ++  +KRSDL+RT NETD++ TFSVW+GA+ILPETIY+ D C AL F EL+
Sbjct: 816  NSSLKNESEDKDPVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELV 875

Query: 900  IDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRM 959
            +D RS NYYMD++A L  T ++R+  K   ++F  +  +N  + +  G LSDL+IHGHRM
Sbjct: 876  VDFRSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRM 935

Query: 960  FGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVIND 1019
            FGLPP EPTYFC+WD ++G L ++S+ +F+KGF  SF +IGFG+ DLENILLY  E ++D
Sbjct: 936  FGLPPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDD 995

Query: 1020 MTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYG 1079
            MTSLTV+A+ I ++  + V      +  + + FT IDFE+  YS R+D+ IP L +S+  
Sbjct: 996  MTSLTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSC 1055

Query: 1080 LDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKK 1139
            +  DG       F TK+  T+F Q K+  + RS QR YIT +D+ +HR  FLLP  +Q  
Sbjct: 1056 VMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDS 1115

Query: 1140 ELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFG---STN 1196
            + Y +LYG+I PSSS+P L LP LP T+DFI+ED +GEY +LL+    F+  F    ST 
Sbjct: 1116 DTYQKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLETTNPFKDIFAETPSTV 1175

Query: 1197 TPNQAST---HHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLS 1253
             P++AS+    ++E  DPLEF     +  +N+Q  N VID+ YI ++++P +  + +SL 
Sbjct: 1176 EPSRASSTEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLL 1235

Query: 1254 STVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLD 1313
               Y E++VQV+DDIEI  +K LS  QEG +SI+NI + + Y ++ W E    G ELYLD
Sbjct: 1236 KEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQETGEEGFELYLD 1295

Query: 1314 KLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCEL 1373
            ++D++MS++++EK+R   LLE+  LA+ +++R +++++ +    ++RPPALSL +EG E+
Sbjct: 1296 RIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEV 1355

Query: 1374 WSATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRK 1433
            WS+T ++QVN              Q+EWLF + ++Q   +Q  + + +S+Q+    S+ +
Sbjct: 1356 WSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTE 1415

Query: 1434 LISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWES 1493
            LISKLTAA+++YQISHDPYVITKPAFI RLSKGHVRENRSWKIITRLRHILTY+P DW+ 
Sbjct: 1416 LISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQD 1475

Query: 1494 GVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRR 1553
             +E  LKE+      +AK +FMSVFS WRNWEFSDVARSYIYG+LF  + AE  +  M++
Sbjct: 1476 NIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKK 1535

Query: 1554 IIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSVK 1613
            ++K  + SF+LT Y  GY+++ NFV+ +AN+V + TPP T   ++RE+ I +TG +GSVK
Sbjct: 1536 LLKCTMGSFYLTVYGEGYEVEHNFVIADANLVVDLTPPVTSLSLNREETIEITGRVGSVK 1595

Query: 1614 GNFSD------EXXXXXXXXXXXNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQL 1667
            G FSD      +           +K   K E S         K FK+N +LL +K+E+QL
Sbjct: 1596 GKFSDRLLKLQDLIPLVAAVGGGDKSDAKAELS---------KQFKMNTVLLVDKSEIQL 1646

Query: 1668 VIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFS 1727
            V+ ++KL +R + G+VSLL ++ K++ S AGS+++++++SE  + H +  L E Q+RDFS
Sbjct: 1647 VMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQLRDFS 1706

Query: 1728 LSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAE 1787
            + AT E+WS KPT+L++ QCA  H ++M+ T   V  + E+ ++V      L I DR+  
Sbjct: 1707 ILATTEAWSHKPTILINNQCADLHFRAMSTTEQTVTVITEIRESV------LKIKDRIKF 1760

Query: 1788 GENKSPKKKLKDVEIEVV--CQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMID 1845
                  + +    +I +V  C  SNVS EIMP+SPFYIRHE K+ D+ F +FGS  V++ 
Sbjct: 1761 KPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLS 1820

Query: 1846 VWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILS 1905
            +WDTDFF+ S  TK+QY R SFGD +I   + + ++ +++ ++S SMIKLTFSEP RI++
Sbjct: 1821 IWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRRIVN 1880

Query: 1906 SFLQDERTASESXXXXXXXXXXXXXQTEG----RLQPATTKEMRWLLDTDIKYFGILVPI 1961
            SFLQDE+ AS+               T G    + + A  + + W LDT I YFGILVP+
Sbjct: 1881 SFLQDEKLASQGINLLSSLKSLLF--TSGLPKKKKKKAPARMINWTLDTSITYFGILVPV 1938

Query: 1962 STTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSI 2021
            ++TYFVFE H L+LS+++ +     E+ +   Q SIEN++FLIK+R +P  LS++LDFSI
Sbjct: 1939 ASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDFSI 1998

Query: 2022 SFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIX 2081
              ST+Q+ ++ + SFQVES+HFR+ LSP SL+RL+WG  + L L +YY  +   ++WDI 
Sbjct: 1999 KVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDI- 2057

Query: 2082 XXXXXXXXXXXXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYG 2141
                         I +N  S H+LSY FCIGW+F     S PG+MLG++RLFSAYE  +G
Sbjct: 2058 -KMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFG 2116

Query: 2142 KLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGE 2201
            K T+VDAFFSVA G  S+TF+   +E +  NRS+LPNMQI+YW K+ G +KD F RFHGE
Sbjct: 2117 KFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGE 2176

Query: 2202 ALDVSFLTTFITVIESMLQSFQVFQELKTSLIQPXXXXXXXXXXPKI--------KSLAP 2253
            ALDV+F+ +F+ VI+S LQS + FQELK +++            P           SLAP
Sbjct: 2177 ALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDNPYATSSMESASNSLAP 2236

Query: 2254 FLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWI 2313
            FL NI+SVN  FKYDGGVF+V++++DIE+  EPSFE+K+P V I+  YKHN    KPH I
Sbjct: 2237 FLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRI 2296

Query: 2314 RALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKR 2373
            R L+A+  T NTL+A CAPL+ EF E + +M+KKHS++ K      + +K  SQN+DYKR
Sbjct: 2297 RILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDK-----PSFTKPSSQNVDYKR 2351

Query: 2374 LLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKK 2433
            LLD FD+A KLTS++Q+LSLSCEPKAKVQADVGF+SF+  + TN  D  +PL FSL++++
Sbjct: 2352 LLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQ 2411

Query: 2434 TKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLF 2493
            TKASI+HIFS+E STSF +  +DL  +FTHPD+I+MYGT L+S++ ++FNVKQLQNLYLF
Sbjct: 2412 TKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLF 2471

Query: 2494 IDIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPS 2553
            +DIW+ SS +   P   S + + +   LT     ++  EIPW FTLIFTN++G  DLGPS
Sbjct: 2472 LDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPS 2531

Query: 2554 LGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKE 2613
            LGV+SL+ +RTW+A+DHY +KRQ++ AFTD +S  S+GRLSG+FE+  ASW+SEV W  E
Sbjct: 2532 LGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLE 2591

Query: 2614 KRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFT 2673
            K  +++PLV+ S+NID++++KAAFDYHMFLIGTI+  +F LH+EKD  G +PDLL+V+F+
Sbjct: 2592 KSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFS 2651

Query: 2674 CEMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSL 2733
             + I + STALVAANILD+YNT++RMRQDNKI Y+ETLR+S+  E++  P  Y+DILRSL
Sbjct: 2652 SDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESK-QPILYKDILRSL 2710

Query: 2734 NLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGY 2793
             LL+TD+S NI  LK+Q+SPI+LFD+EVLV+ I+N+S R+ T +G+KLKT L+L+V D  
Sbjct: 2711 KLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVS 2770

Query: 2794 VALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLY 2853
             ALSTSK E+DE+  ++I++ DY+ YASKI GGTII++PKL + MT+ QEE ++ +EYL+
Sbjct: 2771 AALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLF 2830

Query: 2854 KCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENI 2913
             C+F DKI+VKWNLGPVNFIKEMWTTHVKALAVR+SQ    +  QT+EE+++ IK +E  
Sbjct: 2831 ACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQTEEELEESIKTKETT 2890

Query: 2914 SKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQ 2973
            SK  Y+ +EEP+I +PQIRDLGDATPP+EWFGVNRKR P FTHQT V+PVQKLV+ AEKQ
Sbjct: 2891 SKFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQ 2950

Query: 2974 YASLLDNS 2981
            Y  +LD +
Sbjct: 2951 YVKILDGT 2958

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 3197 bits (8290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1539/3000 (51%), Positives = 2114/3000 (70%), Gaps = 62/3000 (2%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            M + S+ + VP++  K+FSW              +++FY+GR  AY+ S ILEWLLWKRA
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120
             +K+N+E+LR+SLLGGRI FK++++IHKDYTIS+L+G++TW+YWLL  RK     E  D+
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKA----ELIDN 116

Query: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180
            N    K N +LPC+F L CEG EIF+YNRT +YDN+INL SK+ER KF+K+L+E  F + 
Sbjct: 117  NKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEP 176

Query: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240
             S              + +S  KL DED  ES Y++ S  +  NDR + +    K   FL
Sbjct: 177  FS--------------DGSSADKL-DEDLSESAYTTNSDASIINDRDYQETDIGKHPQFL 221

Query: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300
            +  P+E+   R SL  GNKFTPS++I+S E G GI+D   PKE++DLY+ K  +E  NF 
Sbjct: 222  KFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFE 281

Query: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360
            +++K NIGY + + LKFK+D GK+S+LWK F  +  ++++P+   + KK      D F Q
Sbjct: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQ 341

Query: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420
            KW+GLSLYK T  E   +DLDDI+FD  NHEYAKF+S++KCPK   +Y+ D+PG VPHGA
Sbjct: 342  KWKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGA 401

Query: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480
            HPT S+IDGPDVGNNGAPP  +LD+QI GGSICYGPW QRQ++ +  +L+P VSRT  P+
Sbjct: 402  HPTISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPI 461

Query: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540
            K+  PGS R+YT  +++ISI +DTTWRI TRE SKD  FL+HYKET+++YRPFGW+DLRF
Sbjct: 462  KKLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRF 521

Query: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600
             K++YA F  ++ PT EGF+N+ ++H  + EIRSSVNHDIL+K K F+ D D+ YPL WN
Sbjct: 522  CKDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWN 581

Query: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660
             +A W I+M S QLE FLLREHITL+ADTL+DF++G+PTPYELFRP    +NW+M+ Y I
Sbjct: 582  SKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSI 641

Query: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRXXX 720
            YLNVNDHNIVNNPLDFNENCYLSLHGD L I+VT+P E I   + +I+Y I+TPMFR   
Sbjct: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMML 701

Query: 721  XXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780
                     EFMK+KEVGR+YDF+ KG+YLLYSELD+DNVDT+ I C S  T L CYGFV
Sbjct: 702  NTPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFV 761

Query: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDNGDVYSDGESG-M 839
            +RYL NVKMNYFG+FFNF+TSEEYTG+                      D+ S  +SG  
Sbjct: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVV------DLASTVDSGYQ 815

Query: 840  DDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELI 899
            + ++      +  +KRSDL+RT NETD++ TFSVW+GA+ILPETIY+ D C AL F EL+
Sbjct: 816  NSSVKNNSEAKGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELV 875

Query: 900  IDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRM 959
            +D RS NYYMD++A L+ T ++R+  K   ++F  +  +N    +  G LSDL+IHGHRM
Sbjct: 876  VDFRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRM 935

Query: 960  FGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVIND 1019
            +GLPP EPTYFC+WD ++G L+++S+ +F+KGF +SF +IGFG+ DLENILLY  E I+D
Sbjct: 936  YGLPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDD 995

Query: 1020 MTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYG 1079
            MTSLTV+A+ I ++L++ V      +  + + FT IDFE+ NYS R+D+ +P LK+S+  
Sbjct: 996  MTSLTVHAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNC 1055

Query: 1080 LDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKK 1139
            +  DG       F TK+  T+F Q K+  + RS QR YIT +D+ +HR SFLLP  +Q  
Sbjct: 1056 VMGDGVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDS 1115

Query: 1140 ELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFG---STN 1196
            + Y +LYG+I PSSS+P L LP LP T+DFI+ED +GEY +LL+    F+  F    ST 
Sbjct: 1116 DTYQKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTV 1175

Query: 1197 TPNQAS---THHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLS 1253
             P++AS     ++E+     F     + + + + DN V+D+ YI ++I+P +  + +SL 
Sbjct: 1176 EPSKASFTEDDNDEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLL 1235

Query: 1254 STVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLD 1313
              +Y EN+VQV+DDIEI  +K LS  QEG +SI+NI + + Y ++ W E    G ELYLD
Sbjct: 1236 EQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLD 1295

Query: 1314 KLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCEL 1373
            ++D++M ++++EK+R   LLE+  LA+ +++R +++++ +    ++RPPALSL +EG E+
Sbjct: 1296 RIDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEI 1355

Query: 1374 WSATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRK 1433
            WS+T  +QVN              Q+EWLF + ++Q   LQ + T+ +S+Q   T S+ +
Sbjct: 1356 WSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTE 1415

Query: 1434 LISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWES 1493
            LIS+LTAA+++YQISHDPYVITKPAFI RLSKGHVRENRSWKIITRLRHILTY+P DW++
Sbjct: 1416 LISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQN 1475

Query: 1494 GVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSM-R 1552
             ++  LKE+     ++AK +FMSVFS WRNWEFSDVARSYIYG+LF T+  EKHKQ++ +
Sbjct: 1476 NIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDN-EKHKQNLIK 1534

Query: 1553 RIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSV 1612
            +++K  + SF+LT Y  GY+++ NFV+ +AN+V + TPP T   ++RE+ I +TG IGSV
Sbjct: 1535 KLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSLNREETIEITGRIGSV 1594

Query: 1613 KGNFSDEXXXXXXXXXXXNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGES 1672
            KG FSD                E  +  P  +   + K F++N +LL +K+E+QLV+ E+
Sbjct: 1595 KGKFSDRLLKLQDLIPLVAAVGEDDKSDPKTE---LSKQFRMNTVLLVDKSELQLVMDET 1651

Query: 1673 KLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATV 1732
            KL +R + G+VSLL ++ K++ S AGS+++++++SE  + H +  L E Q+RDFS+ AT 
Sbjct: 1652 KLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATT 1711

Query: 1733 ESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKS 1792
            E+WS KPT+L++ QCA  H ++M+ T   V ++ E+ ++       L I +R+       
Sbjct: 1712 EAWSHKPTILINNQCADLHFRAMSSTEQTVTAITEIRESA------LKIKERIKFKPKSK 1765

Query: 1793 PKKKLKDVEIEVV--CQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTD 1850
             K +    +I  V  C  SNVS EIMP+SPFYIRHE K+ D+ F +FGS  ++I +WDTD
Sbjct: 1766 KKSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTD 1825

Query: 1851 FFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQD 1910
            FF+ S  TK+QY R SFGD +I   + +  + +++ ++S SMIKLTFSEP RI++SFLQD
Sbjct: 1826 FFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQD 1885

Query: 1911 ERTASESXXXXXXXXXXXXXQTEGRLQPATTKEM-RWLLDTDIKYFGILVPISTTYFVFE 1969
            E+ AS+                  + +      M  W LDT I YFGIL+P+++TYFVFE
Sbjct: 1886 EKLASQGINLLCSLKSLFFSSNIPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFE 1945

Query: 1970 THALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKM 2029
             H L+LS+++ +     E+ +   Q SIEN++FLIK+R +P  LS++LDFSI  ST+Q+ 
Sbjct: 1946 LHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRT 2005

Query: 2030 MELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIXXXXXXXXX 2089
            ++ + SFQVES+HFR+ LSP SL+RL+WG  + L L +YY +    ++W+I         
Sbjct: 2006 IDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNI--KMFTGKS 2063

Query: 2090 XXXXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAF 2149
                 I +N  S H+LSY FCIGW+F     S PG+MLG++RLFSAYE  +GK T+VD+F
Sbjct: 2064 DKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSF 2123

Query: 2150 FSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLT 2209
            FSVA G TS+TF+   +E +  NRS+LPNMQI+YW K+ G +KD F RFHGEALDV+F+ 
Sbjct: 2124 FSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVP 2183

Query: 2210 TFITVIESMLQSFQVFQELKTSLI--------QPXXXXXXXXXXPKIKSLAPFLSNIKSV 2261
            +F+ VI+S LQS + FQELK +++        +               SLAPFL+NI+SV
Sbjct: 2184 SFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSV 2243

Query: 2262 NCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGS 2321
            N  FKYDGGVF+V+++EDIE+  EPSFE+K+P V I+  YKH+   ++PH IR L+ +  
Sbjct: 2244 NSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDP 2303

Query: 2322 THNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIA 2381
            THNTL+A CAPL+ EF E + +M+KKHS++ K      N +K   QN+DYKRLLD FD+A
Sbjct: 2304 THNTLYAGCAPLLMEFSESLQKMIKKHSTDEK-----PNFTKPSPQNVDYKRLLDQFDVA 2358

Query: 2382 FKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHI 2441
             KLTS++Q+LSLSCEPKAKVQADVGF+SF+  + TN  D   PL FSL+++ TKASIKHI
Sbjct: 2359 VKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHI 2418

Query: 2442 FSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSS 2501
            FS+E STSF +  +DL  +FTHPD+I+MYG GL+S+++++FNVKQLQNLYLF+DIW+ SS
Sbjct: 2419 FSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSS 2478

Query: 2502 FIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSLKL 2561
             +   P  +S N   +   LT     +L  EIPW FTLIFTN++G  DLGPSLGV+SL+ 
Sbjct: 2479 ILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRT 2538

Query: 2562 KRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPL 2621
            +RTW+A+DHY +KRQ++ AFTD +S  S+GRLSG+FE+  ASW+SEV W  EK  + +PL
Sbjct: 2539 QRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPL 2598

Query: 2622 VNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICS 2681
            V+ S+NID++++KAAFDYHMFLIGTI+   F LH+EKD  G +PDLL+V+F+ + I + S
Sbjct: 2599 VSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSS 2658

Query: 2682 TALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVS 2741
            TALVAANILD+YNT++RMRQDNKI Y+ETLR+S+  E+R  P  Y+DILRSL LL+TD+S
Sbjct: 2659 TALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESR-QPVLYKDILRSLKLLRTDLS 2717

Query: 2742 TNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKR 2801
             +I  LK+Q+SPI+LFD+EVLV+ I+ +S R+ T +G+KLKT L+L+V D   ALSTSK 
Sbjct: 2718 VSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKE 2777

Query: 2802 EIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKI 2861
            E+DE+  ++I++ DYM YASKI GGTII++PKL + MT+ QEE ++ LEYL+ C+F DKI
Sbjct: 2778 ELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKI 2837

Query: 2862 AVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPI 2921
            +V+WNLGPVNFIKEMWTTHVKALAVRRSQ    +  QT+EE+++ I +EE  SK  Y+ +
Sbjct: 2838 SVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTEEELEESINKEETASKFNYIAL 2897

Query: 2922 EEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNS 2981
            EEP+I++PQIRDLGDATPP+EWFGVNRKR P FTHQT V+PVQKLV+ AEKQY  +LD++
Sbjct: 2898 EEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKILDDT 2957

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 3153 bits (8174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1575/2997 (52%), Positives = 2082/2997 (69%), Gaps = 60/2997 (2%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            M + S+FQ +P++  K+FSW               VIFY+ R +AY  S ILEW LWKR+
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120
            ++K+NIES+RIS LGGR+FFKNV IIH+DYTIS L+  +TWRYWLL  RK  Y  ++ + 
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGY--DTPEL 118

Query: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180
                   + +LPCRF L  EG EIFVYNR  +YDNII  FSKEER +F+KFL+EQ+F D 
Sbjct: 119  PDKASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTD- 177

Query: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240
                    + A  S  ESNS+     ED  ES  + +S  +  NDR+F +  S++   FL
Sbjct: 178  --------SKAEVSNSESNSE-----EDTFESAGTFKSDSSTTNDRVFQEELSERPQ-FL 223

Query: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300
               P++ +V   SL  GNKFTPSL+I S    TG+ID CQP EKLDLYK++  ++   FA
Sbjct: 224  DFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFA 283

Query: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360
            + +K NIG+ EE  +KFKIDR ++S++W++F  +       + L+  +  +    D F +
Sbjct: 284  IDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYE 343

Query: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420
            KW+GLSLY+GTIF  + DD++DI FDF NHEYAKFSS+V+ P+AIFT+E DIPG VPHGA
Sbjct: 344  KWRGLSLYRGTIFGKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGA 403

Query: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480
            HPT +  DGPDVGN+GAPP  SL+IQI GGSIC+GPW QRQ+N +  +L+P  SR   P 
Sbjct: 404  HPTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPT 463

Query: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540
            KR  PG TRIYT  K +IS  ++TTWRI TRE SKD  FL+HY+ETN++YRPFGWIDL+F
Sbjct: 464  KRLTPGCTRIYTQFKTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKF 523

Query: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600
            SK++Y   T A  PT EGFKN ++IHL  NEIRSSVNHDIL+KCK F+F +D+ +PL WN
Sbjct: 524  SKDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWN 583

Query: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660
            + ATWTID+ S QLE F+LREHITLIADTLTDF+SGEPTPYELFRP    INWK++ Y +
Sbjct: 584  EEATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSL 643

Query: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRXXX 720
            YLNVNDHNIVNNPLDFNENCYLS HGD L I++ +P  +++A F E++Y I TPMFR   
Sbjct: 644  YLNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVL 703

Query: 721  XXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780
                     EFMK KEVGRS+DF   GSYL+YSELD+DNVDTI I C S+ T LQCYGFV
Sbjct: 704  NTPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFV 763

Query: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDNGDVYSDGESGMD 840
            IRYL NVKMNYFGDFF+F+TSEEYTG  R                 ++    S  ES   
Sbjct: 764  IRYLTNVKMNYFGDFFHFVTSEEYTGEIR---ANEVQNQFTDRQLYEDKASLSSYESIET 820

Query: 841  DAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELII 900
             ++ +E    + +KRSDL+R  NETDL+ TF+VW+GAI+LPETIYNCD C  L FGEL+I
Sbjct: 821  SSVRKEQTGDSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLI 880

Query: 901  DLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRMF 960
            D RS NYYMDLLAS+ D  + RY  K   +I++SV  DN   ++  G LSD+ IH HRM+
Sbjct: 881  DFRSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMY 940

Query: 961  GLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVINDM 1020
            GLPP EPTYFC+WDF +G L++N +  FL+GF+TSF++I FG  DLENILLY KEVI+DM
Sbjct: 941  GLPPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDM 1000

Query: 1021 TSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYGL 1080
            TSLTV+ ++IS+ ++       +    + + F++I+FE+  Y +RLDL IP   + MY +
Sbjct: 1001 TSLTVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTM 1060

Query: 1081 DIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKKE 1140
            +   KK +LF F TKV+L++F +  +   H+S Q+ YITL+DA +HR +F+LP S Q  E
Sbjct: 1061 N-GAKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSE 1119

Query: 1141 LYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFGSTNTPN- 1199
            +Y +L+GSI PSSSLP L +P+LP T+D+I++D LG +  +L+    FR+PF    +P  
Sbjct: 1120 IYQDLFGSIAPSSSLPPLPIPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSPKL 1179

Query: 1200 -----QASTHHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLSS 1254
                  + T  +E++DPLEF   T    + +  DN VIDI Y S+ INP + +Y+++   
Sbjct: 1180 GNPFEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDNCRE 1239

Query: 1255 TVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLDK 1314
                ++IVQ++DDIEI  +  LS  QEG  +  NIKL++LY D++WG+R   GI LYLD+
Sbjct: 1240 HFCSQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDR 1299

Query: 1315 LDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCELW 1374
            +D EM Q+ +E++ E  + E+T L K RS+RA+I+E  S     ERPPALSLV+EG E+W
Sbjct: 1300 IDLEMCQKMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIW 1359

Query: 1375 SATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKL 1434
            S     QVN              Q++WLF ++++Q    Q I + L S+Q   + +R++L
Sbjct: 1360 SCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQL 1419

Query: 1435 ISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESG 1494
            +SKL  A+++YQISHDPYVITKPAFITRLS+GHVRENRSWKIITRLRHILTY+P DW   
Sbjct: 1420 VSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRV 1479

Query: 1495 VENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRI 1554
            ++    ++  +   +    F+SVFSNWRNWEFSD+ARSYIY  +F    ++K + SM   
Sbjct: 1480 IDEMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENS 1539

Query: 1555 IKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIGSVKG 1614
            IK+ L+S F T Y+ GY+++ NF+LT  N+V E  P  +++ + +EK+IN+TGS+G++KG
Sbjct: 1540 IKLKLASLFFTVYSTGYEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKG 1599

Query: 1615 NFSDEXXXXXXXXXXXNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKL 1674
              S +           + ++     +P        + FKLN LLLFE++E+Q V+G SK+
Sbjct: 1600 KTSHKLINLKKLLPELSMKKNLKPSTPFL------RCFKLNMLLLFERSELQFVLGASKV 1653

Query: 1675 TNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVES 1734
             +R+  GK+S+L + PK+  S A S+ +YA+RSE  + H N  L E+Q+R+FS+  T ES
Sbjct: 1654 MSRVFGGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAES 1713

Query: 1735 WSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQL-SISDRLAEGENKSP 1793
            WS KPTVLV+ QC   H ++M  T  L  SV E+++ +K ++K   S SD   +  ++ P
Sbjct: 1714 WSYKPTVLVNLQCTDIHFRAMTATDVLAKSVGEIIENIKELEKLFYSDSDSGIQQISQYP 1773

Query: 1794 KKKLKDVEIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFL 1853
              + K + + + C  +NV+ EIMP+SPF  RH  K+ D+ F + GS ++++ VWDTD FL
Sbjct: 1774 VMEQK-INMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFL 1832

Query: 1854 RSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERT 1913
             S LTK++YFR SFG+ Q+  N++E     ++ +VSAS++KLT  +  R++ SFLQDE+ 
Sbjct: 1833 ISHLTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKI 1892

Query: 1914 ASESXXXXXXXXXXXXXQTEGRLQPATTKEMR---WLLDTDIKYFGILVPISTTYFVFET 1970
              ES             +      P+T K  R   W L+++I YFG+LVPIS+TYF+ E 
Sbjct: 1893 LIESLEQFSSLKLFQRKKP----APSTEKSGRTVTWSLESNINYFGLLVPISSTYFILEL 1948

Query: 1971 HALVLSMSDID--TEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQK 2028
            H L++S++ I   + KY   +    Q SI+NV FL+K++ +P+ LS++LDFSI  ST+QK
Sbjct: 1949 HMLLMSLNKIQGISSKY---NGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQK 2005

Query: 2029 MMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIXXXXXXXX 2088
            +     SFQ+ES HFR+ LSP SL  ++W G Q L    YYKE      W+         
Sbjct: 2006 LKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSV-AWE--KVINFKN 2062

Query: 2089 XXXXXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDA 2148
                  +  +  SFHVLSYNFC+GW+F     + PG+++G+SRLFSAYE  +GKLTL+DA
Sbjct: 2063 TNNSAEVQADFPSFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDA 2122

Query: 2149 FFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFL 2208
            +FSVA G TS TF+ +  E +  NRSYLPNMQI+YW+K  GL++DV++RFHGEALDV+FL
Sbjct: 2123 YFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFL 2182

Query: 2209 TTFITVIESMLQSFQVFQELKTSLIQPXX---XXXXXXXXPKIKSLAPFLSNIKSVNCQF 2265
             +FI VIES L+S Q FQELK  L+                 I  ++PF + I+S+NCQF
Sbjct: 2183 ASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQF 2242

Query: 2266 KYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLK-PHWIRALVAIGSTHN 2324
            +YDGGVFKVFS  +  +HL+PSFE+K+P VIID NYK+N    + P WIR L+ I STHN
Sbjct: 2243 QYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHN 2302

Query: 2325 TLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFKL 2384
            TLFA CAPLIAEF E I +MVK+HSS+   E   TN+SK   QNIDYKR+LD FD+A ++
Sbjct: 2303 TLFAKCAPLIAEFSEGIQKMVKRHSSD--REPSGTNISK---QNIDYKRMLDSFDVAVEV 2357

Query: 2385 TSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSK 2444
             S++Q LSL CEP+AKVQAD+GF SF   + TN+ D  EPL F+LS++KT+ASIKHIFS+
Sbjct: 2358 ISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSR 2417

Query: 2445 ETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIR 2504
            E STSFG+D IDL  MFTHP+ IN+ GTGLIS+V ++FNVKQLQNLYLF+DIWKLS+ + 
Sbjct: 2418 EASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLN 2477

Query: 2505 PGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSLKLKRT 2564
              P  +    + + K L+  Q  +    IPW FTLIF+NING  DLGP+LGVLSL  KRT
Sbjct: 2478 SKPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRT 2537

Query: 2565 WVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNV 2624
            W A+DHY+  R+V+ A+T  ++  SKGRLSGI ELDGASW+SEV+WP  +  ++YPLV++
Sbjct: 2538 WFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSI 2597

Query: 2625 SVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTAL 2684
            S+NID +  K AFDYHMFL+G I+     +HSEKDI G  PDLLKVN  CE I +CSTAL
Sbjct: 2598 SLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTAL 2657

Query: 2685 VAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNI 2744
            VAANILD+YNTVMR+RQDNKI Y+ETL+ES+T E R   D Y+DILRSLNL+QTDVS +I
Sbjct: 2658 VAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALD-YKDILRSLNLIQTDVSVDI 2716

Query: 2745 HVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKREID 2804
            + L +Q+SPI+LFD E+LV+NIENISAR+ T AG KLKT LE++VYD  VALSTSK E+D
Sbjct: 2717 YTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELD 2776

Query: 2805 EDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVK 2864
            ED ++ ISV DYM YA +ISGG IIE P+L IAMT++Q+E SDILEYLY C+F DKI+V+
Sbjct: 2777 EDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVR 2836

Query: 2865 WNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEEP 2924
            WNLGPVNFIKEMW THV+A+AVRRSQ  +     ++E+V KRIK+EE  S+ +YVP+EEP
Sbjct: 2837 WNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEP 2896

Query: 2925 RIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNS 2981
            RIDMPQIRDLGDATPPLEWFG+NRKR PAFTHQT V+ VQKLVH AEK+Y S+L +S
Sbjct: 2897 RIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILGHS 2953

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 2910 bits (7543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1447/3019 (47%), Positives = 2024/3019 (67%), Gaps = 84/3019 (2%)

Query: 3    SSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRAHI 62
            SS+ F+   +   +NFSW              + +FY+ RA AY  + ILEWLLWK+A +
Sbjct: 6    SSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKV 65

Query: 63   KVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLE-----S 117
            KV+I +LRISLL GR+FFKN+TII KD TI++L+G++TWRYWL++TRK  Y +      S
Sbjct: 66   KVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHAS 125

Query: 118  KDSNGVT-----------MKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERI 166
              S+G +           M+K  +LPCRF+  CEG E+F+YNRT++YDNI+N+ SK ER 
Sbjct: 126  AGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVERE 185

Query: 167  KFQKFLDEQIFNDHSSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDR 226
            KF+KF+ E  F         +   ++    E++S T   DE+ +             NDR
Sbjct: 186  KFEKFMAENDF-----LDPSSDGSSDDKIEETSSATNSTDEETIA------------NDR 228

Query: 227  IFDQAKSDKDSLFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLD 286
             F          +L+  P+E  +++ S+  GNKFTP ++I+S E    + D  +   KLD
Sbjct: 229  TFQNDTRKTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLD 288

Query: 287  LYKMKLAIETHNFAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQ 346
            LY+MK  +   N  + +K NI Y  E    F+ D+GKLSRLW RFT I  ++  P    +
Sbjct: 289  LYRMKYEVRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNR 348

Query: 347  RKKKRNEPPDLFIQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIF 406
            RK+   +P D F+QKW+GLS+Y+  +F    D+ DDI+FD  +HEYAKF+S++K P+   
Sbjct: 349  RKE---QPHDNFMQKWKGLSMYRNDMF-GEFDEFDDIEFDISSHEYAKFTSLLKSPRVTI 404

Query: 407  TYEYDIPGCVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIH 466
             ++YD+PG VPHGAHP +S  DGPDVGNN APP +  +I IFGG++CYGPW QRQ N + 
Sbjct: 405  HHDYDMPGWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQ 464

Query: 467  SMLAPAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKET 526
            S+L+P+VSRT  P+K+  PGS RIYT  KL+I+ M+D TWRI TRE SKD  FL HYKET
Sbjct: 465  SLLSPSVSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKET 524

Query: 527  NDDYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKF 586
            NDDYRPFGWID++ S++S   F  A+ PT++GFKN I++ L   EIRSSVNHDI +K K 
Sbjct: 525  NDDYRPFGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKS 584

Query: 587  FDFDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRP 646
            F F+ D+ YPL WN  A WTI M+SNQLE FLLREH+TLIADTLTDF+SGEP PYELFRP
Sbjct: 585  FSFNCDIGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRP 644

Query: 647  SETFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNE 706
                I W M  Y  YLNVNDHNIVNNPLDFNENCYLS+HGDDL +NV +P + IT++F  
Sbjct: 645  FVYHIKWNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTN 704

Query: 707  ITYNITTPMFRXXXXXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISII 766
            +TY+I TPMFR            EFM+ KEVGRS+DF  KGSYL+YSELD+DNVDT+++ 
Sbjct: 705  MTYDIYTPMFRLLLNTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVE 764

Query: 767  CESRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXX 826
            C SRGT L  YGFVIRYL NVKMNYFG+FF+F+TSEEYTG TR                 
Sbjct: 765  CSSRGTALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDF 824

Query: 827  DNGDVYSDGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYN 886
             + +  S   S   D  + +  ++ +LK+SDL+RT+NETD++ TFSVWDGA+ILPETIYN
Sbjct: 825  SSYESVSRISSNSSDK-NPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYN 883

Query: 887  CDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQ 946
             D C AL F ELI+DLRS NYYMD+LA+  D  ++RY  K   +I++ V  +N +  E  
Sbjct: 884  ADPCIALHFAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVH 943

Query: 947  GFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDL 1006
            G LSD+ IHGHRM+GLPP EPTYFC+WD D G LN++S   FL+G   +F +IGFG+KDL
Sbjct: 944  GTLSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDL 1003

Query: 1007 ENILLYSKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRL 1066
            ENILLY  E+I+DMTSLT+    I + L +  +     LK +   FT IDFE+  YS R+
Sbjct: 1004 ENILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRM 1063

Query: 1067 DLIIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFH 1126
            D+ IPSL+ +++    +     L NF   ++ T+F Q ++F +HR +QR+YI LNDA +H
Sbjct: 1064 DIKIPSLEFNIFS--NEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYH 1121

Query: 1127 RTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLD--- 1183
            R +FLLP+S+QK  +YNEL+G+I PSSSLP L +P+   T++++LED L +Y+ L +   
Sbjct: 1122 RCAFLLPESYQKSRIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLFEGNY 1181

Query: 1184 ---DRTIFRMPFGSTNTPNQASTHHEEDM--DPLEFSNSTVSTEKNYQCDNLVIDIEYIS 1238
               + ++  +   +       +    E    +P+  S+  V      + DN V+ +E I 
Sbjct: 1182 DIKESSVENLELSAIEATRAITGIGAERTHSNPITLSDYAV------ESDNYVVKVESIV 1235

Query: 1239 VEINPSISTYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDI 1298
            ++INP++ T IE L   +Y+++ VQ+ID IEI  +K LS+  +G +++TN+K+++ + ++
Sbjct: 1236 IDINPALYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNL 1295

Query: 1299 YWGERDRYGIELYLDKLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEK 1358
            +WGE++   + ++ DK+DF ++++ +E++ EK LLE+T+LAK +++R ++ ++      +
Sbjct: 1296 FWGEKESDNVSMFFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQ 1355

Query: 1359 ERPPALSLVVEGCELWSATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNIIT 1418
            ERPPA+++ VEG E WS   EKQVN              Q+EW F ++  Q     +++ 
Sbjct: 1356 ERPPAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQ 1415

Query: 1419 TLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIIT 1478
            + N +Q     S+++LIS+LTAA+++YQISHDPYVITKPAFI RLS+GHVREN+SWKIIT
Sbjct: 1416 SYNRIQNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIIT 1475

Query: 1479 RLRHILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRL 1538
            RLRHILTY+P DW   V   L+++  +   +A+ +FMS+FSNWR+WEFSDVARSYIYG+L
Sbjct: 1476 RLRHILTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKL 1535

Query: 1539 FLTNQAEKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEA--- 1595
            FL + AEK KQS++++ K+N+ +FF+T Y+  YD+D + V++NA ++ E TP  TE    
Sbjct: 1536 FLNDHAEKKKQSLQKLFKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKEN 1595

Query: 1596 GVSREKLINLTGSIGSVKGNFSDEXXXXXXXXXXXNKEQEKMERSPSFQVDNIPKSFKLN 1655
             + RE+LI+++G++  +KG  S +            +  EK    P    D IPK FK+N
Sbjct: 1596 SLQREELIDISGTVDVIKGKLSTKLLKLQKLIPILTEGSEKQPVKPP--QDTIPKPFKMN 1653

Query: 1656 ALLLFEKTEVQLVIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRN 1715
            A  +    ++QLV+  +KL   + +G++S+L ++ +++ + AGS++L++K +E ++ H N
Sbjct: 1654 AAFMVNSCDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHIN 1713

Query: 1716 TTLVENQVRDFSLSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNI 1775
            + L E +V +F  + T ++W+ +PT L+ ++ +  H ++MAKT  LV ++K++   +  I
Sbjct: 1714 SVLAEGRVSNFYATFTTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIKLKIDQI 1773

Query: 1776 DKQLSISDRLAEGEN-KSPKKKLKDVEIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKF 1834
             +QL +  RL +      P K      +   C  SNVS +IMP+SPF +++  K+ D  +
Sbjct: 1774 SEQLELERRLTQHPTVYDPNKS----NVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFY 1829

Query: 1835 KQFGSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIK 1894
             +F S + +I + DTDFFL SD TK+QY R+S    QI  N+   +  +VD N+S +++K
Sbjct: 1830 NKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVK 1889

Query: 1895 LTFSEPNRILSSFLQDERTASESXXXXXXXXXXXXXQTEGRLQPATTKEMR---WLLDTD 1951
            LTFSEP  I+ SFL+DER ASES               +    P + +E     W LD+ 
Sbjct: 1890 LTFSEPKNIVYSFLKDERVASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSS 1949

Query: 1952 IKYFGILVPISTTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPS 2011
            I YFGIL+P+++TY+V E H+ V S+S+ +       D T   +S+EN++FLIK+  +P 
Sbjct: 1950 IDYFGILIPMTSTYYVMEFHSYVSSISNANGAPSGNLDIT-GHMSVENILFLIKESSLPD 2008

Query: 2012 ALSRMLDFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKE 2071
             LS+++D +++ ST+Q++ +   S QVES+H RI LSP SL+RL+WG  Q   L+ +Y +
Sbjct: 2009 GLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLK 2068

Query: 2072 QRGTDLW------DIXXXXXXXXXXXXXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGI 2125
                 LW      D                  +++S H LSYN C+GW+F        G+
Sbjct: 2069 YHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGL 2128

Query: 2126 MLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWV 2185
            + G+SRLFSAYE   GKLT++D++F+ A+G TS+TFYP  +  E  NR YLPNMQI +W 
Sbjct: 2129 ITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWW 2188

Query: 2186 KKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQSFQVFQELKTSLI--QPXXXXXXXX 2243
            K    MKDV++RF GE LDV +L+ F+  IES L S ++FQ+LK  LI   P        
Sbjct: 2189 KVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIK 2248

Query: 2244 XXPKIKSLAPFLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKH 2303
                + S    L NIKSVNC FKYDGG + VF+  D   +  P+ E+K+P + +D  YKH
Sbjct: 2249 EDKPVNSSNNILKNIKSVNCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKH 2308

Query: 2304 NIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKH-ESIATNLS 2362
               + K H IR LV I  THN L+A CAPL+  F+E +  +  ++ S  KH E+  T++ 
Sbjct: 2309 EKQNTKHHSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSV- 2367

Query: 2363 KAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDET 2422
                QNIDY++LL+ +D+A  +TS++Q+LSLSCEPKAKVQADVGF++  + + TN  D  
Sbjct: 2368 ----QNIDYEKLLEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDID 2423

Query: 2423 EPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYF 2482
            EPL FS SIK TKASIKH+FS+ETSTSFG+  +DL  +FTH + IN YGT LIS++DLYF
Sbjct: 2424 EPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYF 2483

Query: 2483 NVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFT 2542
            NVKQLQNLYLF+DIW+LS  + P    +     R++K  ++ +P +   ++PW FTLIFT
Sbjct: 2484 NVKQLQNLYLFLDIWQLSELLNPVTSSQE-QVIRKDKKKSVDKPIHNESQLPWCFTLIFT 2542

Query: 2543 NINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGA 2602
            N+ G  DLGPSLG++SL+L RTW+A+DH+  KRQ++ AF D L  +S+GRLSG+  +DGA
Sbjct: 2543 NVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGA 2602

Query: 2603 SWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVG 2662
            SW+SEV W ++ +  N PLV +S+N D + +KAAFDYHMFLIGT++   F LHSE+D+VG
Sbjct: 2603 SWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVG 2662

Query: 2663 TMPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGN 2722
              PDLLKV+F+CE I +CSTALVAANILD+YNT++RMRQD KI Y+ETL++S+ +ET   
Sbjct: 2663 VAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSN-METNKQ 2721

Query: 2723 PDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLK 2782
               YRDIL+SL LL+TD++ +I  L+LQ+SPI+LFD+EV+VIN+ ++SAR+ T +  KL 
Sbjct: 2722 TLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDVEVVVINVVSVSARSETHSEAKLT 2781

Query: 2783 TILELEVYDGYVALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQ 2842
            T L +EVYD  ++LST+K+E+DED +S I+VADYM YASKI GGTIIE+P++ + MT+WQ
Sbjct: 2782 TSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQ 2841

Query: 2843 EENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEE 2902
            EE SDILEYLY C F DK+AV+WNLGPVNF+KEMWTTHVKA+AVRRSQ +  +   ++++
Sbjct: 2842 EEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKD 2901

Query: 2903 VQKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVP 2962
            V+KRIKEEENI+KL YVP+EEP+IDMPQI+DLGDATPP+EWFGVNRKR PAFTHQT VVP
Sbjct: 2902 VEKRIKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVP 2961

Query: 2963 VQKLVHAAEKQYASLLDNS 2981
            VQ LV+ A+KQYA  L  S
Sbjct: 2962 VQNLVYLAQKQYAKTLGRS 2980

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 2767 bits (7172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1402/3006 (46%), Positives = 1978/3006 (65%), Gaps = 98/3006 (3%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            M   S+F+ V +S  +NFSW              +VIFY+GR  AY  +L+LEW LWK  
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120
             +K+++ESLRI+ L G I F+N+ II KD TIS+L+G+L WRY LL TR+  Y   S   
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 121  NG-------VTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLD 173
            +G       V   KN  LPCRFVL CEG EIF+YNRT +Y+NII +FS+EER++F+KF+ 
Sbjct: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 174  EQ----IFNDHSSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQN-NDRIF 228
            +Q    +F+ HS  S                    +D+   +S  SS  +   N NDR+F
Sbjct: 181  KQEMSELFHCHSERS--------------------DDKGSTDSVLSSSVSDVPNINDRVF 220

Query: 229  DQAKSDKDSLFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLY 288
            D+  + K S+F++  P+E+++ R S+  GNKFTPSL+I S   G G++D CQPKEKLDLY
Sbjct: 221  DEVHNQKKSIFMRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLY 280

Query: 289  KMKLAIETHNFAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRK 348
            KM   ++  +  ++++ NI Y  +   K     GKLSR+W  F  +  I   P       
Sbjct: 281  KMHFQVDFIDIDISIRQNIEYNRK---KATFKNGKLSRMWATFVKVLHI---PFYNKSHN 334

Query: 349  KKRNEPPDLFIQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTY 408
             K  E  + F+ KW+GL LYKG  F+   +D D++ FDF NHEYAK S+++K P+ + TY
Sbjct: 335  NKGTES-EPFMTKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTY 393

Query: 409  EYDIPGCVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSM 468
             YDIPG VPHGAHPT   ++GP+VGNNGAPP   +D+Q +G +ICYGPW QR++  +  M
Sbjct: 394  SYDIPGVVPHGAHPT---LEGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRM 450

Query: 469  LAPAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETND 528
            ++P V+R+  P+K   PGS RIYT  K +  ++D ++WRI TRE SKD  FLK +K T++
Sbjct: 451  ISPTVARSSVPIKTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSE 510

Query: 529  DYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFD 588
            +YRPFGW+DL+F+ +SY   T  L P  EGF N + IH A+ E  SSVNHD+++KC  FD
Sbjct: 511  EYRPFGWLDLKFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFD 570

Query: 589  FDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSE 648
               DV YPL WN  ATWTI+++S QLETFLLREH+TL+AD  TDF+SGEPTPYELFRP  
Sbjct: 571  VAGDVGYPLGWNSSATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFI 630

Query: 649  TFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEIT 708
              INW +D Y IYLNVNDHNIVNNPLDFNENCYLSLHG++LLI+VT P++ IT  + ++ 
Sbjct: 631  YQINWIIDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVP 690

Query: 709  YNITTPMFRXXXXXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICE 768
            Y I+TPMFR            EFMK KEVGRSY F+  G Y +YSELD+DNVDT+S+ C 
Sbjct: 691  YKISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECT 750

Query: 769  SRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDN 828
            S GTTL CYGFV+RYL NVKMNYFGDFF+FITSEEYTG+ R                 DN
Sbjct: 751  STGTTLHCYGFVMRYLMNVKMNYFGDFFHFITSEEYTGVIR-AKEKESVGKTEEESLRDN 809

Query: 829  GDVYSDGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCD 888
                S    G+ D   + +     + RSD++RT NETD++ TFSVW+GA++LPETIYNCD
Sbjct: 810  STNLSTDSGGLSDPYVR-LRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCD 868

Query: 889  NCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGF 948
             C AL FGELI+DLRS NYYMDLLA++  T ++RY  +   ++F+S+  DN  + +  G 
Sbjct: 869  PCVALHFGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGS 928

Query: 949  LSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLEN 1008
            L+ L+IHGHRM+GLPP EPTYFC+W  D+  L +NS+ +F KGF T F+ IGFG+ +LEN
Sbjct: 929  LAALTIHGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLEN 988

Query: 1009 ILLYSKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDL 1068
             LLY  E  +DMTS+TV  ++++V ++N+ S     +   ++ FTSIDFE+  YS R+DL
Sbjct: 989  TLLYDVETPDDMTSVTVRVRDMNVVVENDSS--RAVVDVPNLTFTSIDFENERYSQRIDL 1046

Query: 1069 IIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRT 1128
             +PSL + +   + D +  RL + TTKV+LTDF QK++F +HRS QR+YITLND+ F+R 
Sbjct: 1047 KVPSLSILLLTSEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRC 1106

Query: 1129 SFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIF 1188
            SFLLP   Q+  LY  L GSI PSSSLP L +P+L +T+DFI+ED LGE+ + L      
Sbjct: 1107 SFLLPCYLQESPLYKSLLGSISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDT 1166

Query: 1189 RMPFGSTNTPNQA---STHHE--EDMDPLEFSN--STVSTEKNYQCDNLVIDIEYISVEI 1241
            +      ++P+++   S  HE  +D+    F+     +S     Q DN++ID+++++V++
Sbjct: 1167 QRTVDDPDSPSESFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDL 1226

Query: 1242 NPSISTYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWG 1301
            +P I +Y++ L    ++ N V +ID+IE+  +K L      T  + N+KL V+  + +WG
Sbjct: 1227 DPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQLWNNT-CVLNLKLYVVDINFFWG 1285

Query: 1302 ERDRYGIELYLDKLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERP 1361
            +++   ++LY DKLDF++ QR  + D E  + E   L+K RS+RA++ +   T+  +ERP
Sbjct: 1286 DKNAKVVDLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERP 1345

Query: 1362 PALSLVVEGCELWSATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNIITTLN 1421
            PALSL VEG E +S   EK V               QLEWL +++ EQ   ++N++T+  
Sbjct: 1346 PALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFT 1405

Query: 1422 SVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLR 1481
             +      +RR L+  +T A++ YQISH+PYVITKPAFI RLS GHVREN SW+IITRLR
Sbjct: 1406 KLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLR 1465

Query: 1482 HILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLT 1541
            HILTY+P++W +   + ++     D  +A     SV S+WR WE SD+ RSYIY  +FL+
Sbjct: 1466 HILTYLPNEWRNN--SAIQVSPTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLS 1518

Query: 1542 NQAEKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSR-- 1599
            +Q++   QS+++++KV+  SFF T Y+ GY +  NFV+T ANIV E+ P    + V +  
Sbjct: 1519 DQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQAL 1578

Query: 1600 --EKLINLTGSIGSVKGNFSDEXXXXXXXXXXXNKEQEKMERSPSFQVDNIPKSFKLNAL 1657
              + ++NLT S+G++KG  +D+                K  ++      NI KS+K+N L
Sbjct: 1579 DYDNVMNLTVSLGAIKGELNDQLLKLRNIFSKAQTPALKRSKTSI----NISKSYKVNVL 1634

Query: 1658 LLFEKTEVQLVIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTT 1717
            L F+++E+Q V+G+++LTNRILNGK +LLL+  K + +PA S + +AKRSE+ + H +  
Sbjct: 1635 LAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLV 1694

Query: 1718 LVENQVRDFSLSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDK 1777
            L E   R+ SL+ T E WS  P++ ++ QC++ HI++M  T  LVNS+K++++++  + +
Sbjct: 1695 LAEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISELKR 1754

Query: 1778 QLSISDRLAEGENKSPKKKLKDVEIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQF 1837
              ++       +  S    +      +    S+V+ E+MP++PF +RHE K+  L   + 
Sbjct: 1755 HFAMEKTTPNVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRV 1814

Query: 1838 GSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTF 1897
             S  ++I +WD +  L+S  T +QYF  + GD Q+  NL      I++  +S S++KLT 
Sbjct: 1815 QSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTL 1874

Query: 1898 SEPNRILSSFLQDERTASESXXXXXXXXXXXXXQTEGRLQPATTKEMRWLLDTDIKYFGI 1957
            SEP RILSSFLQDE+   ES                 + Q +    +RW LD ++ YFGI
Sbjct: 1875 SEPRRILSSFLQDEKLIGESLGYIKGLLQLFSPLARNKTQSSA---LRWSLDANLNYFGI 1931

Query: 1958 LVPISTTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRML 2017
            LVP+++T+FVFE H L+ +M++    +         QVSIEN + LIK+  +P+ LS++L
Sbjct: 1932 LVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLL 1991

Query: 2018 DFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDL 2077
            DFSI   + QK+     S+Q+ES+HFR+ LSP SLV+++WG  Q   L  Y+++ R  D 
Sbjct: 1992 DFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQD- 2050

Query: 2078 WDIXXXXXXXXXXXXXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYE 2137
                               ++  S H+LSYN CIGWMF   +    G+++GF RLFSAYE
Sbjct: 2051 -KAISPFSLFDGSASADRQIDFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYE 2109

Query: 2138 GGYGKLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIR 2197
              YGKLTL+D +FSVA G ++ TFY + SE +  NRS+L N+QI YW+K+   MKD+FIR
Sbjct: 2110 KHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIR 2169

Query: 2198 FHGEALDVSFLTTFITVIESMLQSFQVFQELKTSLIQPXXXXXXXXXXPKIKS--LAPFL 2255
             +GEAL+VS L+    +IES L S Q FQ LK   +             +  S  ++PFL
Sbjct: 2170 VNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHKRDSGPRNKLNLENTSNNISPFL 2229

Query: 2256 SNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRA 2315
            S+I++++CQFKY GGV K++S +D+     PS E+K+PGV+I   Y HN    +PH IR 
Sbjct: 2230 SHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRC 2289

Query: 2316 LVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSN-TKHESIATNLSKAPSQNIDYKRL 2374
            LV+I  THN L++ C P++ + +E    MV+KHS + T  ES         SQ+IDYK L
Sbjct: 2290 LVSIDPTHNILYSQCVPILNDIVEASQRMVQKHSPDETPLES---------SQSIDYKSL 2340

Query: 2375 LDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKT 2434
            LD FDIAFK+TS  Q+LSLSCEP+AKVQADVGFDSF  G+ TN+L +  P   SLS++K 
Sbjct: 2341 LDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKI 2400

Query: 2435 KASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFI 2494
            ++S++HIFS+ETS SF +D +D   +FTHPD+   +G  L+S+++++FN+KQLQNL LF+
Sbjct: 2401 QSSVRHIFSRETSASFSVDFVDFTSIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFL 2457

Query: 2495 DIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSL 2554
            DIW+L+  +    + K ++ K++ K +TL + ++    I WSFTLIFTN+ G  DLGPSL
Sbjct: 2458 DIWQLNGKLNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSL 2517

Query: 2555 GVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEK 2614
            GVLSL+L RTW A+DHY  +R+V+ AF D LS  S+GRLSG+F+L  A+W+SEV++P   
Sbjct: 2518 GVLSLRLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAG 2577

Query: 2615 RTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTC 2674
                   +++S+++  +++K AFDYHMFLIGTI   KF L SE D+ G +PDLL V  +C
Sbjct: 2578 SIKGSSEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSC 2637

Query: 2675 EMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLN 2734
            + ++ C+TAL AANILD+YNT+ RMRQDN+I Y+ETLRES++ E R     Y DIL+SLN
Sbjct: 2638 KEMDFCATALTAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTL-LYDDILQSLN 2696

Query: 2735 LLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYV 2794
            LL+TD+S +I   K Q+SPI+LFD+EVLV+NI+N+SAR+ T +GEKLKT L L+V +  V
Sbjct: 2697 LLRTDLSFDITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKV 2756

Query: 2795 ALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYK 2854
            +LSTSK E+DE+ V+ IS+ DYM YASKISGGTI++VP+L ++MT+WQ+  SD++EYL+ 
Sbjct: 2757 SLSTSKEELDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFT 2816

Query: 2855 CTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQN---VLDTDMQTDEEVQKRIKEEE 2911
            C F D++AVKWNLGP+NFIKEMW+TH+K+LAVR++Q+   + + D Q D + ++ IK   
Sbjct: 2817 CRFFDRVAVKWNLGPINFIKEMWSTHIKSLAVRQTQSNKTMSEKDKQADLDPEEEIK--- 2873

Query: 2912 NISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAE 2971
              +KL+YVP++EP I+MPQI+DLGDATPP+EWFGV+RKRLPA THQ  +V +QKLVHAAE
Sbjct: 2874 --AKLQYVPLDEPYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAE 2931

Query: 2972 KQYASL 2977
            K+YA +
Sbjct: 2932 KEYAKV 2937

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2531 bits (6560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1328/3043 (43%), Positives = 1927/3043 (63%), Gaps = 107/3043 (3%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            M   S FQ V +   +NFSW              +VIFY+GR   ++ + ILEW++WKR 
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHL----- 115
             +K+NIESLRI+ LGG I F+N+ IIH+DYTIS L+GT+ WRYWL  +RK  Y       
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNE 120

Query: 116  ESKDSNGVTMKKN--EQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLD 173
            E +  NG   K N   + PCRF+L CEG EIFVYN+T SY+NII++FSKEER +F+KF+D
Sbjct: 121  EERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180

Query: 174  EQ----IFNDHSSYSSKTTNGANSST-----GESNSDTKLNDEDFVESGYS---SQSTYN 221
            +Q    +FN+    +   +    SS      G ++ +   +  +  ++G +    Q+  N
Sbjct: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAPNN 240

Query: 222  QNNDRIFDQAKSDKDSLFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQP 281
              ND +F+Q  S++ S++++  P++I   R SL  GN+FTPS++++S+++  GIID C P
Sbjct: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300

Query: 282  KEKLDLYKMKLAIETHNFAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRP 341
            KEKLDL+K+KL  E ++   +VK NIG+ +++   FK  RG+LS+LW++F  I  + T  
Sbjct: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLPT-- 358

Query: 342  LGLTQRKKKRNEPPDLFIQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKC 401
            LG    K  + +    F + W+GLSLY+  + E   D+L+++ FDF NHEYA+  S++K 
Sbjct: 359  LG---PKHLQTQEDITFRENWKGLSLYRQNMEE---DELENVDFDFANHEYARVISILKS 412

Query: 402  PKAIFTYEYDIPGCVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQ 461
             K +FTYEYDIPG VP     T   + GP+VGN+GAPP   +DIQ++G +ICYGPW +RQ
Sbjct: 413  AKIVFTYEYDIPGLVPKEPEET---LQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQ 469

Query: 462  MNFIHSMLAPAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLK 521
            ++++ ++L+P VSRT  P+K   PGS RIYT  K SISIM+++TWRI TRE SKD  FL+
Sbjct: 470  LSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLR 529

Query: 522  HYKETNDDYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDIL 581
            HY ET +++RPFGWIDL+F K+SY      + PT EG  N++N H +  EIR+SVNH++L
Sbjct: 530  HYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELL 589

Query: 582  MKCKFFDFDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPY 641
            ++ K FDF+ D+ YPL WND+A W I+++S QLE F+LREHITLI+D   DF+SG+PTPY
Sbjct: 590  LRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPY 649

Query: 642  ELFRPSETFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDIT 701
            ELFRP    INW +D Y IYLNVNDHNIVNNPLDFNENCYLSLHGD L+ +V IP + + 
Sbjct: 650  ELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVA 709

Query: 702  AQFNEITYNITTPMFRXXXXXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVD 761
             +  EITY+I+TPMFR            EFMK KEVGRSY+F   G Y ++SELD+DNVD
Sbjct: 710  NRCTEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVD 769

Query: 762  TISIICESRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTGI--TRXXXXXXXXXX 819
            TIS+ C S GTTL CYGFV+RYL NVKMNYFGDF +F+T+EEYT    T           
Sbjct: 770  TISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDE 829

Query: 820  XXXXXXXDNGDVYSDGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAII 879
                      DV +D  +      ++ IP     KRS+L+RT NE D++  FSVW+GA+I
Sbjct: 830  HSGFNISSTEDVETDRTNPEGRPANKGIP---MPKRSELKRTENEMDIWFVFSVWEGALI 886

Query: 880  LPETIYNCDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDN 939
            LPETIYN D C AL F EL +DLRS+NYYMDLLA++ +T ++RY  + P D+F+ V  DN
Sbjct: 887  LPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDN 946

Query: 940  RESSEAQGFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRI 999
                ++ G+LS L+IHGHRM+GLPP EPTYFC+W  DI  L +NS+ +F KGFLT FS+I
Sbjct: 947  GRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKI 1006

Query: 1000 GFGFKDLENILLYSKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFES 1059
            GFGFK+LENILLY    + DMTS+TV  +E+   + +  +     L  + + FT+IDFE+
Sbjct: 1007 GFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFEN 1066

Query: 1060 ANYSSRLDLIIPSLKMSMYGLDIDGKKAR-LFNFTTKVHLTDFAQKKNFKRHRSMQRNYI 1118
              YS R+D   P +   ++ LD + K+ R L +  T+++ TDF Q + F  HR  QR YI
Sbjct: 1067 EAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYI 1126

Query: 1119 TLNDAAFHRTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEY 1178
            TL+D+A++R SFLLP  FQ+  LY EL GSI PS++LP L LP+L +T+D+I+ED LGEY
Sbjct: 1127 TLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLGEY 1186

Query: 1179 VSLLDDRTIF--------RMPFGSTNTPNQASTHHEEDMDPLEFSNSTVSTEKNYQCDNL 1230
               +              R P  + +T  QA++       P    N+        + +N 
Sbjct: 1187 APTVKPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHNPPNN------RDRYNNY 1240

Query: 1231 VIDIEYISVEINPSISTYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIK 1290
            V+D+EY+++E+ PS++  + +     Y E+   +ID  EI  +K L   Q G S +T  +
Sbjct: 1241 VLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTSR 1300

Query: 1291 LRVLYSDIYWGERDRYGIELYLDKLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISE 1350
            L V      +   +  G+EL L+  DF++ ++ IE + EK +LE TM +   ++R S+  
Sbjct: 1301 LHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLL- 1359

Query: 1351 EGSTKNEKERPPALSLVVEGCELWSATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQN 1410
            E    +   +P AL L +E  ELWS+T ++ VN              QLE +  ++  Q 
Sbjct: 1360 EAHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQI 1419

Query: 1411 QNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRE 1470
            + L++ IT+   ++     +++ LI  LT+A+++YQISHDPYVITKPAFI RLS+GHVRE
Sbjct: 1420 KVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRE 1479

Query: 1471 NRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQ--DEAKKVFMSVFSNWRNWEFSD 1528
            NRSW+IITRLRHILTY+P+DW +       + S N       + +F+SVFSNWRNW+ SD
Sbjct: 1480 NRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSD 1539

Query: 1529 VARSYIYGRLFLTNQAEKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQ 1588
            + RSYIY ++FL    +  K+ +R ++K+N  SFF T   +GY++ ++ + T  NI+ + 
Sbjct: 1540 ITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVDV 1599

Query: 1589 TPP----FTEAGVSREKLINLTGSIGSVKGNFSDEXXXXXXXXXXXNKEQ-------EKM 1637
             PP     +E    +EK+I LT ++G++KG + +E           ++ +         +
Sbjct: 1600 LPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGSI 1659

Query: 1638 ERSPSF-----QVDNIPKS-----------FKLNALLLFEKTEVQLVIGESKLTNRILNG 1681
             RS S      Q+D +  S            K+ A ++FE+ ++  V+G+++LTNRI+NG
Sbjct: 1660 SRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIING 1719

Query: 1682 KVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKPTV 1741
            K S+LL++ KE   PA S + +A+R E  + H    L E  ++   ++AT +     P V
Sbjct: 1720 KNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQ-LGVIPFV 1778

Query: 1742 LVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKSPKKKLKDVE 1801
             ++ Q  +  I++M  T  L NSV+++ + V+ +  Q   S  +      + K     ++
Sbjct: 1779 SLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFK-SHEVKNSSAVTKKTPRIPIK 1837

Query: 1802 IEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQ 1861
             ++    +++S EIM +SPFY+  + K+  +      +  +++   + D +L+S L+ +Q
Sbjct: 1838 FDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQ 1897

Query: 1862 YFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASESXXXX 1921
            +F+ S  D Q    + +    +V+  +S S++KLT  EP R L + LQDE+T  ES    
Sbjct: 1898 FFKFSSTDLQFKCEVADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHI 1957

Query: 1922 XXXXXXXXXQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFETHALVLSMSDID 1981
                      + G    + ++  RW LD ++KYFG+LVP+S+  ++FE H+L  S+++ +
Sbjct: 1958 QKLWNFLRSASGGN-DRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNAN 2016

Query: 1982 TEKYTEKDETQS-QVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQVES 2040
             E+Y E D   S Q+ +E+   L+K+  +P+ LS++LDFSI F T QK+     S+Q+ES
Sbjct: 2017 -EQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIES 2075

Query: 2041 NHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIXXXXXXXXXXXXXXIGMNMS 2100
            ++FR+ L P  LV ++W       L N++K+     L                   ++  
Sbjct: 2076 SYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTPWL-----PYSSNKTAKSGESTLDFR 2130

Query: 2101 SFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSAT 2160
            S H+LSYNFC+GW+F   + S PG++LG+ RLFSAYE  +GKLTL+D + SVA G TS T
Sbjct: 2131 SIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDT 2190

Query: 2161 FYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQ 2220
            FY ++SE +S  R+YL NMQI YW+K   L+KD+F+RFHGE +DV FL+T   ++E  L 
Sbjct: 2191 FYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLH 2250

Query: 2221 SFQVFQELKTSLIQPXXXXXXXXXXPKIKS--LAPFLSNIKSVNCQFKYDGGVFKVFSFE 2278
            S + F E+K + I+            +  S  LAPFL++I+++N Q  + GGVFKV+S  
Sbjct: 2251 SIKRFNEMKKAKIKQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPT 2310

Query: 2279 DIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFL 2338
            +++S  EP  E+K+PGV +  NY+ N    K H IR    I  THN LFA CAPL+++F 
Sbjct: 2311 ELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFN 2370

Query: 2339 EHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPK 2398
             +I  M++  SS  K     ++ SK  + +IDYK LL+ +DIAF++ S +QKLS SCEPK
Sbjct: 2371 HNIKNMIRNLSSEDK-----SHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPK 2425

Query: 2399 AKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLN 2458
            AKVQ D GF+SF+  + T+ +D  EP   S S+ K ++S++HIFS+++S +F LD ID+ 
Sbjct: 2426 AKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIV 2485

Query: 2459 FMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKREN 2518
             MFT+P   N+YG  L+S++++Y N+KQ QNL +F+DIW+LS+  R  P       K + 
Sbjct: 2486 MMFTYP---NVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDA 2542

Query: 2519 KHLTLPQPSNLYGE----IPWSFTLIFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDK 2574
            K    P  S    +     PWSFT+IFTN+ G  DLGPSLGVL+L L++ W+ + H  D+
Sbjct: 2543 KKSLSPPFSPSSNDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQ 2602

Query: 2575 RQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLK 2634
            ++    F   ++  S+GRLSG+FELD AS +SE+SWP+E      PL++VS+ I+ +S+K
Sbjct: 2603 KRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIK 2662

Query: 2635 AAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAANILDLYN 2694
            +AFDYHMFLIG++ + K  LH+E D    +PDLL+V+   E I +C+TAL AAN LD+YN
Sbjct: 2663 SAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALDIYN 2722

Query: 2695 TVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPI 2754
            T+MRM+QDN+I Y+ETL+ES+ +        Y ++L SLNLL+TD+S  +  LK+ +SP+
Sbjct: 2723 TIMRMQQDNRISYIETLKESN-ISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPM 2781

Query: 2755 ALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKREIDEDTVSAISVA 2814
            +LFD EVLV+++ +++AR+ T +GEKLKT L+L++ D   +LS+SK E+DE+TVS I+V 
Sbjct: 2782 SLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAVD 2841

Query: 2815 DYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIK 2874
            DYM YASK SGGTII++P+L ++MT+WQ+++S +LEYL+ C F DKI++KWNLGPVNFIK
Sbjct: 2842 DYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIK 2901

Query: 2875 EMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEEPRIDMPQIRDL 2934
            EMW THV++LAVRR+Q  L       E   +  KE+   SK  YVP++EP I+MPQI+DL
Sbjct: 2902 EMWATHVRSLAVRRTQ--LGNSSPELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDL 2959

Query: 2935 GDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASL 2977
            GDATPPLEWFGV+RK LPA THQT V+ +QKLVH AEK+YA L
Sbjct: 2960 GDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2531 bits (6560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1295/3036 (42%), Positives = 1897/3036 (62%), Gaps = 96/3036 (3%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            M   S+F S+ +   K FSW              +VIFY+ R    I + IL W +WK+ 
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLE---- 116
             +K+NIES+R+S LGG +F KN++II++D+T+S L+  + WRYWLL +R+  Y ++    
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120

Query: 117  ------SKDSNGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQK 170
                  S  SN +T++KN +LPC  ++ C+G E+FVYNR  +Y+N++ LF+KEER KF  
Sbjct: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180

Query: 171  FLDEQIFNDHSSYSSKTTNGANSSTGESNSDTKLN--DEDFVESGYSSQSTYNQN-NDRI 227
            FL+E    D  S                  DT +N  D+D+ ES  +  S+ +   NDR 
Sbjct: 181  FLNEHDLGDIVS-----------------EDTNVNSMDKDYFESVTTENSSESTVINDRT 223

Query: 228  FDQAKSDKDSLFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDL 287
            + + K ++ S+     P+++ +   ++  GN+FTPSLV+ S E+  G++D     EK+DL
Sbjct: 224  YKKNKDERKSILFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDL 283

Query: 288  YKMKLAIETHNFAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLT-- 345
            YK K+ ++  +  ++VKPN+ Y  E   +  ID+GKLSR+W  F  I  +I  P      
Sbjct: 284  YKSKVTMKFQDVNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYH 343

Query: 346  -QRKKKRNEPPDLFIQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKA 404
               KKK ++   +F+ KW+GLSLYK  + +     LD+  +DFLN EYAKFSS++KCP  
Sbjct: 344  KHMKKKEHDVESMFVNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNF 403

Query: 405  IFTYEYDIPGCVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNF 464
              +Y  D PG VPHGAH TN + DGPD+GN+G+PP   +D+Q+   SI YGPWT RQ+++
Sbjct: 404  TLSYYLDSPGIVPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSY 463

Query: 465  IHSMLAPAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYK 524
            +  ML+P VS+ + P+K+  PGS RI+T  K+S+ I+D+++WRI TREPSKD  F+K + 
Sbjct: 464  LIRMLSPVVSKNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFV 523

Query: 525  ETNDDYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKC 584
            +TNDD+RPFGW+D   +K + A F F+L+PT +G  N+ +IH    E+ +SVNHDIL+K 
Sbjct: 524  KTNDDFRPFGWLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKS 583

Query: 585  KFFDFDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELF 644
            K FD   D+ YPL WN +A W  D+ + QLETFLL+EHI+L +D  +DF S +PTPYELF
Sbjct: 584  KEFDVVADIGYPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELF 643

Query: 645  RPSETFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQF 704
            RP    +NW ++ Y IYLNVND NIVNNPLDFNENCYLSLHGD+L I+  IP+  I+  +
Sbjct: 644  RPFTYSLNWDIEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPY 703

Query: 705  NEITYNITTPMFRXXXXXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTIS 764
             EI +NI TPMFR            EFMK KEVGR++DF  +GSYL+YS+LD+DNVDTI+
Sbjct: 704  TEIAFNIYTPMFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTIT 763

Query: 765  IICESRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXX 824
            + C SR TTL CYG VIRYL NV+ NYFGDF +FITSEEY+ I +               
Sbjct: 764  MECTSRSTTLFCYGVVIRYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFTY 823

Query: 825  XXDNGDVYSDGESGMDDAI---SQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILP 881
               +    S   S  DD +    ++   +  ++R+D+ RT NE D++ TF VWDGA+ILP
Sbjct: 824  STTS----SVQNSSSDDTVLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILP 879

Query: 882  ETIYNCDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRE 941
            E +YN + C++L F EL+I  R SNYYMD L +L D  + R+   SP +IF+ V   +  
Sbjct: 880  EGLYNGNLCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHN 939

Query: 942  SSEAQGFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGF 1001
             +   G LSD++IH HRMFGLPPN+ TYFC+W  D G L ++S  +FL  F   F+++GF
Sbjct: 940  LNIVHGTLSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGF 999

Query: 1002 GFKDLENILLYSKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESAN 1061
            G+ +LEN L+Y  E  +DMT LT+  +++ + + ++VS    +L+   +   SIDF++  
Sbjct: 1000 GYSNLENKLVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNER 1059

Query: 1062 YSSRLDLIIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLN 1121
            YS R++L IP   +S++ +     K  L  F TK+  T+F  K++F+   + QR YITL+
Sbjct: 1060 YSKRINLKIPEFSISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLH 1119

Query: 1122 DAAFHRTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSL 1181
            D+ +HR  F+LP  +Q+  LYNELYG I PS S+P+L +P+LP T+DF++EDFL EY  L
Sbjct: 1120 DSPYHRCFFILPTMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDL 1179

Query: 1182 LDD-----RTIFRMPFGSTNTPNQASTHHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEY 1236
            L++     R+I  +   S     +  T+  E         +TV+ +  Y+ DN ++++EY
Sbjct: 1180 LENPFLNIRSINNLDTSSLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEY 1239

Query: 1237 ISVEINPSISTYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYS 1296
            I V+INP  S +I+S+S+ +Y EN+V +ID+IE+  ++ L + ++     TN+KL++ Y 
Sbjct: 1240 IRVDINPLFSDFIDSMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYV 1299

Query: 1297 DIYWGERDRYGIELYLDKLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKN 1356
            DI+WG R+  GIE+YLDKLDFEM QR  +   ++ L E T+L+K +S+R S SE    + 
Sbjct: 1300 DIFWGSRNSEGIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEI 1359

Query: 1357 EKERPPALSLVVEGCELWSATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNI 1416
            E ERPPALSL VEG E+WS T   Q N              Q  WL  ++N+Q +   N+
Sbjct: 1360 EYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNL 1419

Query: 1417 ITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKI 1476
              +++ +Q      ++ LISKLT A+++YQI HDPYVITKPA I RLS  HVRENRSW+I
Sbjct: 1420 KGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRI 1479

Query: 1477 ITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYG 1536
            +TRLRHIL Y+P  WE     +++ + +    + K VF+SVFSNWRNWE SDVARSYIY 
Sbjct: 1480 VTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYR 1539

Query: 1537 RLFLTNQAEKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQT----PPF 1592
            R+FL    +  K  +    K+ + SF+ T Y+  Y +D N V+T  N++ +Q      P 
Sbjct: 1540 RVFL---PDIEKNLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPK 1596

Query: 1593 TEAGVSREKLINLTGSIGSVKGNFSDEXXXXXXXXXXXNKEQEKMERSPSFQVDNIPKSF 1652
                   +K+ ++TG++G+ KG   D+           +K + + E+S  F   +IPK F
Sbjct: 1597 AATANKNDKIYDITGTVGTFKGELGDQ-LIRLKKLYSEDKAKIRSEKSTDF---SIPKFF 1652

Query: 1653 KLNALLLFEKTEVQLVIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLIT 1712
            K+N +L+ EK E+ L    +KL +RI NGK+S   ++ ++  + +GSI+ YA R+E  + 
Sbjct: 1653 KINIVLIVEKGELTLAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLK 1712

Query: 1713 HRNTTLVENQVRDFSLSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTV 1772
            H    L++  + D  +S   E    KPT+LV+ + +H   K++  T  LV  ++E  + +
Sbjct: 1713 HNELILLDAHLDDLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREI 1772

Query: 1773 KNIDKQLSISDRLAEGENKSPKKKLKDVEIEVVCQLSNVSFEIMPISPFYIRHETKKFDL 1832
              I  +L+  D      + SP    K ++I     + ++S EI+ +SPF ++H  K+  +
Sbjct: 1773 SKITGRLTDKDNKKRHTSTSPIFSTKKIDISFDINIFDISSEIVILSPFTVKHSMKELKI 1832

Query: 1833 KFKQFGSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASM 1892
             F + G  + +  + D D +L S     QYFR+S+ D  +   L + +  ++  N+  S+
Sbjct: 1833 VFNREGDNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSL 1892

Query: 1893 IKLTFSEPNRILSSFLQDERTASESXXXXXXXXXXXXXQTEGRLQPATTKEMRWLLDTDI 1952
            IKLT ++P +I +S LQDE+T  +S               E R   A     +++++ D+
Sbjct: 1893 IKLTLADPKKITNSLLQDEKTFEQSLESIKTLNTLFSSNREVRTS-AVDNPYKFMVNFDL 1951

Query: 1953 KYFGILVPISTTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSA 2012
             YFG+L P+ T+YF+ E H+L+ + S++       K++    ++++N +F+IK   + + 
Sbjct: 1952 TYFGLLFPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQ 2011

Query: 2013 LSRMLDFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQ 2072
            +S++LDFS++ ST  K++    SF+VES+HFR+ L+P SL++++ G  Q      YYKE 
Sbjct: 2012 VSKVLDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEH 2071

Query: 2073 RGTDLWDIXXXXXXXXXXXXXXIGMNM--SSFHVLSYNFCIGWMFPEANASAPGIMLGFS 2130
                   I              IG  +   S H LSYNFCIGW+F  + +S PG+++G+ 
Sbjct: 2072 TRL---QIFKTKKKASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYD 2128

Query: 2131 RLFSAYEGGYGKLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGL 2190
            RLFSAYE  YGKLT+VD FFS+A G +S TFY + +E E  NRSYLPN+QI YW+K+   
Sbjct: 2129 RLFSAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDA 2188

Query: 2191 MKDVFIRFHGEALDVSFLTTFITVIESMLQSFQVFQELKTSLIQPXXXXXXXXXXPKIKS 2250
            MK +F+RF+GE +DV FL+ F T+I   ++S Q FQ +K   ++               S
Sbjct: 2189 MKQLFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAEKKVGEDDIS 2248

Query: 2251 --LAPFLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSL 2308
               + F S ++ +NCQ  YDGGVF V+         E + E+ TP VIID +YK+ I   
Sbjct: 2249 TKFSLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMK 2308

Query: 2309 KPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQN 2368
            KPHWIR+ + I  T+NTL +  A  + EF E +HEMV K S   +  +      K  S  
Sbjct: 2309 KPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPA-----PKTVSPP 2363

Query: 2369 IDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFS 2428
            IDYKR+L+ FD++F +++ +QK+SLSCEP AKV A+VGF+SF+  I+TN+ D TEPL+ S
Sbjct: 2364 IDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCS 2423

Query: 2429 LSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQ 2488
            L++   K SI H FS E + SF +D +D+  +FTHPDI   YGT LIS+V LYFN+KQLQ
Sbjct: 2424 LTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFNIKQLQ 2480

Query: 2489 NLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSA 2548
            NL +F+DIW L   I+  P+      K E++  +  + S+    IPWSFT+I T+ING  
Sbjct: 2481 NLMVFLDIWNLKRLIKLRPQKSVPVKKPESRVSSSTKSSSNTTIIPWSFTVIITDINGDI 2540

Query: 2549 DLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEV 2608
             LGPSLG LSLKLK+ W++++H+QD+R+ +R FTD LS  S GRL G+ ++   SW+  V
Sbjct: 2541 HLGPSLGNLSLKLKKNWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNV 2600

Query: 2609 SWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLL 2668
             + + ++    PLV++++N++N+++KAAFDYHMFLIG +    F+L SEKD++G +PDLL
Sbjct: 2601 RYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLL 2660

Query: 2669 KVNFTCEMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRD 2728
            K++  C+ I+ICSTALVA+NILD+ NT+ R RQD++  Y+ETL ES+    + +  +Y D
Sbjct: 2661 KLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSI-SYTD 2719

Query: 2729 ILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELE 2788
            IL+SLNLL+TDV   IH +++Q+SPI+LFD+EV+V  +EN+SAR+ T +GEKL T L+++
Sbjct: 2720 ILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMK 2779

Query: 2789 VYDGYVALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDI 2848
            +Y   ++LS S  E+DE+ VS ISV DYM YA K+SGG I+ +PKL + MT+WQ ENS I
Sbjct: 2780 IYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKI 2839

Query: 2849 LEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQ---------- 2898
            +EYL+ C F DKI+V+WNLGPVNFIKE+W THVK+LAVRR+Q   D + Q          
Sbjct: 2840 IEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGEPS 2899

Query: 2899 ---TDEEVQKRIKEEENI----------SKLKYVPIEEPRIDMPQIRDLGDATPPLEWFG 2945
               + EE++    E  N            K  YVP++EP+I+MP+I+DL DATPPLEWFG
Sbjct: 2900 PLVSSEELEMLRSESSNADNDNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDATPPLEWFG 2959

Query: 2946 VNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNS 2981
            VNRK+ P  THQT ++ +QK+VH A+K+YA +L +S
Sbjct: 2960 VNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLGDS 2995

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 2227 bits (5771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1146/2604 (44%), Positives = 1633/2604 (62%), Gaps = 59/2604 (2%)

Query: 419  GAHPTNSEIDGPDVGNN--------------GAPPTHSLDIQIFGGSICYGPWTQRQMNF 464
            GA P     +  D  NN               APP  +++ Q+F  SI YGPW  R +  
Sbjct: 561  GASPDTDRNNESDASNNQQRNTYSRSTTDNISAPPESNMEFQLFDASINYGPWAHRNIMN 620

Query: 465  IHSMLAPAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYK 524
            I  + +P VSRT        PG  R YT TK+S+SIM+D++WR+ TREPSKD  FLK Y 
Sbjct: 621  IQRIFSPIVSRTPELQPDPEPGFLRRYTMTKISVSIMEDSSWRVPTREPSKDQDFLKRYM 680

Query: 525  ETNDDYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKC 584
            +TND  R FGW DL FS+ S A F  + +P   G+ N +N+     E+RSSVNHDI  + 
Sbjct: 681  KTNDSSRSFGWFDLNFSRNSEATFCISSIPDVNGYANKLNLDFKDLEVRSSVNHDIFFRS 740

Query: 585  KFFDFDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELF 644
            K +  D D+ YPL WND  TW+   +S QLETF LREH+ LIADT +DF+SGEPTPYE F
Sbjct: 741  KSYRVDSDIGYPLGWNDEVTWSFVFDSYQLETFFLREHLVLIADTFSDFSSGEPTPYEFF 800

Query: 645  RPSETFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQF 704
            RPS   ++W    Y  YLNVNDHNI+NNPLDFNENCY+S+HGDD  I V IP   ITA +
Sbjct: 801  RPSIYKVDWNFHGYSAYLNVNDHNIINNPLDFNENCYISVHGDDAHIGVEIPRLGITATY 860

Query: 705  NEITYNITTPMFRXXXXXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTIS 764
             +I + I+TPMFR            EFM+ KE+GR YDF+A+GSY++YS+LD+DNVD+++
Sbjct: 861  TDIIFQISTPMFRLLLNTPPWNTLNEFMRNKEIGRGYDFTAEGSYIIYSDLDIDNVDSLT 920

Query: 765  IICESRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXX 824
            I C +R  TL  YGFVI YL NV+MNYFG+F +FIT+EEYT I R               
Sbjct: 921  IECSTRRMTLLTYGFVIGYLLNVQMNYFGEFSHFITAEEYTDIVRGNDNDIVSTLADFSV 980

Query: 825  XXDNGDV--YSDGESGMDDAISQEIPE---RTTLKRSDLRRTANETDLFLTFSVWDGAII 879
              +   V   S+ +   D++    I +      L++ D++R  NETD++ TFSVW+GA++
Sbjct: 981  MSETNSVSNVSNSQHNPDNSSKSNIIDPLYNPPLRKDDIKRKVNETDIWFTFSVWEGALL 1040

Query: 880  LPETIYNCDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDN 939
            LPE +YN D C AL F ELIID R+ +YY+DLLA+L  T  +R   K+  DIF+ V ++ 
Sbjct: 1041 LPEVLYNSDPCIALSFKELIIDFRNCDYYLDLLATLNGTSFKRCIRKNQNDIFELVHNNA 1100

Query: 940  RESSEAQGFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRI 999
             ++ E  G +S++SIHGHRM+G PP  P+YF  W  D+  L++NS+  F++GF++  +++
Sbjct: 1101 IKNLEEHGSVSNISIHGHRMYGAPPTSPSYFSDWAVDVNNLSINSDIYFIRGFISYITKV 1160

Query: 1000 GFGFKDLENILLYSKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFES 1059
            GF F +L+NILLY + V+++MTS+TV+   I + + ++ +   + L    + F  I+F +
Sbjct: 1161 GFEFSNLQNILLYDESVLDNMTSVTVHGTGIDILVADKSTSAQVLLNMDGITFNRINFAN 1220

Query: 1060 ANYSSRLDLIIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYIT 1119
              YSSR+DL +P L  + +       K  LF F TK++ T+F Q K+ + H   Q+ +I 
Sbjct: 1221 DRYSSRIDLQVPGLHFAFFDNGSSMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQEFIA 1280

Query: 1120 LNDAAFHRTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEY- 1178
            LND+AFHR SFLL    Q+  LY+ELYG I PSSS+P L +P+  +T+ FI++DFLG + 
Sbjct: 1281 LNDSAFHRCSFLLLPHIQESLLYHELYGGITPSSSVPPLPIPVQAETIAFIIDDFLGPFG 1340

Query: 1179 ---VSLLDDRTIFRMPFGSTNTPNQASTHHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIE 1235
                 LL   +    P  S+N P +  +     + P+E   S +   ++    N +IDI 
Sbjct: 1341 INSTELLGSIST-STPIHSSNKPLKPPS--SSVIHPIESMQSHLVPSQSVTHGNYIIDIS 1397

Query: 1236 YISVEINPSISTYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLY 1295
            YI+++INP   TY  +     Y ENI++ ID IE+  +  L T  E   S+TNIKL++ Y
Sbjct: 1398 YITLDINPLFFTYASNFLDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKY 1457

Query: 1296 SDIYWGERDRYGIELYLDKLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTK 1355
             D ++G+R+  G+ELY+D++D E+SQ+  +K     L EI +L++  S+RASI+E+   +
Sbjct: 1458 LDFFFGQRNTEGLELYVDQIDLEVSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLE 1517

Query: 1356 NEKERPPALSLVVEGCELWSATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQN 1415
            +  ERPPALSL +EG E WS+TA  QVN              Q+EWL  ++N     +  
Sbjct: 1518 DFDERPPALSLALEGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHE 1577

Query: 1416 IITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWK 1475
            ++ +L+S+Q +    ++KL+S LT A+++YQISHDPYVITKPA++ R+SKGHVR+NRSW+
Sbjct: 1578 LVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWR 1637

Query: 1476 IITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIY 1535
            I+TRLRHI TY+P DWE  V+  ++ K +ND  ++  +F++VFSNWRNWE SDVARSYIY
Sbjct: 1638 IVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIY 1697

Query: 1536 GRLFLTNQAEKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEA 1595
             ++FL+N     ++ ++  +K+NL+S F T Y+ GY ID N +LT A I+ E T   TE 
Sbjct: 1698 KKIFLSNDETTSEKKLQTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELT---TET 1754

Query: 1596 GVS---REKLINLTGSIGSVKGNFSDEXXXXXXXXXXXNKEQE--KMERSPSFQVDNIPK 1650
             VS    + ++N+TGS+GS+KG FSD+           +KE++   +  + S   +  P 
Sbjct: 1755 AVSPPIEKSILNMTGSLGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPY 1814

Query: 1651 SFKLNALLLFEKTEVQLVIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETL 1710
             F ++  LLFE   +QL +G++ L+N + +GK+S LL+    +   + S   Y K+SE  
Sbjct: 1815 -FTIHLFLLFENGGLQLTMGDTTLSNNVTDGKISALLEKSSYSKEFSYSGAYYMKKSEMC 1873

Query: 1711 ITHRNTTLVENQVRDFSLSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQ 1770
            + H    + E Q+    L +T       P +L++ + A  H KS+A T  +V +++++ +
Sbjct: 1874 LKHNKDIIAEFQLHHLGLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITE 1933

Query: 1771 TVKNIDKQLSISDRLAEGENKSPKKKLKDVEIEVVCQLSNVSFEIMPISPFYIRHETKKF 1830
               ++ K   +     +      K +  + ++ V C LS VS E+  ISPFY+R+ETK+ 
Sbjct: 1934 YSVHLYKHYDLRKYTTKPTKVDQKPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQL 1993

Query: 1831 DLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSA 1890
            DL F Q G   +++ +WDTD F+ S  TK+QYFR S+ D QI  N +  +  ++  ++SA
Sbjct: 1994 DLYFNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSA 2053

Query: 1891 SMIKLTFSEPNRILSSFLQDERTASESXXXXXXXXXXXXXQTEG--RLQPATTKE---MR 1945
            S++KLTFSEP RI +SFLQDER   ES               +   +L     KE    +
Sbjct: 2054 SLVKLTFSEPRRIFASFLQDERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTK 2113

Query: 1946 WLLDTDIKYFGILVPISTTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIK 2005
            W L+ +I YFGIL+PI++T+FV E H L+ S+++   E     ++   Q+S+EN++FLI 
Sbjct: 2114 WALELNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLIN 2173

Query: 2006 DRGIPSALSRMLDFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGL 2065
            DR +P  LS+++DFSI  ST+QK      S Q+ES+HFR+  SP SLV ++WG +Q    
Sbjct: 2174 DRSLPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNE 2233

Query: 2066 ANYYKEQRGTDLWDIXXXXXXXXXXXXXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGI 2125
              YYK+ +    W++                    S H+LSYNFCIGWM PE     PG 
Sbjct: 2234 LEYYKDHKTKRQWNLSSHKTGTKSSTSESPLNYFRSIHILSYNFCIGWMLPENQKDIPGW 2293

Query: 2126 MLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWV 2185
            M G+ RLFSAYE  YGKLTL++ + SV    +S  F+ +  E    NRS+LP+MQI YW+
Sbjct: 2294 MFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWL 2353

Query: 2186 KKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQSFQVFQELKTSLIQPXXXXXXXXXX 2245
            K+    KD+FIR HG+ALDV  L+ F+ +IE + +S+Q+F++ + S I            
Sbjct: 2354 KEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKI--VQNIEKQKHH 2411

Query: 2246 PKIKS------LAPFLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDF 2299
              IKS      +  FLS+I S+NC+FKY+GG  +VFS +D+E    PS EL  P V I  
Sbjct: 2412 EHIKSENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYL 2471

Query: 2300 NYKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIAT 2359
            NYKH   S KPHW+R ++ I S+HN L++ CAP + EF+E I E+++      K      
Sbjct: 2472 NYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQ----- 2526

Query: 2360 NLSKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNL 2419
            ++SK  + N  YKR+L  FDIAF++ +++Q LS SCEP AKVQA+VG DSF+ GI T   
Sbjct: 2527 SVSKIATPNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGS 2586

Query: 2420 DETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVD 2479
               +PL+ +L I K   S++HIFSKE S SF L+ IDL F+FT P    +Y  GLIS++D
Sbjct: 2587 SVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQP---TLYCVGLISDID 2643

Query: 2480 LYFNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTL 2539
            ++FN+KQ QNL LF+DIW LS  I   P  K    K+   H  +P+       IPW+F +
Sbjct: 2644 IFFNMKQQQNLLLFLDIWHLSESIGIRPNRKKRKHKKHKGHTQIPETPQPGKIIPWNFNI 2703

Query: 2540 IFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFEL 2599
            IFTN+N    LGP+LG++S KL++TW  SD Y DKRQ+++ FTD +   S+GRLSG+ ++
Sbjct: 2704 IFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDI 2763

Query: 2600 DGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKD 2659
              A W  EV++   +  +N P+V + ++I  ++LK AFDYHMF+I  ++   F LHSE+D
Sbjct: 2764 SNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERD 2823

Query: 2660 IVGTMPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLET 2719
              G +PDLL     CE I+ICST LVA+NILD+YNT++R RQD K  Y ETL ES+  +T
Sbjct: 2824 PEGKLPDLLLTTLLCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDT 2883

Query: 2720 RGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGE 2779
            R N   Y DIL+SLNLL+TDV  ++  L+LQ+SPI+LFD EVLVINI+N+SAR+ T + +
Sbjct: 2884 RTNIP-YSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTD 2942

Query: 2780 KLKTILELEVYDGYVALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMT 2839
            KLKT LEL+V +  VALST+K E+DE++V+ ISVADYM YASKI GGTI+ +PKL + MT
Sbjct: 2943 KLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMT 3002

Query: 2840 SWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVR--RSQNVLDTDM 2897
            +WQ+  S+ +EY + C F+ K++V+WNLGPVNFIKEMW THVK+LAVR  R +  ++   
Sbjct: 3003 TWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARIEEPVEYSS 3062

Query: 2898 QTDEEVQKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQ 2957
            +  E   + I  E    K  YV + EP I+MPQI+DL DATPP+EWFG+NRK+ P+FTHQ
Sbjct: 3063 EELESSPESIYLEPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQ 3122

Query: 2958 TVVVPVQKLVHAAEKQYASLLDNS 2981
            T V+ VQKLVHA EK+YA ++ +S
Sbjct: 3123 TAVIVVQKLVHAVEKEYAKIIGHS 3146

 Score =  159 bits (403), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 79/180 (43%), Positives = 114/180 (63%), Gaps = 5/180 (2%)

Query: 1   MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
           M    +F SV +S  K FSW               + FY+ R  AY  + IL+WLLW+  
Sbjct: 1   MVDEPKFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPY 60

Query: 61  HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSY--HLESK 118
            +K++ ES+R+SLL  RI FKN+ II ++ TIS+L+G + W+YWLL TR  +Y  H + K
Sbjct: 61  KVKIHCESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQK 120

Query: 119 DSNGVTMK---KNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQ 175
           +   +T     KN QLPC+F+  CEGAEIFVYN+T +Y+NII+ FS +E+IK+++FL + 
Sbjct: 121 EHGYITPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 2196 bits (5689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1189/3081 (38%), Positives = 1790/3081 (58%), Gaps = 146/3081 (4%)

Query: 5    SEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRAHIKV 64
            +EF +V +S  + FSW              + +FYV +   +  +   EWLLWK  +IKV
Sbjct: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65

Query: 65   NIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESK----DS 120
             IES+R+S L G IFFKNV +I +D TIS+L+ ++TWRYWLL TRK  Y L +K      
Sbjct: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125

Query: 121  NGVTM------------------------------------------------KKNEQLP 132
            NG  M                                                 KN++L 
Sbjct: 126  NGDDMLDNNTIHDRSNNDNNDNNDNNDNNDNNNNNDNNDNNETNNYNDIDYDYNKNKKLD 185

Query: 133  CRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQ----IFNDHSS------ 182
              F ++C G EIF+YNR  +Y+ II  FSKEE+I+F  FL +     IF + SS      
Sbjct: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245

Query: 183  -YSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNN-DRIFDQAKSDKDSLFL 240
             Y +      ++  G S    K +  +   SG S ++  +++N D     +      L L
Sbjct: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAHIMRKLHL 305

Query: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300
               P++I +++ ++  GNKFT SL++I+     G++DY  P  KLD++K K+  E ++  
Sbjct: 306  DILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDID 365

Query: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360
            +++K NIGY  E+  +F    G L+R+W     +  +I      T  +  R +    F++
Sbjct: 366  MSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFVK 425

Query: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420
            KW GL LYK ++   T    DD+ FDF NHEYAK S+  K P+ IF+ E DIPG VPHG+
Sbjct: 426  KWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHGS 485

Query: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480
            HP  S+  GPD+GN+ +PPT  +D+Q+   SI +G W  R +  +  ++ P +S+ + P+
Sbjct: 486  HPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKPL 545

Query: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540
             +  PG TR+++    S+S++DD++ R+ TREPSKD+ FLK Y ET DD+R FGWIDL F
Sbjct: 546  NKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLSF 605

Query: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600
             K S       ++PT+ GF+N +    ++ E+ +SVNH++L K    +   ++ YPL WN
Sbjct: 606  KKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGWN 665

Query: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660
            D   W  ++NS QL+ FLLREHITL++D + DF++ EPTPYELFR     +N K+  Y  
Sbjct: 666  DPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYSF 725

Query: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRXXX 720
            Y NVND NI+NNPLDFNENCYLS HGD     +TIP   +  Q+  I+Y I TPMFR   
Sbjct: 726  YFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFL 785

Query: 721  XXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780
                     EFM+ KE+GRS+DF   G+YL+YSELD+DNVD+++I  ES  T L C+GFV
Sbjct: 786  NTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGFV 845

Query: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDNGDVYS-DGESGM 839
            I+Y+ N + NYFG F  FIT+EEY+ + R                 +  D+ S +G   M
Sbjct: 846  IKYMMNFQANYFGSFIKFITTEEYSELIR-------NNVNDNLGSINTNDLTSIEGLQKM 898

Query: 840  DDAISQEIPE--RTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGE 897
             D+I+ ++ +  + T+KRSDL RT NETD++L F V DGA+ILPE +YN D+C +L FGE
Sbjct: 899  -DSITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGE 957

Query: 898  LIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGH 957
            L I++R+ NYYMD+  +L D  + R+ +  P ++F+ +   NR SS  +G +SD++IHGH
Sbjct: 958  LFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNR-SSSVEGNISDITIHGH 1016

Query: 958  RMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVI 1017
            RM+GLPP E TYFC+W  +IG   ++S+  FL  F+ S ++IGF   + EN LLY  + +
Sbjct: 1017 RMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTV 1076

Query: 1018 NDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSM 1077
            NDMT L+V+ + + V L + +      +    +   +IDFE+  Y+ RLD+       S+
Sbjct: 1077 NDMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSL 1136

Query: 1078 YGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQ 1137
              L ID  K  + +  TK+++T+F +  N   H   QR +I L+D+ +HR  FLLP+ FQ
Sbjct: 1137 DSLKIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQ 1196

Query: 1138 KKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFGST-N 1196
            +   Y ELYGSI PS SLP+L +P +  T +FI+E  L +Y   L      +M   +  N
Sbjct: 1197 ESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELN 1256

Query: 1197 TPNQASTHHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIESLSSTV 1256
            + +        DM    F N  ++TE  Y+ DN V++++Y++V +NP I   IE  S+  
Sbjct: 1257 SVDTTPLKDSFDMQITNFQN-ILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEKFSTEF 1315

Query: 1257 YEE-NIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELYLDKL 1315
             ++ ++   ID IE+  +  LS  +E  SS  N+ L V   D  WG RD   I  Y++ L
Sbjct: 1316 NKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYINML 1375

Query: 1316 DFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCELWS 1375
             FE+SQ +   +      ++T+L K RS+R  I          +RPP LSL++EG E WS
Sbjct: 1376 KFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAWS 1435

Query: 1376 ATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLI 1435
            +T  KQ+               Q+ WL  +V  Q      I  ++  +  E    ++  I
Sbjct: 1436 STTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFI 1495

Query: 1436 SKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGV 1495
            + L  A + YQI HDPYVITKPA + RLS  H+RENRSW+I+T+LRHILTY+P DWE  +
Sbjct: 1496 TSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYLPEDWEDRL 1555

Query: 1496 --ENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRR 1553
              E+ +K   L  + EA   F++VFSNWRNWE SD+ +SYIY  +F+    E  K+ ++ 
Sbjct: 1556 DEEDLIKRSGL--EKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---EEVSKRILQN 1610

Query: 1554 IIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVF-EQTPPFTEAGVSR--EKLINLTGSIG 1610
             IKV L +F+ T Y+  Y  DQNF++T ANI+   +     E  + R  E+++++   IG
Sbjct: 1611 SIKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIG 1670

Query: 1611 SVKGNFSDEXXXXXXXXXXXNKEQEKMERSPSFQVD--------NIPKSFKLNALLLFEK 1662
            S+K  F++             K +  +E+     VD        +I K FK+N   +F+ 
Sbjct: 1671 SIKFEFTEAIL----------KLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDH 1720

Query: 1663 TEVQLVIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQ 1722
             +       S L +R+ N  +    ++  E+ +P+GS + YA R+   + H N  L++ Q
Sbjct: 1721 IDFNGQFYNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQ 1780

Query: 1723 VRDFSLSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSIS 1782
            VR+   S T E  S+  +++++ +C++ H KS+ KT   VN++K + + V+ +  ++S +
Sbjct: 1781 VRNLFASTTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKA 1840

Query: 1783 DRLAEGEN--KSP----KKKLKDVE------IEVVCQLSNVSFEIMPISPFYIRHETKKF 1830
                +  N   +P    K K++  +      I +    +NVS EI  + P Y++HET   
Sbjct: 1841 QGTTDNINTEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSV 1900

Query: 1831 DLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSA 1890
            ++ +       +++ V DTD +L S  TK+QY R+S+   ++T  L +    ++D  +S+
Sbjct: 1901 NISYNTINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISS 1960

Query: 1891 SMIKLTFSEPNRILSSFLQDERTASESXXXXXXXXXXXXXQTEGRLQPATTKEMRWLLDT 1950
            S++KLT S+P R+L SFLQDE+    S             +              W+++ 
Sbjct: 1961 SILKLTTSDPRRMLFSFLQDEKELKNS-LTFLRSLESLNRKANSEDSETLFSSYEWIVNF 2019

Query: 1951 DIKYFGILVPISTTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIP 2010
              KY G+L+PI  TY+VFE H  + ++S+ +        +    +S ++++FLIKD+ IP
Sbjct: 2020 KSKYMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIP 2079

Query: 2011 SALSRMLDFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYK 2070
               S++LDFSI  ST + +   D SF++ES+ FR+ L+P+SL++ +WG  Q L L N Y 
Sbjct: 2080 HKFSKILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSYY 2139

Query: 2071 EQRGTDLWDIXXXXXXXXXXXXXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFS 2130
            +Q   + +                   ++ SFH+LSYNF IGW++ +++ + PG++LG++
Sbjct: 2140 DQSTVNFFVFNDNNIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYN 2199

Query: 2131 RLFSAYEGGYGKLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGL 2190
            RLFS YE  +GKLTLVD FFS+A G++  TFY    E    NRSYLPN+QI YW+K+   
Sbjct: 2200 RLFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEK 2259

Query: 2191 MKDVFIRFHGEALDVSFLTTFITVIESMLQSFQVFQELKTSLIQPXXXXXXXXXXPKIKS 2250
            MK +FI+FHGE LDV+F   F+ +IES ++S  +FQ LK   I P              +
Sbjct: 2260 MKHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSA 2319

Query: 2251 L----APFLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIG 2306
            L     P    +K VNC+F YDGG+F++FS   + + LEP+  +K+P V I  +Y +   
Sbjct: 2320 LTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEK 2379

Query: 2307 SLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPS 2366
             LK HWI  L+ I  T N L + C P +++F+  I ++V+    N + E++  N+ K P 
Sbjct: 2380 ELKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNME-ENMDNNV-KDP- 2436

Query: 2367 QNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLT 2426
              I+   LL+ FDI FKL S  Q ++L CEPKAK+  DVGF SF   I+T +L+  +PL 
Sbjct: 2437 --INITSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLD 2494

Query: 2427 FSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQ 2486
             SL I   K S+KH FS E S SF +  +D+  +FTHP++   +GTGL+ +V L+FN+KQ
Sbjct: 2495 ISLKINDIKTSVKHQFSNEASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFNLKQ 2551

Query: 2487 LQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNING 2546
             QN+ +F+DIW +S         K +N   + K   + Q       +PWSF  I TNING
Sbjct: 2552 FQNISIFLDIWDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNING 2611

Query: 2547 SADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMS 2606
              ++G +LG L+L L+RTW+++DH+ +KRQ++  FTD +   S+GRL G  E+D  +W  
Sbjct: 2612 DINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKL 2671

Query: 2607 EVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPD 2666
            +V++  + +    PLV++  ++  +S+K AFDYHMFLI T+   KF + SEKDI   +PD
Sbjct: 2672 DVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPD 2731

Query: 2667 LLKVNFTCEMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNY 2726
            LL VN TC+ I +C+TALVA+NILD+YNT+MR RQDNK  Y+ETL ES+    +  P  Y
Sbjct: 2732 LLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKP-LY 2790

Query: 2727 RDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILE 2786
             DIL+SLNLLQT +S NIH L LQ+SP +L+D EV++I ++++ +   T  GEK+KT LE
Sbjct: 2791 EDILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLE 2850

Query: 2787 LEVYDGYVALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENS 2846
            + VY+  ++L++  +E+ E+ ++ +S   Y+ YAS ++ G I E+P+L I MT++Q  ++
Sbjct: 2851 MRVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADN 2910

Query: 2847 DILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNV------LDTDMQTD 2900
             IL+Y Y C+F+ K+ V WNLGP+NFIKE+W THV++L VR  Q +      L+ +  TD
Sbjct: 2911 MILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISLENEGDTD 2970

Query: 2901 EEVQKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVV 2960
            E V+        +S ++Y+ +EEP I+MPQI+DL DATPPLEWFG+NRK  P+ THQ+V+
Sbjct: 2971 ESVKV-------LSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVI 3023

Query: 2961 VPVQKLVHAAEKQYASLLDNS 2981
            VP+QKLV+ A+K+YA +L +S
Sbjct: 3024 VPIQKLVNVAQKEYAKVLGSS 3044

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2118 bits (5489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1187/3066 (38%), Positives = 1769/3066 (57%), Gaps = 156/3066 (5%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            M + S+F+++PIS   NFSW              SV+FY GRA+AY  +++++W+LW+R 
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120
             +K+NI+SL+IS LGGR+FFKN+T+I KD TIS LQG+ TWRYWLL +RK    LE  + 
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTL--LEELEK 118

Query: 121  NGVTM-KKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFND 179
            +G    +K+  L CRF L  +G E+F+YNRT +YD I+   +K+++  F+KF +    + 
Sbjct: 119  SGEEKDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFFEGGEDSL 178

Query: 180  HSSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLF 239
            HSS                  + KL DE    +  SS S  +  NDR F +   D  S+ 
Sbjct: 179  HSS------------------EEKLEDETL--ASDSSVSNVDSTNDRNFQE--QDSRSML 216

Query: 240  LQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNF 299
            LQ  P+ ++V+R ++  GN  TPS++II  E   G++D CQ  EKLDLYK++  ++ +N 
Sbjct: 217  LQFLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNV 276

Query: 300  AVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPIT-GIITRPLGLTQRKKKRNEPPDLF 358
             + +KPNI + +E  +K  I   ++SR+WK+F  I    ++  L  +  +K        F
Sbjct: 277  DLKIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQF 336

Query: 359  IQKWQGLSLYKGTIFEPTTDD----------LDDIQFDFLNHEYAKFSSVVKCPKAIFTY 408
             +KW+GL+LY  + +  TT D           +++  D  NHEYAK++ ++K  K   TY
Sbjct: 337  FEKWRGLALY--SEYNVTTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTY 394

Query: 409  EYDIPGCVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSM 468
             YDIPG VPHGA  T  + DGPDVGN+GAPP  SLD +++G +ICYGPW  RQ+ ++  M
Sbjct: 395  AYDIPGMVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRM 454

Query: 469  LAPAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETND 528
            L P VSR   P+K+  PGS RIYT   LS+ +M+D  WRI TRE SKD  FLK Y+E+ +
Sbjct: 455  LCPIVSRDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKN 514

Query: 529  DYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFD 588
              RPFGW+D++ +KE+  + T  + PT  GF+N +  HL + EIRSSVNHDI  K     
Sbjct: 515  KERPFGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQT 574

Query: 589  FDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSE 648
               D+ YPL WN  A W    NS Q+ TF LR+HI L++D   DF SG PTPYELFRP  
Sbjct: 575  ISADLGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFV 634

Query: 649  TFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEIT 708
                W +D Y IYLNVND NI+NNPLDFNENCYLSLHGD L I+ ++  + IT     + 
Sbjct: 635  YRFEWSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVN 694

Query: 709  YNITTPMFRXXXXXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICE 768
            Y+I TP F             EFMK KEVGRSYDF   GSY  +S++DV N+DTI I C+
Sbjct: 695  YSIRTPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQ 754

Query: 769  SRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTG------ITRXXXXXXXXXXXXX 822
            S+ TTLQC GFVIRYL N+ MNYFGDF +F T+EEYT        TR             
Sbjct: 755  SKYTTLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDES 814

Query: 823  XXXXDNGDVYSDGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPE 882
                    V +D E+   D    E  E   +KR+DL+R  NE D++ TF V DG ++ PE
Sbjct: 815  SQMSSTSFVTNDKETTEYDL--HEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPE 872

Query: 883  TIYNCDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRES 942
             IY+C +C  L F  L +DLR  NYYMDL ASL  T ++R+++ +P +IF  V       
Sbjct: 873  NIYDCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLV 932

Query: 943  SEAQGFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFG 1002
               QGFLS+L+IH HRMFGLP  E TYFCKWDF IG L+++S+ DF KG + +FS+IGFG
Sbjct: 933  DGHQGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFG 992

Query: 1003 FKDLENILLYSKEVIN--DMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESA 1060
            +KD EN+L+Y  E+I   DMTSLT+    IS  + +  +   +AL    ++ + IDFE+ 
Sbjct: 993  YKDYENMLIY--EIIKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENE 1050

Query: 1061 NYSSRLDLIIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITL 1120
             YS+++   IP++K+ +       +   LF   T + L  F Q ++F  HR++QRN+ITL
Sbjct: 1051 RYSNKMSAKIPNIKLLVSEKSSKNEVQGLFE--TSLDLAYFGQNRDFDNHRNLQRNHITL 1108

Query: 1121 NDAAFHRTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEY-- 1178
            +D+ +HR +FLLP  +QK  LYN+L+G+I P  S+P L  P++P T+D I E  LG++  
Sbjct: 1109 HDSPYHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQ 1168

Query: 1179 -------------VSLLDDRTIFRMPFGSTNTPNQASTHHEEDMDPLEFSNSTVSTEKNY 1225
                          ++ ++ + F    GST+   + S++ +        +  +   E  +
Sbjct: 1169 DYECCSDANYSKETAITEENSSFIQGSGSTSALKELSSYSQ--------NCPSYKLEPKF 1220

Query: 1226 QCDNLVIDIEYISVEINPSISTYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSS 1285
            + D+ +I++    + INPS    + S+       +I  +ID  EI+ ++  S +    S+
Sbjct: 1221 EYDSFIINLGKTIIAINPSSEKCLLSIYLQFCVGSIDDIIDANEIDIVEKFSKYFVEKSA 1280

Query: 1286 ITNIKLRVLYSDI---YWGERDRYGIELY------LDKLDFEMSQRNIEKDREKGLL--- 1333
            +TN  LRVL   I   +   + ++ +  Y      ++    ++ Q+ I        L   
Sbjct: 1281 VTN--LRVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYT 1338

Query: 1334 -EITMLAKTRSIRASISEEG-STKNEKERPPALSLVVEGCELWSATAEKQVNXXXXXXXX 1391
             E+T   K  SI   I+++    K   +  P  S+V E  E WS ++E   N        
Sbjct: 1339 EEVTSSLKASSINFFINQQQLKPKTLLKARPVFSIVFEELEFWSDSSESSKNSLNARAVD 1398

Query: 1392 XXXXXXQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDP 1451
                  QLEWL  ++         +  + +  +      +++LI +   A+  Y I HD 
Sbjct: 1399 FFVNHSQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDS 1458

Query: 1452 YVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAK 1511
             VITKPA+ITRLSK H+RENRSW+IITRLRHIL Y+P  W    E  LK++     D+A+
Sbjct: 1459 PVITKPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDAR 1518

Query: 1512 KVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSMRRIIKVNLS--SFFLTSYTA 1569
              F+ +FSNWR+WEFSDV + YIY R+FL+   +K++ +     KVNL   SF L+S T 
Sbjct: 1519 DQFLKIFSNWRSWEFSDVQKCYIYKRVFLSRSMKKNRITGAD-FKVNLERISFSLSSSTH 1577

Query: 1570 GYDIDQNFVLTN------ANIVFEQT-PPF---TEAGVSREKLINLTGSIGSVKGNFSDE 1619
                D++F++        +N + E + PP    TE   S EK+I ++ +I S++G+  D 
Sbjct: 1578 E---DEDFMVVKNLKSVISNELIESSLPPSAKNTEDSASTEKMI-ISCNIKSIRGDLGDN 1633

Query: 1620 XXXXXXXXXXXNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKLTNRIL 1679
                       +   +   ++ S + D  PK   +  +LL ++T+  + +   +L  R  
Sbjct: 1634 IVKLVRMYDGLSNLSDTNLKTTSVKHDVKPK--LIQGVLLVDRTDTNIHLDGKRLILRSF 1691

Query: 1680 NGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKP 1739
              + S  ++          S+      SE  + H +  L+E+ ++D +L+ +   +    
Sbjct: 1692 RNRFSTFMERVPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHL 1751

Query: 1740 TVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKSPKKKLKD 1799
               V  +     + +MA T   ++ +  +  +V  I K+L+ +         S  K    
Sbjct: 1752 ITKVVLRSGGLSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETS 1811

Query: 1800 VEIEVV---CQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSD 1856
              +  V     LS  S  I P++PF I   T   ++  ++    N  I + D D  L S 
Sbjct: 1812 SRLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLST 1871

Query: 1857 LTKQQYFRISFGDFQITYNLI-----EGEFIIVDANVSASMIKLTFSEPNRILSSFLQDE 1911
             +KQ+Y + S    Q T NL+     E   + ++  V++ + KLT S+P   + S ++DE
Sbjct: 1872 RSKQRYLKFS----QSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDE 1927

Query: 1912 RTASESXXXXXXXXXXXXXQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFETH 1971
              A ++             + + + +      + WLL  +++Y GI+V + +  +V E +
Sbjct: 1928 TLAIKNFAQLKSLAEKFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELN 1987

Query: 1972 ALVLSMS-DIDTEKYTEKD--ETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQK 2028
             ++ S+S +I   KY E+         SIENV+ LI    +   LS+++D +++    Q+
Sbjct: 1988 NVLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQE 2047

Query: 2029 MMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYK------EQRGTDLWDIXX 2082
              +   + Q+ES+HFR+ L P SL +++W   +F  ++  YK      + + T   DI  
Sbjct: 2048 EGDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVSEAYKTRSSLLQHKKTAPTDI-- 2105

Query: 2083 XXXXXXXXXXXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGK 2142
                        +     S  +LSYNFCIGW+F   + + PG++ G+ RLF+AY+  YGK
Sbjct: 2106 ----------SELSNKFRSIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGK 2155

Query: 2143 LTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEA 2202
            LTL+DA+FS+A GA+S TF+    E +  NRSYLP+MQI YW  K G   ++F+R  GE 
Sbjct: 2156 LTLLDAYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGER 2215

Query: 2203 LDVSFLTTFITVIESMLQSFQVFQELKTSLIQPXXXXXXXXX--XPKIKSLAPFLSNIKS 2260
            LDV+FL++ I +    ++S Q FQELK +++ P             +   L P LS I++
Sbjct: 2216 LDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFATNKTTEKPVNSEAAPLDPILSKIRA 2275

Query: 2261 VNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIG 2320
             NC  KY GGVFK+FS EDI+++ +PSFE+++P V +  +YKH    +K HWIR LV + 
Sbjct: 2276 FNCIVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVD 2335

Query: 2321 STHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDI 2380
             ++NTLF  C P+++   + +  M+K  +S  K +  +T      S  ++YK+LL  FDI
Sbjct: 2336 PSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNST----ISSSGMNYKKLLRAFDI 2391

Query: 2381 AFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKH 2440
            AF +   +Q +SLSCEPKAKVQADVGF+   + + TNNLD +EPL+ S+ I+  +A+ +H
Sbjct: 2392 AFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRH 2451

Query: 2441 IFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLS 2500
            IFS+E STSF +D ID  F+ THP+II  YGT L+S+V +YFN+KQLQ+L LF+DIWK  
Sbjct: 2452 IFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPD 2511

Query: 2501 SFIRPGPKGKSNNGKRENKHLTLP----QPSNLYGEIPWSFTLIFTNINGSADLGPSLGV 2556
            S I   PKG +   +  + H  LP    Q        PW++TLIF+NI G  DLGPSLGV
Sbjct: 2512 SQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGV 2571

Query: 2557 LSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRT 2616
            LS++  R+W  SDH+ D RQ +  F + +   S GRL G   ++   W SE+SWP +   
Sbjct: 2572 LSVRNNRSWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGF 2631

Query: 2617 HNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEM 2676
            +  PL+++S+ + +L+LK +FDYHMFLI  +      L++E+D +G + DLL V+ TC  
Sbjct: 2632 YETPLISLSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGK 2691

Query: 2677 INICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLL 2736
            I++  TAL +AN +D+YNT++RMRQDNK  Y+ETL++S+T  T+    N +++L SL+LL
Sbjct: 2692 IHLFLTALASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQN-QNVLESLSLL 2750

Query: 2737 QTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVAL 2796
            +TD+S  I +  LQV P  LFD+EVLV+  E++SA   T    K+KT L  ++++  V+L
Sbjct: 2751 RTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSL 2810

Query: 2797 STSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCT 2856
            S  K + +E+ VS I V +Y+++A+K+ GGTI+  P + + MT+WQE +S+++E LY  +
Sbjct: 2811 SAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSS 2870

Query: 2857 FEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQ--TDEEVQKRIKEEENIS 2914
            F  K+ VKWNLGP+NFI+EMW THV+ALA+RR  ++ D +     DE ++++IK+ +  +
Sbjct: 2871 FGGKVDVKWNLGPINFIREMWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIKDVDLGN 2930

Query: 2915 KLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQY 2974
            K  Y+P+EEPRI+MPQI+DLGDATPP+EWFGVNR+R P  THQ+VVVP+QKL H AE++Y
Sbjct: 2931 KYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEY 2990

Query: 2975 ASLLDN 2980
            A +L N
Sbjct: 2991 ARVLGN 2996

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1836 bits (4756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1090/3030 (35%), Positives = 1649/3030 (54%), Gaps = 148/3030 (4%)

Query: 4    SSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRAHIK 63
            SSEF+ VPIS  ++FSW                 FY GR + Y  + ILE+L WKR  +K
Sbjct: 2    SSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVK 61

Query: 64   VNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDSNGV 123
            V           GR+FFKN+T+I +D T S+L G++TWRYWLL +RK S  LES+     
Sbjct: 62   V-----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTS--LESQS---- 104

Query: 124  TMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDHSSY 183
              +K  +LPCRF + C+G E F+YNRT ++DNI++   +E++   +KF     F+D S  
Sbjct: 105  --EKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKF-----FSDPSPR 157

Query: 184  SSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQN-NDRIFDQAKSDKDSLFLQT 242
            +++ T+  N S  +         +  +E+  SS S   ++ NDR +    S     FL+ 
Sbjct: 158  ATEETSTENDSAAQ---------KSHLETSMSSPSASTESLNDRTYQLPNSMPS--FLRL 206

Query: 243  FPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFAVT 302
             P+E  V + +L  GNK T S+++ S E   G +D C P  K+DLYK+KL  +   F ++
Sbjct: 207  LPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMS 266

Query: 303  VKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLF--IQ 360
            ++PN+ Y  +  LK      +L +L  ++   T +  R   L++  K  +   DL   ++
Sbjct: 267  LRPNLCYDNDEPLKNLPKANRLPKLLHKYYE-TFLRVRKRYLSRGSKTESTRKDLRNPLE 325

Query: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420
            +W+GL LY     +P  DD+    F+   HEYA++S V+KC   +  Y +D PG VPHGA
Sbjct: 326  RWRGLGLYWKE-NDPAWDDV--FHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGA 382

Query: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480
             PT   +DGPDVGN GAPP  SLDIQ+FG +I YGPW   ++  I  + +P VSR   P 
Sbjct: 383  FPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPT 442

Query: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540
            +R   GSTR++T  ++SI IM D+ WRI TREPSKD  FLK YKET DD RPFGW++L  
Sbjct: 443  ERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSL 502

Query: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600
            ++ S      A+ PT+ GF N +++H  + EIR+SVNHDIL+  +  D +  + YPL WN
Sbjct: 503  AEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWN 562

Query: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660
             +A W  D+ S+Q   F+L++HITL+ D L+DF +G+PTPY+LFRP     NW++  Y +
Sbjct: 563  AKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSM 622

Query: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRXXX 720
            YLNVND NIVNNP+DFNENCYLS HGDDL I+  +P + I      I YN+ TP+FR   
Sbjct: 623  YLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNM 682

Query: 721  XXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780
                     EFMK KEVGR+ DFS  GSYL +S+LDV+N+DTI I C+SR TTL+CYG+V
Sbjct: 683  NTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYV 742

Query: 781  IRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDNGDVYSDGESGMD 840
            +R+L  VKMNYFGDF +F T+EEY    R                 +      +GE    
Sbjct: 743  VRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANSTETTTA-GEGEDKQ- 800

Query: 841  DAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGELII 900
            +A      +    K+  L+R  NE D++ TF V DG +ILP+ +Y+C+ C A +F  L I
Sbjct: 801  NAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDI 860

Query: 901  DLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQ-GFLSDLSIHGHRM 959
            DLR  NYYMDL A+L   ++   ++  P  +F     + R  S A  G +SDL IH HRM
Sbjct: 861  DLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSG--SEGRCPSRANFGSISDLHIHAHRM 918

Query: 960  FGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVIND 1019
            FGLPP+E TYFCKWDF +GVL+++S+   +  F  ++S++ F FKD ENI+ Y    I D
Sbjct: 919  FGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILD 978

Query: 1020 MTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYG 1079
            MTS+  +A EI V + +      + ++ ++V    +DFE+  YSSR D+ I S+ + +  
Sbjct: 979  MTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKE 1038

Query: 1080 LDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKK 1139
               DG  + + +F++ + +T F Q KNF  H   Q+++I  NDA FHR SFLLP + Q+ 
Sbjct: 1039 GGKDG--SLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRS 1096

Query: 1140 ELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFL-GEYVSLLDDRTIFRMPFGSTNTP 1198
            + Y +L GSIVP  S+P +  PI P+ V  IL++FL GE  SL      F          
Sbjct: 1097 DNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHF---------- 1146

Query: 1199 NQASTHHEEDMDPLEFSNSTVST---EKNYQCDNLVIDIEYISVEINPSISTYIESLSST 1255
                +  EED     F++  +S+   + N + ++LV+ +      I+        S S  
Sbjct: 1147 ---CSKKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQ 1203

Query: 1256 VYEENIVQVIDDIEIETIKILSTFQEGTSSITNIK---------LRVLYSDIYWGERDRY 1306
             Y   + Q+ID  EIE +              N+K         L    SD      D  
Sbjct: 1204 AYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTV 1263

Query: 1307 GIELYLDKLDFEMSQRNIEKDREKGLLE-ITMLAKTRSIRASI---SEEGSTKNEKERPP 1362
             I +    +D  M +       EK  ++ IT L K  S+   +   S  G  +N  E   
Sbjct: 1264 DIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHED-Q 1322

Query: 1363 ALSLVVEGCELWSATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQNQNLQNIITTLNS 1422
              S  ++  E W  + + + +              + E   +F+     N+  I   ++ 
Sbjct: 1323 LCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSV 1382

Query: 1423 VQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRH 1482
             +     ++R    +++ A+D YQI HDP VITKPA+ITRL   HVREN+SWKIITRLRH
Sbjct: 1383 HKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRH 1442

Query: 1483 ILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTN 1542
            IL Y+P    + +   LK  S      A ++F+++FS WR+WE SDV + Y+Y + F + 
Sbjct: 1443 ILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYS- 1501

Query: 1543 QAEKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKL 1602
            Q E     +   ++V+  S  ++  T     + + +      + ++    +E   S   +
Sbjct: 1502 QYEGQAGPLNLRVEVDSCSATVSDSTHK---EGDMIAVKGLKLLKKFILKSEMVGSILAI 1558

Query: 1603 IN--------LTGSIGSVKGNFSDEXXXXXXXXXXXNKEQEKMERSPSFQVDNIPKSFKL 1654
             +        L+ S+ +VK + S E            + Q   +   + QV    K  KL
Sbjct: 1559 DDGTATDGNSLSCSLKAVKASIS-ETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKL 1617

Query: 1655 NAL-LLFEKTEVQLVIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITH 1713
              L LL ++ E+++ +       +     +S  L   + A     S+ L     E  + H
Sbjct: 1618 MELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRH 1677

Query: 1714 RNTTLVENQVRDFSLSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVK 1773
             N  +V+   R  SL + +    S     V        +K  + T    N +  + ++  
Sbjct: 1678 NNAIIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWS 1737

Query: 1774 NIDKQLSISDRLAEGENKSPK-KKLKDVEIEVVCQLSNVSFEIMPISPFYIRHETKKFDL 1832
            ++  +L  + R    ++ SP+ K    V  E    + + + EI  +SP  I    K   +
Sbjct: 1738 SLAPKLKFNTR---SKDLSPEMKNFSKVAFEA--HVDDFTSEISALSPLSISKRFKGLTV 1792

Query: 1833 KFKQFGSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEG-EFIIVDANVSAS 1891
            +F++  + ++ + V + D  L S++T QQY ++S    ++T  + +  E +     + ++
Sbjct: 1793 QFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESA 1852

Query: 1892 MIKLTFSEPNRILSSFLQDERTASESXXXXXXXXXXXXX-----QTEGRLQPATTKEMRW 1946
            + K    +P  I+ +  QD   A ++                   T+  +         W
Sbjct: 1853 LTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREW 1912

Query: 1947 LLDTDIKYFGILVPISTTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKD 2006
            L   D+KY G+LVP+ TT ++ E + L  S+S  +  +++       ++S+  + FLI D
Sbjct: 1913 LWQLDMKYVGLLVPLGTTSYISEINELSSSLSCDEAAEFSFP-LVHGELSVAGISFLIND 1971

Query: 2007 RGIPSALSRMLDFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVR---LVWGGQQFL 2063
            + +P  LS++L+F+      +       S Q+ES HFRI L P+SL+R   L +      
Sbjct: 1972 KELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEATHLS 2031

Query: 2064 GLANYYKEQRGTDLWDIXXXXXXXXXXXXXXIGMNMSSFHVLSYNFCIGWMFPEANASAP 2123
            GL    K+  G    D               I     S  +LSY+FC+GW+F    AS  
Sbjct: 2032 GL-QALKDNAGVKSSD--------DAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNS 2082

Query: 2124 GIMLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAY 2183
            G+  G+ RLF+A+E  YGKLTL+DA+F +ARG+TS  FY +  E++  NRS LP+MQI Y
Sbjct: 2083 GLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICY 2142

Query: 2184 WVKKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQSFQVFQELKTSLIQPXXXXXXXX 2243
            W + +G   ++F+R +GE LDVSFL+  I +     +S  +FQELK   + P        
Sbjct: 2143 WFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVK 2202

Query: 2244 XXPKIKSLA--PFLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNY 2301
              P   + +  P LS+I  VNC+ +Y GGVFK++S +DI+    PSF+L++P V + F Y
Sbjct: 2203 RVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEY 2262

Query: 2302 KHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNL 2361
               +   + H +RAL+++ S+HNTLF  C P+I+E    I +++K    +    S+ T  
Sbjct: 2263 TKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLK----DLNKSSVETPR 2318

Query: 2362 SKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDE 2421
            +    + I+Y+ LL   DI+F +   +Q++SLSCEPKAKVQADVGF+ F + + TN+ D 
Sbjct: 2319 TSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDV 2378

Query: 2422 TEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLY 2481
             EPL+ SL I    A+ +HIFS+E STS  ++ +   FM THPD I+ YG   I  +D+Y
Sbjct: 2379 LEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVY 2438

Query: 2482 FNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNL-------YGEI- 2533
            FN+KQLQ+L +FI+IWKL S I   P       + +NK +    P+NL       Y ++ 
Sbjct: 2439 FNIKQLQDLNVFINIWKLDSKILSQP-------ELDNKFVI--GPTNLEKPLTSKYKKVI 2489

Query: 2534 -----PWSFTLIFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFV 2588
                 PW+F +I + I G  DLG SLGVLSL  ++ W  +DHY D  Q +    D LS  
Sbjct: 2490 SNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLS 2549

Query: 2589 SKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTIS 2648
            S GRL G F L    WMS++ WP  + +   PLV +++ +D  ++K  FDYH+ LI ++ 
Sbjct: 2550 SDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVE 2609

Query: 2649 TAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMRQDNKILYL 2708
                SL +++D  G + +LL V+ + +   +  TAL  ANI D+YNT++RMR+DN+  YL
Sbjct: 2610 KLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYL 2669

Query: 2709 ETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIEN 2768
            ETL +S+T +T+G+  +  +IL SL+ L+T++S  +  + +QV P  LFD+EV+     +
Sbjct: 2670 ETLGDSNTRDTKGS-SSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARD 2728

Query: 2769 ISARAGTFAGEKLKTILELEVYDGYVALSTSKREIDEDTVSAISVADYMEYASKISGGTI 2828
             S  + T   +KLKT L+L+V++  +ALST K ++ E   S I V +Y+E+ASK+ GGTI
Sbjct: 2729 FSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTI 2788

Query: 2829 IEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRR 2888
            +  P + I MT+W +  ++ +E LY  +F  KI V+WNLG +NF++EMW TH +A+A+RR
Sbjct: 2789 LSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRR 2848

Query: 2889 SQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNR 2948
            S N        DE +  ++K+ +   +  Y+P+EEP I++PQ +DLG+ATPP+EWFGVNR
Sbjct: 2849 SHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNR 2908

Query: 2949 KRLPAFTHQTVVVPVQKLVHAAEKQYASLL 2978
            K+ P  THQ V+VP+QKL H AE ++A +L
Sbjct: 2909 KQFPGLTHQGVIVPLQKLAHLAESEWARIL 2938

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1835 bits (4752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1070/3060 (34%), Positives = 1658/3060 (54%), Gaps = 183/3060 (5%)

Query: 4    SSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRAHIK 63
            +S+F+ V +S  ++FSW                 FY GR   Y  + +LEWL WKR  +K
Sbjct: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61

Query: 64   VNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDSNGV 123
            ++I+SL+IS LGGRIFFKN+T++ ++ T S LQG++TWRYWLL +RK ++   S++ +  
Sbjct: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENID-- 119

Query: 124  TMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDHSSY 183
              K  E+LPCRF + C+G E F+YN+T ++DNI+N   +E+  +F+ F     F D+S  
Sbjct: 120  --KSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDF-----FQDNSDK 172

Query: 184  SSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFLQTF 243
            ++   +    S G+ +            S  S  S     NDR F     D    FL+  
Sbjct: 173  NTDECSVDEDSAGQRSH--------LETSTSSPSSKSKSLNDRSFQSP--DSTPPFLKLL 222

Query: 244  PVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFAVTV 303
            P+E  V + ++  GNK + S++++S E   G++D C P  K+DLYK+K+  E   F +++
Sbjct: 223  PLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISL 282

Query: 304  KPNIGYKEEMLLKFKIDRGKLSRLWKR----FTPITGIITRPLGLTQRKKKRNEPPDLFI 359
            KPN+  + E  LK  + R KLS+LW R    F       ++    + +   RN      +
Sbjct: 283  KPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNP-----L 337

Query: 360  QKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHG 419
            ++W+GL LY     E    D D  QFD   HEYA+++ V+KC   +  Y +D PG VPHG
Sbjct: 338  KRWRGLGLYWKE--EDAAWD-DRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHG 394

Query: 420  AHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESP 479
            A PT   +DGPDVGN+G PP +S+DIQI G S+ YGPW+  ++  +  + +P VSR   P
Sbjct: 395  ALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQP 454

Query: 480  VKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLR 539
            V++  PGS RIYT  +LSI I+ ++ WRI TRE SKD  FLK ++ET D+ RPFGW+++ 
Sbjct: 455  VEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVS 514

Query: 540  FSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVW 599
             S+ S   F  A+ PT  GF N +++H  + EIR+SVNHDIL+  +       + YPL W
Sbjct: 515  LSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGW 574

Query: 600  NDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYF 659
            N +A W  D  SNQ + F+L++HITL+ D ++DF SGEPTPYELFRP     NW    Y 
Sbjct: 575  NKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYS 634

Query: 660  IYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRXX 719
            IYLNVND NIVNNP++FNENCYLS HGDDL +N  +P E+I     +I Y + TP+FR  
Sbjct: 635  IYLNVNDANIVNNPVNFNENCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLN 694

Query: 720  XXXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGF 779
                      EFMK KEVGRS +FS  GSYL +S+LDVDN+DTI I C S+ TTL+CYG+
Sbjct: 695  MNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGY 754

Query: 780  VIRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDNGDVYSDGESGM 839
            V+RY   VKMNYFGDF +F T+EEY    R                 D+     +    M
Sbjct: 755  VLRYFLGVKMNYFGDFVHFKTTEEYMEELR-------GTNAVTKTTHDSETEIQEAPKQM 807

Query: 840  DDAISQE---IPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFG 896
            D+  SQ    I +  T K++ L+R  NE D++ TF V DG  ILPE +Y+CD+C AL+F 
Sbjct: 808  DEDSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFD 867

Query: 897  ELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRE--SSEAQGFLSDLSI 954
             L IDLR  NYYMD+ A+L    + R  +    ++F+      R        G LS L I
Sbjct: 868  SLDIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFE---QKGRALCGELVAGRLSRLHI 924

Query: 955  HGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSK 1014
            H HRMFGLPP E TYFCKWDF +G L+++S+  F  GF+ ++ ++GFGF+D ENI+ Y  
Sbjct: 925  HTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKV 984

Query: 1015 EVINDMTSLTVNAQEI---SVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIP 1071
              I DMTS+T+    I   +  +K+E +   + L  Q ++    D E++ YSSR+DL + 
Sbjct: 985  APILDMTSVTLAIDAIVFCTDKIKDETA---IQLNAQDISAKFADLENSLYSSRVDLDVA 1041

Query: 1072 SLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFL 1131
            +L  S+  +D +     + +F T + +++F Q ++   H   Q+ +I  NDA FHR  FL
Sbjct: 1042 NLTASI--IDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFL 1099

Query: 1132 LPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLD--DRTIFR 1189
            +P + Q    Y  L+G I P  S+P LA+P+  + V  + + +L    +  D  DR    
Sbjct: 1100 IPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVDRW--- 1156

Query: 1190 MPFGSTNTPNQASTHH-EEDMDPLEFSNSTVS---TEKNYQCDNLVIDIEYISVEINPSI 1245
             P       N +S    +  + P+   N+++S   ++  ++ + LV+++E   + I+P  
Sbjct: 1157 FPVNEVKNKNSSSLKDFKGQLQPILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPEC 1216

Query: 1246 STYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIY---WGE 1302
               I +     +++ I Q ID+IE++ +           +  NI++ +   D+    + +
Sbjct: 1217 YEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNK 1276

Query: 1303 RDRYGIELYLDKLDFEMSQRNIEKDREKGLL---------EITMLAKTRSIRASISEEGS 1353
             + Y +E    ++    +Q +++   +KGL          + T L K  S+   +  +  
Sbjct: 1277 ENTYDVE---GQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLD 1333

Query: 1354 TKN---EKERPPALSLVVEGCELWSATAEKQVNXXXXXXXXXXXXXXQLEWLFLFVNEQN 1410
             K    E +   A    V+  E WS       +              +  WL  F+ +  
Sbjct: 1334 KKTKFAEMDENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAF 1393

Query: 1411 QNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRE 1470
             + + +I  L+    +   + ++   +++ A+D YQI+HDP VITKPA+ITRL   HVRE
Sbjct: 1394 NDSKQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRE 1453

Query: 1471 NRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVA 1530
            +RSWKI+TRLRHIL Y+P+   S + N LK      +  A++ F+ +FSNW NW++SDV 
Sbjct: 1454 SRSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVE 1513

Query: 1531 RSYIYGRLFLTNQAE---KHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFE 1587
            + Y+Y R+F TN  +    H+ S     K+   +F L  + +      + +L N      
Sbjct: 1514 KCYMYRRVF-TNTLDDTVAHESST----KIETGTFMLNFFDSINTGSDSVILKNLKAQRT 1568

Query: 1588 QTPPFTEAGVSREKLIN--------LTGSIGSVKGNFSD---------EXXXXXXXXXXX 1630
                  EA   R  + N        L+  I   + + SD                     
Sbjct: 1569 LEACKDEAAEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAA 1628

Query: 1631 NKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIGESKLTNRILNGKVSLLLDHP 1690
             KE EK+   P+FQ              L ++ ++QL+ G ++   +     ++++ ++ 
Sbjct: 1629 VKENEKL---PAFQ----------QYTALVDRCDIQLLCGANRANLKSFGNTLTIVRENK 1675

Query: 1691 KEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKPTVL-VSTQCAH 1749
             E  + A S        E  I HRNT L++   R  ++ A    +S K +   +  +   
Sbjct: 1676 SED-ADAFSTAFAWSWFEFGIRHRNTILLDAFSRSSAVGA--HGFSGKNSRRKLDLRAKK 1732

Query: 1750 FHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKSPKKKLKDVEIEVVC--- 1806
            F +K  +++      +  + ++  N+        RLA G N    +K      E V    
Sbjct: 1733 FRLKLPSESKHYCTFIDSLEESWNNL--------RLALGPNTGFLEKPHSAATEKVAPQF 1784

Query: 1807 ----QLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQY 1862
                 +S+++ +I  +S   I    KK  L ++Q  S  + +     D  + S  T QQY
Sbjct: 1785 ALNIDISDLTTDISLLSSLAITKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQY 1844

Query: 1863 FRISFGDFQITY-----NLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASES 1917
             +IS  +   +      N      + +D+N++    KL   +P  I     +D   A   
Sbjct: 1845 LKISQSNISFSLHRPKKNNASPPTVKLDSNIT----KLKLYDPRDITLPLGKDIAQAKAC 1900

Query: 1918 XXXXXXXXXXXXXQTEGR-LQPATTK---EMRWLLDTDIKYFGILVPISTTYFVFETHAL 1973
                         + +   +    TK      W+    + Y G+L+P+ +T ++ E + +
Sbjct: 1901 LASLKSCFGKLNTKNDKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEI 1960

Query: 1974 VLSMSDIDTEKYTEKDETQSQ------VSIENVVFLIKDRGIPSALSRMLDFSISFSTIQ 2027
                + I  +++T K    SQ      +S  ++ FLI DR +P ALSR++DF++S    +
Sbjct: 1961 ---SAFITADEFTNKASENSQGALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAK 2017

Query: 2028 KMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIXXXXXXX 2087
            +  E+  S Q+ES +FRI LSP+SLVR+++   +   L+   K Q       +       
Sbjct: 2018 ESEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSELQKRQT------VGKLPESV 2071

Query: 2088 XXXXXXXIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVD 2147
                         S  VLSYNFC+GW+F   ++  PG++ G+ RLF+A+E  YGKLTL+D
Sbjct: 2072 EVRETFRFRRAFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLD 2131

Query: 2148 AFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSF 2207
            A+FS+A G+TS  FY  ++  E+ NRS+LP+MQI YW++  GL  ++FIR +GE LDV F
Sbjct: 2132 AYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRF 2191

Query: 2208 LTTFITVIESMLQSFQVFQELKTSLIQPXXXXXXXXXXPKIKSLA--PFLSNIKSVNCQF 2265
            L+  I V   +++S  +F ELK   + P              + +  P LS I+ V+C+ 
Sbjct: 2192 LSKSIDVAGGLMKSLNMFDELKKQYVDPFKSVANPKRPSATSTFSKFPGLSTIQRVDCKV 2251

Query: 2266 KYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNT 2325
            +Y GGVF+++S +D+++   PSF+L++P V I F+Y+  +     H +RA + + S+HNT
Sbjct: 2252 QYAGGVFRLYSLDDVQNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNT 2311

Query: 2326 LFAVCAPLIAEFLEHIHEMVK---KHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAF 2382
            +F  C P++ E    I +++K   +      H+S++        +++DY+  L G DI+F
Sbjct: 2312 IFPTCVPVLNEMARDIRQLLKGFNRSPQEASHKSVS-------QESLDYRSFLRGTDISF 2364

Query: 2383 KLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIF 2442
             +   +Q++S SCEPKAKVQAD+GF+   + + TN+LD +EPL+ S+ I +  A  +HIF
Sbjct: 2365 LIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIF 2424

Query: 2443 SKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSF 2502
            S+E STS  +D +   F+ THPD I+ YG   I  +D+YFN+KQLQ+L +F++IWK  S+
Sbjct: 2425 SREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSY 2484

Query: 2503 IRPGPKGKSNNGK---RENKHLTLP-QPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLS 2558
            +   P+  S + +    E K L    +  +     PW+F LI + I G  DLG SLGVLS
Sbjct: 2485 VFTQPELDSEHSRALTSEEKPLVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLS 2544

Query: 2559 LKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHN 2618
            L   R W  +DHY D  Q +    + +   S GRL G   L   SWMS + WP  +    
Sbjct: 2545 LTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFE 2604

Query: 2619 YPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMIN 2678
             PLV + V +D   LK +FDYH+ LI ++   K  L +++D  G   +LL V  +     
Sbjct: 2605 SPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQ 2664

Query: 2679 ICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQT 2738
            +  TAL  ANILD+YNT++RMR+DN+  Y ETL +S+T +TR +    +DIL SL+ L+T
Sbjct: 2665 LFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNTKDTR-SASTSKDILNSLSFLRT 2723

Query: 2739 DVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALST 2798
            ++  ++  + +Q+ P  LFD+EVL    ++   ++     EKLKT L+ +++   +ALS 
Sbjct: 2724 ELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSR 2783

Query: 2799 SKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFE 2858
             K ++ E   S I V +Y+E+A K  GGTI+ +P + I MT+W +  ++ +E LY  +F 
Sbjct: 2784 FKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFG 2843

Query: 2859 DKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKY 2918
             KI ++WNLG +NF++EMW THV+A+A+RRS N        DE +++++++ +   + +Y
Sbjct: 2844 GKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPRGFFEDEHLEEKLRDVDLGDEYEY 2903

Query: 2919 VPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLL 2978
            VP+EEP I++PQ +DLG+ATPP+EWFGVNRK+ P  THQ ++VP+QKL H AE ++A +L
Sbjct: 2904 VPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARIL 2963

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 1702 bits (4408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1009/2810 (35%), Positives = 1529/2810 (54%), Gaps = 116/2810 (4%)

Query: 224  NDRIFDQAKSDKDSLFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKE 283
            NDR +    S     FL+  P+E  V + +L  GNK T S+++ S E   G +D C P  
Sbjct: 12   NDRTYQLPNSMPS--FLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDT 69

Query: 284  KLDLYKMKLAIETHNFAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLG 343
            K+DLYK+KL  +   F ++++PN+ Y  +  LK      +L +L  ++   T +  R   
Sbjct: 70   KIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYE-TFLRVRKRY 128

Query: 344  LTQRKKKRNEPPDLF--IQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKC 401
            L++  K  +   DL   +++W+GL LY     +P  DD+    F+   HEYA++S V+KC
Sbjct: 129  LSRGSKTESTRKDLRNPLERWRGLGLYWKE-NDPAWDDV--FHFELPKHEYARYSKVMKC 185

Query: 402  PKAIFTYEYDIPGCVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQ 461
               +  Y +D PG VPHGA PT   +DGPDVGN GAPP  SLDIQ+FG +I YGPW   +
Sbjct: 186  EHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHE 245

Query: 462  MNFIHSMLAPAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLK 521
            +  I  + +P VSR   P +R   GSTR++T  ++SI IM D+ WRI TREPSKD  FLK
Sbjct: 246  IMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLK 305

Query: 522  HYKETNDDYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDIL 581
             YKET DD RPFGW++L  ++ S      A+ PT+ GF N +++H  + EIR+SVNHDIL
Sbjct: 306  RYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDIL 365

Query: 582  MKCKFFDFDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPY 641
            +  +  D +  + YPL WN +A W  D+ S+Q   F+L++HITL+ D L+DF +G+PTPY
Sbjct: 366  LSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPY 425

Query: 642  ELFRPSETFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDIT 701
            +LFRP     NW++  Y +YLNVND NIVNNP+DFNENCYLS HGDDL I+  +P + I 
Sbjct: 426  DLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIA 485

Query: 702  AQFNEITYNITTPMFRXXXXXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVD 761
                 I YN+ TP+FR            EFMK KEVGR+ DFS  GSYL +S+LDV+N+D
Sbjct: 486  GNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENID 545

Query: 762  TISIICESRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXX 821
            TI I C+SR TTL+CYG+V+R+L  VKMNYFGDF +F T+EEY    R            
Sbjct: 546  TIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQ 605

Query: 822  XXXXXDNGDVYSDGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILP 881
                 +      +GE    +A      +    K+  L+R  NE D++ TF V DG +ILP
Sbjct: 606  SANSTETTTA-GEGEDKQ-NAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILP 663

Query: 882  ETIYNCDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRE 941
            + +Y+C+ C A +F  L IDLR  NYYMDL A+L   ++   ++  P  +F     + R 
Sbjct: 664  KNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSG--SEGRC 721

Query: 942  SSEAQ-GFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIG 1000
             S A  G +SDL IH HRMFGLPP+E TYFCKWDF +GVL+++S+   +  F  ++S++ 
Sbjct: 722  PSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLA 781

Query: 1001 FGFKDLENILLYSKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESA 1060
            F FKD ENI+ Y    I DMTS+  +A EI V + +      + ++ ++V    +DFE+ 
Sbjct: 782  FSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENE 841

Query: 1061 NYSSRLDLIIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITL 1120
             YSSR D+ I S+ + +     DG  + + +F++ + +T F Q KNF  H   Q+++I  
Sbjct: 842  RYSSRADVDIHSITVQVKEGGKDG--SLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIAT 899

Query: 1121 NDAAFHRTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFL-GEYV 1179
            NDA FHR SFLLP + Q+ + Y +L GSIVP  S+P +  PI P+ V  IL++FL GE  
Sbjct: 900  NDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKN 959

Query: 1180 SLLDDRTIFRMPFGSTNTPNQASTHHEEDMDPLEFSNSTVST---EKNYQCDNLVIDIEY 1236
            SL      F              +  EED     F++  +S+   + N + ++LV+ +  
Sbjct: 960  SLQMGNEHF-------------CSKKEEDGYAFNFASGLMSSTENDSNVESESLVVKLIK 1006

Query: 1237 ISVEINPSISTYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIK------ 1290
                I+        S S   Y   + Q+ID  EIE +              N+K      
Sbjct: 1007 PQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTF 1066

Query: 1291 ---LRVLYSDIYWGERDRYGIELYLDKLDFEMSQRNIEKDREKGLLE-ITMLAKTRSIRA 1346
               L    SD      D   I +    +D  M +       EK  ++ IT L K  S+  
Sbjct: 1067 EMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVESLAL 1126

Query: 1347 SI---SEEGSTKNEKERPPALSLVVEGCELWSATAEKQVNXXXXXXXXXXXXXXQLEWLF 1403
             +   S  G  +N  E     S  ++  E W  + + + +              + E   
Sbjct: 1127 CVSNTSRNGPLENIHED-QLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCC 1185

Query: 1404 LFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRL 1463
            +F+     N+  I   ++  +     ++R    +++ A+D YQI HDP VITKPA+ITRL
Sbjct: 1186 IFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRL 1245

Query: 1464 SKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRN 1523
               HVREN+SWKIITRLRHIL Y+P    + +   LK  S      A ++F+++FS WR+
Sbjct: 1246 PNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRS 1305

Query: 1524 WEFSDVARSYIYGRLFLTNQAEKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNAN 1583
            WE SDV + Y+Y + F + Q E     +   ++V+  S  ++  T     + + +     
Sbjct: 1306 WESSDVEQCYMYRKAFYS-QYEGQAGPLNLRVEVDSCSATVSDSTHK---EGDMIAVKGL 1361

Query: 1584 IVFEQTPPFTEA---------GVSREKLINLTGSIGSVKGNFSDEXXXXXXXXXXXNKEQ 1634
             + ++    +E          G + +   +L+ S+ +VK + S E            + Q
Sbjct: 1362 KLLKKFILKSEMVGSILAIDDGTATDG-NSLSCSLKAVKASIS-ETAIKLLAFRELFESQ 1419

Query: 1635 EKMERSPSFQVDNIPKSFKLNAL-LLFEKTEVQLVIGESKLTNRILNGKVSLLLDHPKEA 1693
               +   + QV    K  KL  L LL ++ E+++ +       +     +S  L   + A
Sbjct: 1420 NSQDILSNTQVLPSGKILKLMELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTESA 1479

Query: 1694 ISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSATVESWSSKPTVLVSTQCAHFHIK 1753
                 S+ L     E  + H N  +V+   R  SL + +    S     V        +K
Sbjct: 1480 RDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLRLK 1539

Query: 1754 SMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGENKSPK-KKLKDVEIEVVCQLSNVS 1812
              + T    N +  + ++  ++  +L  + R    ++ SP+ K    V  E    + + +
Sbjct: 1540 VPSSTKDYCNFINSLSESWSSLAPKLKFNTR---SKDLSPEMKNFSKVAFEA--HVDDFT 1594

Query: 1813 FEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQI 1872
             EI  +SP  I    K   ++F++  + ++ + V + D  L S++T QQY ++S    ++
Sbjct: 1595 SEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVEL 1654

Query: 1873 TYNLIEG-EFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASESXXXXXXXXXXXXX- 1930
            T  + +  E +     + +++ K    +P  I+ +  QD   A ++              
Sbjct: 1655 TAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGAL 1714

Query: 1931 ----QTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFETHALVLSMSDIDTEKYT 1986
                 T+  +         WL   D+KY G+LVP+ TT ++ E + L  S+S  +  +++
Sbjct: 1715 FGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSSSLSCDEAAEFS 1774

Query: 1987 EKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQVESNHFRIF 2046
                   ++S+  + FLI D+ +P  LS++L+F+      +       S Q+ES HFRI 
Sbjct: 1775 FP-LVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIA 1833

Query: 2047 LSPYSLVR---LVWGGQQFLGLANYYKEQRGTDLWDIXXXXXXXXXXXXXXIGMNMSSFH 2103
            L P+SL+R   L +      GL    K+  G    D               I     S  
Sbjct: 1834 LCPFSLIRILSLAYEATHLSGL-QALKDNAGVKSSD--------DAKDFFNISQTFHSIQ 1884

Query: 2104 VLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSATFYP 2163
            +LSY+FC+GW+F    AS  G+  G+ RLF+A+E  YGKLTL+DA+F +ARG+TS  FY 
Sbjct: 1885 ILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYI 1944

Query: 2164 RESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQSFQ 2223
            +  E++  NRS LP+MQI YW + +G   ++F+R +GE LDVSFL+  I +     +S  
Sbjct: 1945 QPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLH 2004

Query: 2224 VFQELKTSLIQPXXXXXXXXXXPKIKSLA--PFLSNIKSVNCQFKYDGGVFKVFSFEDIE 2281
            +FQELK   + P          P   + +  P LS+I  VNC+ +Y GGVFK++S +DI+
Sbjct: 2005 LFQELKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIK 2064

Query: 2282 SHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHI 2341
                PSF+L++P V + F Y   +   + H +RAL+++ S+HNTLF  C P+I+E    I
Sbjct: 2065 RKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDI 2124

Query: 2342 HEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKV 2401
             +++K    +    S+ T  +    + I+Y+ LL   DI+F +   +Q++SLSCEPKAKV
Sbjct: 2125 RQLLK----DLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEPKAKV 2180

Query: 2402 QADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMF 2461
            QADVGF+ F + + TN+ D  EPL+ SL I    A+ +HIFS+E STS  ++ +   FM 
Sbjct: 2181 QADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFML 2240

Query: 2462 THPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHL 2521
            THPD I+ YG   I  +D+YFN+KQLQ+L +FI+IWKL S I   P       + +NK +
Sbjct: 2241 THPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQP-------ELDNKFV 2293

Query: 2522 TLPQPSNL-------YGEI------PWSFTLIFTNINGSADLGPSLGVLSLKLKRTWVAS 2568
                P+NL       Y ++      PW+F +I + I G  DLG SLGVLSL  ++ W  +
Sbjct: 2294 I--GPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVT 2351

Query: 2569 DHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNI 2628
            DHY D  Q +    D LS  S GRL G F L    WMS++ WP  + +   PLV +++ +
Sbjct: 2352 DHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFL 2411

Query: 2629 DNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAAN 2688
            D  ++K  FDYH+ LI ++     SL +++D  G + +LL V+ + +   +  TAL  AN
Sbjct: 2412 DETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPAN 2471

Query: 2689 ILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLK 2748
            I D+YNT++RMR+DN+  YLETL +S+T +T+G+  +  +IL SL+ L+T++S  +  + 
Sbjct: 2472 IFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGS-SSSHEILSSLSFLRTELSVMLKFVH 2530

Query: 2749 LQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKREIDEDTV 2808
            +QV P  LFD+EV+     + S  + T   +KLKT L+L+V++  +ALST K ++ E   
Sbjct: 2531 IQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVA 2590

Query: 2809 SAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLG 2868
            S I V +Y+E+ASK+ GGTI+  P + I MT+W +  ++ +E LY  +F  KI V+WNLG
Sbjct: 2591 SQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLG 2650

Query: 2869 PVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKYVPIEEPRIDM 2928
             +NF++EMW TH +A+A+RRS N        DE +  ++K+ +   +  Y+P+EEP I++
Sbjct: 2651 SINFLREMWATHARAMALRRSHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEI 2710

Query: 2929 PQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLL 2978
            PQ +DLG+ATPP+EWFGVNRK+ P  THQ V+VP+QKL H AE ++A +L
Sbjct: 2711 PQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARIL 2760

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1590 (33%), Positives = 818/1590 (51%), Gaps = 127/1590 (7%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            M   +EF+++ +   + F W                 FY+ RAI YI + IL W++WKR 
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120
             + +NI+SL  S++GG+++FKN++I  +D TIS+L+GT TWRYWLL  R P+   + K+S
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPR-PT---QLKNS 116

Query: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFL--DEQIFN 178
            N      +E   CRF L C+G E+F+YN+   Y++I+N  +K ++   +KF   DE IF 
Sbjct: 117  N----INDENSKCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFG 172

Query: 179  DHSSYSSKTTNGANSSTGESN-SDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDS 237
               + SS   +  + S+ +S    T LN         S+QS                   
Sbjct: 173  RVKTDSSVMFDPLDESSEQSKVGQTILN-------SVSNQSAV----------------P 209

Query: 238  LFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETH 297
            L+L   P E+ +   ++  GNK TPS+ II      GIID   P   LD YK++   E  
Sbjct: 210  LYLDFLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELS 269

Query: 298  NFAVTVKPNIGYKE-EMLLKFKIDRGKLSRLWKRFTP-ITGIITRPLGLTQRKKKRNEPP 355
            +  V+VKPNI +       K KID GK   LW++    +   I+  L  T  KK      
Sbjct: 270  STRVSVKPNISFGNGSSSKKHKID-GKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQE 328

Query: 356  DLFIQKWQGLSLYKGTIFEPTTDDL-DDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPG 414
            + F+  W+GL++Y       T+D   D+I FD  NHEYAK+++++   +    Y YD PG
Sbjct: 329  E-FLTSWKGLAMYDVA----TSDTFSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPG 383

Query: 415  CVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVS 474
             +      T + I G + G+    P +S+D+Q++  +  YGPW  RQ+ +   M +PAVS
Sbjct: 384  VI------TETLIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVS 437

Query: 475  RTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFG 534
            R  S  ++ V G +R +   +  I IM+D+ WRI T+EPSKD  FL  YK TND+ R FG
Sbjct: 438  RDFSAHRKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFG 497

Query: 535  WIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVS 594
            WID++ +K++       L  +  GF+N  + +L    I +SVNHD+L   K        S
Sbjct: 498  WIDIKLNKDTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQS 557

Query: 595  YPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWK 654
            YP  WN   TW +   S+ LE F+LR+H  L+ D  TDF SG+  PYELFRP     +W 
Sbjct: 558  YPHQWNSAITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWD 617

Query: 655  MDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTP 714
            +  Y +YLN ND NIVNNPLDFNENCY+S+HG+   I V +P E I+ +   I+Y I TP
Sbjct: 618  ISNYSLYLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPIETISEESITISYEIYTP 677

Query: 715  MFRXXXXXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTL 774
             F             EFM  + VGRS++FSA GSYL Y+++D+DNVDTI++ C++   T 
Sbjct: 678  KFDIQLKTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATF 737

Query: 775  QCYGFVIRYLANVKMNYFGDFFNFITSEEYTG--ITRXXXXXXXXXXXXXXXXXDNGDVY 832
              YGF++RY+ N+K+NYFG+F  F T+EEY+     R                 +  +  
Sbjct: 738  LAYGFLLRYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATDIFNNNDDDQTTELVEPN 797

Query: 833  SDGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTA 892
            S GESG D      I     + ++ L+RT NE D+++TF   DG  +LPE+ Y+  +C  
Sbjct: 798  SYGESGFD------ILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFG 851

Query: 893  LKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDL 952
            L F  +  D+R  +YY DL  S+  T ++RY + S   +F     +   +S   G+LS+ 
Sbjct: 852  LHFDNITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEF 911

Query: 953  SIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLY 1012
            +IH HRMFGLPP E TY  K D  +G L+  S+ + LKGF+   ++  FGF + E++L Y
Sbjct: 912  NIHIHRMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHY 971

Query: 1013 SKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPS 1072
                  D++ L+  A +IS+ L N  +   ++L   +V+   +DF ++ YS R ++ IP+
Sbjct: 972  EMARSFDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPN 1031

Query: 1073 LKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLL 1132
                +  +  D     L   +T +    F++  +FK   ++Q  +I L+DA F R SFL 
Sbjct: 1032 FDFLVSSM--DDHNIVLGTISTSISFAIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLH 1089

Query: 1133 PQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPF 1192
            PQ +Q  +LY  LY SI PSSS+P+L  PI P   D I E+ LG+          F +  
Sbjct: 1090 PQEYQTSDLYKLLYASIPPSSSIPLLPEPIGPNNFDTIFENLLGDIYQDYISEGTFDI-- 1147

Query: 1193 GSTNTPNQAST-----HHEEDMDPLEFSNSTVS-TEKNYQCDNLVIDIEYISVEINPSIS 1246
             S +T  Q +      H E      +  N T+   ++ ++  + V ++ +I+++I+  + 
Sbjct: 1148 -SNDTKLQLNIDEFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVL 1206

Query: 1247 TYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRY 1306
                 L   +    I   ID + ++ +   S    G SS+T  K+     D      + Y
Sbjct: 1207 EVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYY 1266

Query: 1307 GIELY-------LDKLDFEMSQRNIEKDREK-----------------GLLEITMLAKTR 1342
             +E         ++KLD  +  R  E D+E                   L+   ML+K  
Sbjct: 1267 ALEDVKHYFVSDINKLDLNLRLRQ-EYDKESANSEMNSKNKLSVYYKTALINGKMLSKEN 1325

Query: 1343 SIRASISEEGSTKNEKERPPALSLVVEGCELWSATAEKQVNXXXXXXXXXXXXXXQLEWL 1402
             I  S S E S K+  E        +EG   +        N               L+  
Sbjct: 1326 FIYPSESSEFSYKSTFEE-------LEGYAFYDDDLVTDAN---------------LQRG 1363

Query: 1403 FLFVN-EQNQNLQNIITTL----NSVQAEHTVS-------RRKLISKLTAANDFYQISHD 1450
             +F+N E + ++   I TL    N+     T+S       +R+L+ ++  A   Y I HD
Sbjct: 1364 CVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHD 1423

Query: 1451 PYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEA 1510
            P VITKPA ITRLS+ HVRE+RSW+I+TRLRH+L Y+P  W       L++     +++A
Sbjct: 1424 PPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDA 1483

Query: 1511 KKVFMSVFSNWRNWEFSDVARSYIYGRLFL 1540
            K  F+ +F+ WR+WEF+DV R ++Y + ++
Sbjct: 1484 KLQFLDIFTRWRSWEFADVERCFLYKKTYI 1513

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/1199 (33%), Positives = 657/1199 (54%), Gaps = 52/1199 (4%)

Query: 1804 VVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQYF 1863
            V   ++ ++ ++  + PF +R+  K+F++           + + DT   L S   ++ Y 
Sbjct: 1770 VKMNIAAINIQLQLLLPFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYM 1829

Query: 1864 RISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASESXXXXXX 1923
            + S    ++    +     +   ++ +S  KL+  EP + +  FL D   A ++      
Sbjct: 1830 KYSHSYLKLIGMDLGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRS 1889

Query: 1924 XXXXXXXQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYFVFETHALVLSMSDIDTE 1983
                    T     P + + +   L+ +++Y G+L+   TT +V E + L  S S   T 
Sbjct: 1890 TMLETKSSTVQNEFPFS-RLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTS 1948

Query: 1984 KYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQVESNHF 2043
                     S  S E++ FLIKDR +   LS++LDFS+    I+  +    S Q+ES++ 
Sbjct: 1949 SNPVVPTFSSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYL 2008

Query: 2044 RIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIXXXXXXXXXXXXXXIGMNMSSFH 2103
               LSP SLVRL+    +F  + + Y + +                     + +++ S H
Sbjct: 2009 HAVLSPMSLVRLLSFVNEFSIMKSIYHDIKP---------RSTSSNSTLSILPISIKSAH 2059

Query: 2104 VLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSATFYP 2163
            +LSYN CIGW+F     +  G++ G+ RLF+ Y+  YGKLTL+DA+FSVA G +S+T+YP
Sbjct: 2060 ILSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYP 2119

Query: 2164 RESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQSFQ 2223
              +E  ++NRSYLP+MQI YW+++    KD+FIR +GE LDVS L  + T+++   QS  
Sbjct: 2120 DGNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLH 2179

Query: 2224 VFQELKTSLIQPXXXXXXXXXXPKIKSL-APFLSNIKSVNCQFKYDGGVFKVFSFEDIES 2282
             F++LK +++ P           +   L  P  S+++S+NC   Y G   K++S +DI+ 
Sbjct: 2180 KFKKLKETILDPLKVTSNDPILGEWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDIQ- 2238

Query: 2283 HLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIH 2342
            H   SFE+++P   +  +YK+     K HWIR L  + +THNTLF VC PL+ E     +
Sbjct: 2239 HGTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFN 2298

Query: 2343 EMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQ 2402
             M+K  +S ++  + A NL+ A ++ I+Y+ LL+ FDIA  +   +Q++SL+CEP AK+Q
Sbjct: 2299 TMLK--NSCSQFSNGAPNLASAKAE-INYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQ 2355

Query: 2403 ADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFT 2462
            A +GF+ F I I TN++   EPL  S+ +    AS +H+FS+E S+S  L  I + F  T
Sbjct: 2356 ATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREISSSLSLQQISMVFSLT 2415

Query: 2463 HPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHLT 2522
            H + I+ YG+ LIS+   YFNVKQ+++L LF++IW +               K  N  + 
Sbjct: 2416 HSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIE------------KQKSVNDIIL 2463

Query: 2523 LPQPSNLYGEIP---------------WSFTLIFTNINGSADLGPSLGVLSLKLKRTWVA 2567
             P  ++ +  +P               W + LI + I    DLGPSLG++ +K    W  
Sbjct: 2464 APVTASSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGL 2523

Query: 2568 SDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVN 2627
            S H  D  Q +      +   S GRL G   +    W S+++WP     H  PLV +S+ 
Sbjct: 2524 SSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLA 2583

Query: 2628 IDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAA 2687
            +   + K +FDYHMF I TI  A   L +++D  G + DLL V+ + + I +  T+L  A
Sbjct: 2584 LGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYA 2643

Query: 2688 NILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVL 2747
            N+ D+Y+T+ RMR D+    L+ L ES+ L+   + DN + +L SL  L+T++S N  +L
Sbjct: 2644 NLFDIYSTIRRMRNDSGRTNLDLL-ESNELKKISSFDNSK-MLASLLSLRTELSVNAQLL 2701

Query: 2748 KLQVSPIALFDLEVLVINIENI------SARAGTFAGEKLKTILELEVYDGYVALSTSKR 2801
             L +    L   EV+V+    +       A + T +  K++T L  ++ D  ++LS+ K 
Sbjct: 2702 NLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKH 2761

Query: 2802 EIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKI 2861
            ++DE+ +  I V DY++ AS I GG I+E P + + M +WQ + S+++E LY  +F + +
Sbjct: 2762 QLDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGV 2821

Query: 2862 AVKWNLGPVNFIKEMWTTHVKALAVRRSQ--NVLDTDMQTDEEVQKRIKEEENISKLKYV 2919
            ++ WNL P+NFIK+MW+ H+ A+ +R  Q  N  +  +  DE+++ ++ + +  +K  Y 
Sbjct: 2822 SITWNLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYK 2881

Query: 2920 PIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLL 2978
            P+EEP I+MP+I+DLGDATPP+EWFG+NR R P  THQ VVVP+QKL   AEK+Y  +L
Sbjct: 2882 PLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1595 (31%), Positives = 807/1595 (50%), Gaps = 117/1595 (7%)

Query: 1    MASSSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRA 60
            M SSS F+ + IS  K+ S                  FY+GR +A++ +  L++ +W++ 
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120
             IK+N++S+++S LGGRIFFKN+T++  D+TIS L+G+ TWRYWLL TR      ES+D 
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120

Query: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180
            +     +N +LPCRF+L C+G E+FVYN+   Y                    E +  DH
Sbjct: 121  DA---SENAKLPCRFLLQCDGLEVFVYNKIDVY--------------------ESVLRDH 157

Query: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240
              +++ T +G  +   ESN D  +N E   ++  +S+ + +           +D   L  
Sbjct: 158  --FTNVTKDGQET---ESNDDITINTE---KAAANSKLSNSSRYSYSGRSKSTDAPKLSA 209

Query: 241  QT--FPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHN 298
            +T  FP+++E +RA++  GN+ T  + +   E   G+ D       LD Y+ K++++ ++
Sbjct: 210  KTKLFPIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYD 269

Query: 299  FAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLF 358
                ++ N+GY+ +  +K  +    + ++W+        I++ L   Q K   N+    +
Sbjct: 270  ALFELRTNLGYQNDNPIKTFVVEKTMDKIWQTVKKQCISISKLLLPNQGKTINNQQA--Y 327

Query: 359  IQKWQGLSLYKGT--IFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCV 416
            I  W+GL LY  T  + E   D            EYA++S V+K  +   TY +DIPG V
Sbjct: 328  IDSWKGLDLYHHTKAVQEENVDTTV-----LHEQEYARYSRVMKAERVSLTYYFDIPGIV 382

Query: 417  PHGAHPTNSEIDGPDVGN---NGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAV 473
            P  +   NS+ D  +  N   +   P    DI I+  ++ YGPW  + M  I  + +P V
Sbjct: 383  PANSSSINSQSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIV 442

Query: 474  SRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPF 533
            SR +    +  PGS RIY   KLS+   D +   I TRE SKD  F+K YK T D +R F
Sbjct: 443  SRDQMKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAF 502

Query: 534  GWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDV 593
            GW+++  ++     F  AL    +   N++ + L   EI+SSVNH++L +C       ++
Sbjct: 503  GWLNVSLNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANI 562

Query: 594  SYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINW 653
             YP  WN +A W  +++S   E FLLR+HI+LI+D  TDF++ +   YELFRP    I W
Sbjct: 563  GYPTGWNKQADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKW 622

Query: 654  KMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITT 713
                Y ++LNVND NI+NN LD NENC+LSL GD L  ++ +P   I  + +E T+ + +
Sbjct: 623  VFTEYKLFLNVNDANIINNLLDLNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKS 682

Query: 714  PMFRXXXXXXXXXXXXEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTT 773
            P+ +            EF+     G   DFS  G+Y+ +  +DVDN DTI I   S  T 
Sbjct: 683  PLVKLSIHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTK 742

Query: 774  LQCYGFVIRYLANVKMNYFGDFFNFITSEEYTGITRXXXXXXXXXXXXXXXXXDNGDVYS 833
               +GFV+RYL N+K+NYFGDF +F T+EEY+                     ++ +  +
Sbjct: 743  FLSFGFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLT 802

Query: 834  DGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTAL 893
               S     ++  I E  T+ +S L RT NETD+++TF V DG II+PE +Y+C     L
Sbjct: 803  SSSSDGSYQVADTINEN-TIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLL 861

Query: 894  KFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLS 953
             F  L  D+R +NY+MDL A      +    E S    F  V+      SE  G+L DL+
Sbjct: 862  SFRRLEFDMRYTNYFMDLTAFFSRIYLNHSNEFS----FNRVVAIEESHSENTGYLDDLN 917

Query: 954  IHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYS 1013
            +HGHRMFG+PP E TY CKWD  IG L+ +S+  FL  FL +  ++GF +KD ENIL+YS
Sbjct: 918  LHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYS 977

Query: 1014 KEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSL 1073
                 D+TSLT++   +S  ++    G    L    +   S D  ++ YS R+DL++ ++
Sbjct: 978  IHKPEDVTSLTISIGRVSSIVRTNHGG-SATLSLNDITINSWDLSNSRYSKRVDLLVAAI 1036

Query: 1074 KMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLP 1133
             +      ID KK  LF   T V LT F  + N K HR  Q+N + LND+ FHR  FLL 
Sbjct: 1037 SVCA----IDEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLA 1092

Query: 1134 -QSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLD-DRTIFRMP 1191
                    LY++L GSI PS SLP L+ P+  +T D I E  LG Y++L++ D  I    
Sbjct: 1093 FDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTK 1152

Query: 1192 FGSTNTPNQASTHHEEDMDPLEFSNSTVSTE------KNYQCDNLVIDIEYISVEINPSI 1245
              + + P        +D   L  SN TVS +      + ++ +N  ++I  +SV + P  
Sbjct: 1153 NLTDDRP--------DDKRLLPLSN-TVSNDLSGQLAEEFESENTTVNISTLSVFVTPKA 1203

Query: 1246 STYIESLSSTVYEENIVQVIDDIEIETIKILST-------FQEGTSSITNIKLRVLYSDI 1298
             T+ E+ +  +   +   ++D  E+  + I S        F   +  + N+K+ +  SD 
Sbjct: 1204 FTFAENAAHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNI--SD- 1260

Query: 1299 YWGERDRYGIELYLDKLDFEMSQ-----------RNIEKDREKGLL--EITMLAKTRSIR 1345
                 D+  +E  LD+L+  +S            +N+E+  E   +  + T+     S++
Sbjct: 1261 -ETALDKTQLEA-LDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQ 1318

Query: 1346 ASISEEGSTKNEKERPPA-LSLVVEGCELWSATAEKQVNXXXXXXXXXXXXXXQLEWLF- 1403
             +I +    +  K  P A   +++    L+S     +V+               +EW   
Sbjct: 1319 FNIFKSSKNRLTKVLPIAWFEILMFNTVLFSDVG--KVSKLIFGSIKSAILDADVEWTVE 1376

Query: 1404 -------LFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITK 1456
                    F  E    ++  +  L S+  + T+ R   + K++       I   PY+ITK
Sbjct: 1377 YLLKLAKAFCKEGKSCIE--LGKLRSIDMKETIIRVAELGKISG------IDSVPYIITK 1428

Query: 1457 PAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMS 1516
            PA+ITRLSK HVR+  SWKIITRLRH+  +     E+  +     + + +  + K  F+ 
Sbjct: 1429 PAYITRLSKFHVRDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFLD 1488

Query: 1517 VFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSM 1551
            +F +W+NW+  +V +S ++  LF + ++  H++ +
Sbjct: 1489 IFVDWKNWDVYEVEQSSLFTLLF-SGESTVHEEDL 1522

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1220 (32%), Positives = 637/1220 (52%), Gaps = 52/1220 (4%)

Query: 1780 SISDRLAEGENKSPKKKLKDVEIEVVCQLSNVSFEIM--PISPFYIRHETKKFDLKFKQF 1837
            SI D  A   +   +KK   V++  V  L   S ++      PF IR      D  FK  
Sbjct: 1737 SIDDMKAITPDHDSEKKNGHVDLVWVLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNL 1796

Query: 1838 GSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTF 1897
               +++++   T+  L     + +  RIS    ++ Y       ++ D  +   ++KLT 
Sbjct: 1797 SGISIIVNY--TELLLDFYFNQLKLLRISNSVTKVDY---RSNTLLTDIGLDTDIVKLTL 1851

Query: 1898 SEPNRILSSFLQDERTASESXXXXXXXXXXXXXQTEGRLQPATTKEMRWLLDTDIKYFGI 1957
            S+ NR+    L D    + S                   +PA  K        +  Y G+
Sbjct: 1852 SD-NRVYIEELTDSLNGTVSELIKIFK------NKNADNEPAAPKFKPCSFKMNAIYIGL 1904

Query: 1958 LVPISTTYFVFE---THALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALS 2014
            L  + TT +V E   T     S ++   E +   +  +  + I+NV  L+ +  +   LS
Sbjct: 1905 LTDLKTTNYVLEFNETAFSCASRAEALEETHANDNLREMSLVIQNVCILVLNPEVLPTLS 1964

Query: 2015 RMLDFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRG 2074
            ++ D   +   I+   ++  + Q+E+ H R+ L+P +L+ ++           ++ ++  
Sbjct: 1965 KIFDIGFALKLIED--DIKKTLQIETPHSRVMLAPSTLIAVI-----------FFIQEAK 2011

Query: 2075 TDLWDIXXXXXXXXXXXXXXIG--MNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRL 2132
              L  +              I       S ++LS   C+GW+F E +    GI++G+  L
Sbjct: 2012 VSLQKVKQKGKFNSSSNAIEIPPYFETLSVNILSNKLCLGWIF-EEDTDENGIVIGYESL 2070

Query: 2133 FSAYEGGYGKLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMK 2192
            F+AYE  YGKLT+VD + + A+G  S  F+      E +NRS+L +MQI +W     + K
Sbjct: 2071 FAAYEKPYGKLTIVDGYVATAQGKESNNFFFANGVPE-LNRSHLSSMQINFWFSGQFIEK 2129

Query: 2193 DVFIRFHGEALDVSFLTTFITVIESMLQSFQVFQELKTSLIQPXXXXXXXXXXPKIKSLA 2252
            D+F+R + + LDV  LTT + ++  M  S + FQ+    +              +  S  
Sbjct: 2130 DLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQKKLAKISNIKKSSISTHNVAENLSDK 2189

Query: 2253 PFLSNIKSVNCQFKYDGGVFKVFSFEDI-ESHLEPSFELKTPGVIIDFNYKHNIGSLKPH 2311
              + +I+S+NC  KY GG+  +++ +DI +   + S EL +P + +  +Y HN  S K H
Sbjct: 2190 VSILSIRSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQH 2249

Query: 2312 WIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNI-- 2369
            WIR+LV + STHN LF+ C P++      I + +++ +S  K     T      +Q I  
Sbjct: 2250 WIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISF 2309

Query: 2370 DYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSL 2429
            DYK L    D A  +    Q ++L+CEP+AK+QAD+GF +F I + T++ D +EPL+ SL
Sbjct: 2310 DYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSL 2369

Query: 2430 SIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQN 2489
               + + S +HIFS+E S+S G++ + L+FM TH + I  YG  LIS++  Y N+KQLQ 
Sbjct: 2370 QWSEIEISTRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQE 2429

Query: 2490 LYLFIDIW----KLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNIN 2545
            + LF+DIW    K +  +  GP        +     T P+       IPW + +IF N +
Sbjct: 2430 ITLFLDIWSPKTKKAQKLGSGPHSGQKCQPQALTEFTTPK-------IPWIYQIIFKNTS 2482

Query: 2546 GSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWM 2605
               D+ PSLG ++ K+   W++S H  D    +  + D L+  S GRL G+FE+    + 
Sbjct: 2483 AVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFD 2542

Query: 2606 SEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMP 2665
            S +SWP +      PL+N++  + +LS K  FDYH FLI  +S  + ++ +E+D  G + 
Sbjct: 2543 SSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLK 2602

Query: 2666 DLLKVNFTCEMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDN 2725
            DLL V+ +   +NI  TAL +AN+ D+Y T  RMR +NK  Y++TL+ES+  E+ G    
Sbjct: 2603 DLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLKESNP-ESSGKIHF 2661

Query: 2726 YRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTIL 2785
              + L +   L+T+++  I   +L V P  LFD EVLV+    ++  A T   +K KT L
Sbjct: 2662 SNNELLAPLRLRTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDL 2721

Query: 2786 ELEVYDGYVALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEEN 2845
              ++ D  ++L+  K E+ E+  + +SV +Y   A+ + G  I+  P + + +T+WQ+  
Sbjct: 2722 TWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIP 2781

Query: 2846 SDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQ--TDEEV 2903
               +E+LY  +F DK+ +KWNL P+NFI+EMW THV+AL+VRR             DE +
Sbjct: 2782 DTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRALSVRRGHTEPSPSKPFFEDENI 2841

Query: 2904 QKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPV 2963
             ++IK     +K KY+P+EEP I+MP +RDLG+ATPP+EWFGVNRKR P   HQ +VVP+
Sbjct: 2842 AEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPL 2901

Query: 2964 QKLVHAAEKQY-ASLLDNSG 2982
            QKL++ AE QY  +L DN G
Sbjct: 2902 QKLIYVAEDQYNRTLGDNLG 2921

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1531 (31%), Positives = 769/1531 (50%), Gaps = 118/1531 (7%)

Query: 36   VIFYVGRAIAYITSLILEWLLWKRAHIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLL 95
             IFYVGR + YI S     +LWK+  + V+I+SL  S L G++ FKNV++  +D  IS+L
Sbjct: 5    AIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVL 64

Query: 96   QGTLTWRYWLLKTRKPSYHLESKDSNGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDN 155
            +GT+TWRYWL+   +      S  ++G          CRF L                  
Sbjct: 65   KGTITWRYWLIGRYR-----RSGTADGARR-------CRFAL------------------ 94

Query: 156  IINLFSKEERIKFQKFLDEQIFNDHSSYS--SKTTNGANSSTGESNSDTKLNDEDFVESG 213
                       KF+ F +  ++N +  Y   ++  +G ++S   + S   +  E+ +   
Sbjct: 95   -----------KFEGF-EYFVYNRNGVYDRIARELDGEDTSAEPTVSVPSV--EEVI--- 137

Query: 214  YSSQSTYNQNNDRIFDQAKSDKDSLFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGT 273
                             A+   D L  +  PVE   ++ ++  GNK T S+ I++ E   
Sbjct: 138  -----------------AELQDDPLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLA 180

Query: 274  GIIDYCQPKEKLDLYKMKLAIETHNFAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTP 333
            G +    P +       +   +  N  V +KPNI Y+ +  +K  ++  + +RLWK++  
Sbjct: 181  GTVSIEVPDDTRAPSSFRTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKT 240

Query: 334  ITGIITRPLGLTQRKKKRNEPPDLFIQKWQGLSLYKGTIFEPTTDDLDD-IQFDFLNHEY 392
            + G +       +RKK++++ P  +   W+GLS+Y   + E    +LD+ ++FD  +HEY
Sbjct: 241  LLGTVLEATLHAKRKKEQHQTPKWY-DNWRGLSMYDVNLDE----ELDEEVKFDIEHHEY 295

Query: 393  AKFSSVVKCPKAIFTYEYDIPGC--VPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGG 450
            AK ++V+K  +   TY Y +PG   V    +  N  ++ P++        HS+DI ++  
Sbjct: 296  AKCTTVLKADQMDVTYSYGMPGTARVTDSDNAENPLLERPELD-------HSVDILVYDA 348

Query: 451  SICYGPWTQRQMNFIHSMLAPAVSRTESPVKRRVPGSTRIYT---ATKLSISIMDDTTWR 507
            +  YGPW  RQ+     + +P V R     K R P      T   A KLS++IM+D+  R
Sbjct: 349  NCTYGPWANRQVQQCLRVFSPTVCRN---FKLRTPEEIAQQTEPAAFKLSVTIMEDSVLR 405

Query: 508  IATREPSKDNIFLKHYKETNDDYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHL 567
            +  +E SKD  FL+ YK+T D+ RPFGWID+R +KES      A  PT  GF+N ++ +L
Sbjct: 406  VPMKESSKDAAFLEKYKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANL 465

Query: 568  AQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIA 627
                I +SVNHD L+K K  D  +D SYP  W D+A W  ++ S Q E F+LR+H+ LI+
Sbjct: 466  VDTTISTSVNHDTLLKAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLIS 525

Query: 628  DTLTDFTSGEPTPYELFRPSETFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGD 687
            D +TDF+ GE   YE FRP +    W +  Y  YLNVND NI+NNP+DF ENCYLS+HGD
Sbjct: 526  DLVTDFSGGEEVLYEQFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGD 585

Query: 688  DLLINVTIPSEDITAQFNEITYNITTPMFRXXXXXXXXXXXXEFMKYKEVGRSYDFSAKG 747
            D  I  ++P   I  ++  + +NI TP F             E + YKE+GRS +F+ KG
Sbjct: 586  DAEITFSLPITSIIQKYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKG 645

Query: 748  SYLLYSELDVDNVDTISIICESRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTG- 806
            SY  YSE+DVDNVD ++I CE+    + CYG +++ + NVK+NYFG+  +F T+EEY   
Sbjct: 646  SYTSYSEVDVDNVDALNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEE 705

Query: 807  -ITRXXXXXXXXXXXXXXXXXDNGDVYSDGESGMDDAISQEIPERTTLKRSDLRRTANET 865
               R                  + DV +   + + DA         T+K+S L+R+ NE 
Sbjct: 706  LQRRNKQNPSTCRPFNSDGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINEL 765

Query: 866  DLFLTFSVWDGAIILPETIYNCDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTE 925
            D++ TF    G    PE IY  D C    F  L   LR  NYY+D   SL+    +R+T+
Sbjct: 766  DVWFTFISKGGCFFFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTD 825

Query: 926  KSPIDIFKSVLHDNRESSEAQGFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSE 985
                 +FK +         +  +LS  S   H+M G+ P+E +Y C++D  +  L+V+ +
Sbjct: 826  IDARTLFKVIEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCD 885

Query: 986  FDFLKGFLTSFSRIGFGFKDLENILLYSKEVINDMTSLTVNAQEISVNLKN--EVSGIDM 1043
               LK F+ +   + FGFKD+EN L Y +E + D+  ++   + ++V L+N  +   I +
Sbjct: 886  LAVLKAFVNTLRNLAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWL 945

Query: 1044 ALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQ 1103
            +L       TS D  +  YS R DL IP L   +Y    D +   L  F+T V +T F +
Sbjct: 946  SLNLPVTTLTSFDLANERYSRRSDLSIPELLFGIY--RGDSESTCLGAFSTGVTVTLFER 1003

Query: 1104 KKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPIL 1163
             + F R R +QR +I +NDA FHR SF+LP  ++K  +Y  LYG I PSSSLP+   PI 
Sbjct: 1004 FEQFARCRVLQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPIS 1063

Query: 1164 PKTVDFILEDFLGEYVSLLDDRTIFRMPFGSTNTPNQASTHHEEDMDPLEFSNSTVSTEK 1223
                + I E  LGE        + +++   S ++  +   H++     +  S+S     +
Sbjct: 1064 ADNFEVIFEKLLGEIYQEYASDSSYQITDDSISS-TEHDYHNQTVNAAIGTSSSLFIRSQ 1122

Query: 1224 NYQ--CDNLVIDIEYISVEINPSISTYIESLSSTVYEENIVQVIDDIEIETI-KILSTFQ 1280
            N+Q    + +++ + I   ++ S + ++  +   + E ++ + ID +EI  I + + TF 
Sbjct: 1123 NHQQTLSSFIVEFDPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFG 1182

Query: 1281 E--GTSSITNIKLRVLYSDIYWGERDR------YGIELYLDKLD----FEMSQRNIEKDR 1328
            E  G S +     RVL  +I     ++      + +   +  LD     + S  N++ D 
Sbjct: 1183 EDNGISEV-----RVLCPNISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDP 1237

Query: 1329 EKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGCELWSATAEKQVNXXXXX 1388
            EK     T+  K   IRA+I ++G     K+     S  +E  E + +  +  +      
Sbjct: 1238 EK----TTLCYKIDYIRANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQ 1293

Query: 1389 XXXXXXXXXQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQIS 1448
                       + LF F+N        +   L+S +     S+R+ +  +      Y+I 
Sbjct: 1294 SCSVTLSPGTDKLLFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQ 1353

Query: 1449 HDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQD 1508
            HDP VITKPA ITR S  H+R   SW+II RLRHIL Y+P +W      +L  +     +
Sbjct: 1354 HDPPVITKPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPE 1413

Query: 1509 EAKKVFMSVFSNWRNWEFSDVARSYIYGRLF 1539
            EA K F+S+FS+WR+WE +DV  S+++ ++F
Sbjct: 1414 EAGKEFLSIFSDWRSWEPTDVQGSFVHEKVF 1444

 Score =  591 bits (1523), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 396/1260 (31%), Positives = 632/1260 (50%), Gaps = 59/1260 (4%)

Query: 1750 FHI-KSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEG--ENKSPKKKLKDVEIEVVC 1806
            FHI  S A T  L  S+  +   +K + + L + +  AE   E +S   K+  V  +   
Sbjct: 1652 FHIDSSSATTKDLTESLPYVRDEIKYLVEAL-VPELFAEPPIERESSGNKIHAVLFQ--G 1708

Query: 1807 QLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQ--YFR 1864
            Q++N++ ++  +SPF I +  + F+L+ +   + +V+ D+   + ++     KQ+  YF+
Sbjct: 1709 QVANITLKLQILSPFIILYCAENFELQAE--STDSVIFDLNSGESYMEISSAKQKLDYFK 1766

Query: 1865 ISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASESXXXXXXX 1924
             +    +++        +    +    ++KL+  +    ++  LQD + A  S       
Sbjct: 1767 YTHTCLKLSGTSSSAR-LFEHISCDIGILKLSVFDLKTRITDLLQDIKAALFSMKSLSDI 1825

Query: 1925 XXXXXXQTEGRLQPATTKEMRWL------LDTDIKYFGILVPISTTYFVFETHALVLSMS 1978
                      +  P  +    W       L     Y G+L+    T ++ E +      +
Sbjct: 1826 LNI------SQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKHT 1879

Query: 1979 -DIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQ 2037
             D   +  T +   +   SIE+  FLIKDR I   L++++DF+++F+ +        S Q
Sbjct: 1880 RDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQ 1939

Query: 2038 VESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIXXXXXXXXXXXXXXIGM 2097
            +ES H +I L+P ++VRL+    +F  +   + E+                        +
Sbjct: 1940 IESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSVWRL 1999

Query: 2098 NMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVAR-GA 2156
             + S H+LS++F I W+F   N+SA G++ G+ RLFS YE  YGKLTL++A+FS A+  A
Sbjct: 2000 IIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILA 2059

Query: 2157 TSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIE 2216
            + A FY      + +N SYL +MQ+ YW  +     D+FIR HG  L V      +T++E
Sbjct: 2060 SEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVTLLE 2119

Query: 2217 SMLQSFQVFQELKTSLIQPXXXXXXXXXXPKIKSLAPF------LSNIKSVNCQFKYDGG 2270
              +QS Q F  LK +L+ P           K     P+       + ++S+NC   Y G 
Sbjct: 2120 ETIQSIQTFNNLKKALVDPFRTKKQDSDISK----EPYNWNNQLATGVRSLNCIINYAGV 2175

Query: 2271 VFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAVC 2330
              K+ S  D      P  EL +P   +  +YK+     K H  R L+    THNT ++  
Sbjct: 2176 TLKLHS-HDGRGDASP-LELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFYSTS 2233

Query: 2331 APLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQK 2390
            A LI +      +++K  S+  K  S A+  S    +  D   LL   D+   L   +Q+
Sbjct: 2234 AFLIHDLCYRFSKLLKTSSTENKSSS-ASTSSSIKVEGSDNSTLLGSIDLVIILNVGKQE 2292

Query: 2391 LSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSKETSTSF 2450
            ++ SCEPKAKVQA VGF+ F I I  NN+++ E L  ++ I+    + +HI+S+E   S 
Sbjct: 2293 VTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCLAIEIENLMTNSRHIYSREVCASL 2352

Query: 2451 GLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGK 2510
             L  I + F      +  +YG+ LIS    YFN+KQLQ+L LFID W    F +  P   
Sbjct: 2353 KLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQW----FPQKTPM-- 2406

Query: 2511 SNNGKRENKHL----TLPQPSNLY-----GEIPWSFTLIFTNINGSADLGPSLGVLSLKL 2561
             N G      L    +    S  Y         W +++I        +LGPSLGVL++  
Sbjct: 2407 -NTGSYPEGVLVDDISRSIGSKFYKGSSSSSFTWGYSVIVAGSCAEIELGPSLGVLNVTS 2465

Query: 2562 KRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPL 2621
            +  W  S    D  Q +      L   S GRL G F +  A    E+ WP  K     PL
Sbjct: 2466 EDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPL 2525

Query: 2622 VNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICS 2681
            V V +  D +  K +FDYH F I ++     SL +E+D  G++ DLL V  + E +NI  
Sbjct: 2526 VCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFL 2585

Query: 2682 TALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVS 2741
            TAL AANI D+ N++ R+++DN++ YL +   SD  +    P+    I  +L+LL+T +S
Sbjct: 2586 TALAAANISDIKNSITRLKKDNELSYLSSFLASD--QPSDEPEEDGGIFDTLSLLRTQLS 2643

Query: 2742 TNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKR 2801
             N+ V +LQ+SP +LFD +VL++    + A  G  A  K+KT L  ++ D  +AL     
Sbjct: 2644 LNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNN 2703

Query: 2802 EIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKI 2861
             +DE  ++ + V  Y+E +S I GG I   P + + MT+WQE  S+++E LY  +F   +
Sbjct: 2704 SLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTV 2763

Query: 2862 AVKWNLGPVNFIKEMWTTHVKALAVRRS--QNVLDTDMQTDEEVQKRIKEEENI-SKLKY 2918
             ++WNLGP++FIK+MW  H+ A+ +R      + ++ +       K +  E ++ S  +Y
Sbjct: 2764 KIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQY 2823

Query: 2919 VPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLL 2978
            +P++EP I+MP+I+DLGDATPP+EWFGVNR + P FTHQ V+VP+QKL   AEK+Y  +L
Sbjct: 2824 LPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKIL 2883

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 25/61 (40%), Positives = 32/61 (52%)

Query: 4  SSEFQSVPISGGKNFSWXXXXXXXXXXXXXXSVIFYVGRAIAYITSLILEWLLWKRAHIK 63
          SSEF+ VPIS  ++FSW                 FY GR + Y  + ILE+L WKR  +K
Sbjct: 2  SSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVK 61

Query: 64 V 64
          V
Sbjct: 62 V 62

>Kpol_541.6 s541 (15728..20554) [4827 bp, 1608 aa] {ON} (15728..20554)
            [4827 nt, 1609 aa]
          Length = 1608

 Score = 37.0 bits (84), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 51/111 (45%), Gaps = 28/111 (25%)

Query: 2661 VGTMPDLLKVNF------------TCEMINIC----------STALVAANILDLYNTVMR 2698
            +G + +LLKVNF            +CE + +C          S ++    + D+ N +M 
Sbjct: 1181 IGLVKELLKVNFEETINSPLLAQISCERLELCFYLLFSLEKASVSIDEKTLSDILNQLML 1240

Query: 2699 MRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKL 2749
            + + N + +L+ +  S       N + YR ILRS+ ++   V T  H +++
Sbjct: 1241 LFKSNDVSFLDNISRS------SNSNVYRPILRSILIILGMVKTKTHFIEM 1285

>ZYRO0B11638g Chr2 (913485..917921) [4437 bp, 1478 aa] {ON} similar
           to uniprot|P32657 Saccharomyces cerevisiae YER164W CHD1
           Sole S. cerevisiae member of CHD gene family containing
           Chromodomain Helicase domain and DNA-binding domain
           transcriptional regulator
          Length = 1478

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%)

Query: 191 ANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFLQTFPVEIEVH 250
           +N ++   N +   +DED +ES    ++  N NND I D+  SD + ++  T P   +  
Sbjct: 126 SNRTSKAVNYNIDYSDEDLLESDDGGRAKANTNNDEIDDEMNSDDEQMYYSTTPQAADED 185

Query: 251 RA 252
           R 
Sbjct: 186 RG 187

>KLTH0H00572g Chr8 complement(60065..61960) [1896 bp, 631 aa] {ON}
            similar to uniprot|P38862 Saccharomyces cerevisiae
            YHR171W ATG7 Autophagy-related protein that is a member
            of the E1 family of ubiquitin-activating enzymes mediates
            the conjugation of Atg12p with Atg5p a required step in
            the formation of autophagosomes
          Length = 631

 Score = 33.9 bits (76), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 8/99 (8%)

Query: 2322 THNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLD---GF 2378
            T N+     A   A+ L  I  +V+          I   ++    QN DYKRLL+     
Sbjct: 365  TFNSCGKPKAAAAADSLREIFPLVEAEGVELAVPMIGHPITSESKQNEDYKRLLELIKAH 424

Query: 2379 DIAFKLTSSEQKLSLS-----CEPKAKVQADVGFDSFII 2412
            D+ F L  S +   L       E K  + A +GFDS+++
Sbjct: 425  DVVFLLMDSRETRWLPTVMGYAEDKIVINAALGFDSYLV 463

>TBLA0E01290 Chr5 complement(282103..284622) [2520 bp, 839 aa] {ON}
            Anc_4.134 YLR318W
          Length = 839

 Score = 33.9 bits (76), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 68/142 (47%), Gaps = 17/142 (11%)

Query: 2785 LELEVYDGYVALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEE 2844
            L L + D ++ +ST+K++I+E  ++ ++   +MEY + +    I     LN++   + E 
Sbjct: 633  LLLRIADDFLVMSTNKKQIEE--INQVAREGFMEYNASVKLEKI-----LNLSSQEYAET 685

Query: 2845 NSDILEYLYK------CTFED-KIAVKWNLGPVN--FIKEMWTTHVKALAVRRSQNVLDT 2895
            N D   + +       C     K +   N+  VN   IK ++        +R S N L+ 
Sbjct: 686  NKDTTIFQFCGLNINFCNLNVWKESTSLNILQVNSSSIKTIYKRLKWIFQIRLSYNTLNM 745

Query: 2896 DMQTDEEVQKRIK-EEENISKL 2916
            ++  ++ +  +IK   ENISK+
Sbjct: 746  EINNNDTICLQIKIIIENISKI 767

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 314,606,218
Number of extensions: 14380052
Number of successful extensions: 47897
Number of sequences better than 10.0: 80
Number of HSP's gapped: 48647
Number of HSP's successfully gapped: 92
Length of query: 2982
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2854
Effective length of database: 38,804,151
Effective search space: 110747046954
Effective search space used: 110747046954
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)