Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B027108.259ON1416141668350.0
Suva_10.1708.259ON1416143938720.0
YLR086W (SMC4)8.259ON1418143737980.0
Smik_12.1458.259ON1418144137900.0
Skud_12.1548.259ON1417144237780.0
NCAS0B050008.259ON1409143237690.0
TDEL0F038608.259ON1399142337320.0
Kpol_392.88.259ON1427144436230.0
ZYRO0C01716g8.259ON1413142535730.0
KNAG0G020208.259ON1444144935620.0
SAKL0H17094g8.259ON1422144335570.0
NDAI0B019708.259ON1415143235440.0
KLTH0G13750g8.259ON1399141834700.0
Ecym_43118.259ON1376137634010.0
AGR089C8.259ON1370138033840.0
Kwal_56.238258.259ON1396142933480.0
TPHA0J007208.259ON1393143132140.0
TBLA0E044108.259ON1422138831790.0
KLLA0F19085g8.259ON1372138030670.0
CAGL0L12188g8.259ON1398142030050.0
NCAS0C040008.68ON122313276573e-69
TPHA0P003408.68ON12197764441e-43
NDAI0G033208.68ON12317013762e-35
KLTH0A02706g8.68ON12281703682e-34
Kwal_23.50438.68ON12251753637e-34
YFL008W (SMC1)8.68ON12254503611e-33
SAKL0B02288g8.68ON12281643531e-32
Suva_6.528.68ON12641623521e-32
Skud_6.648.68ON12301623502e-32
KAFR0C032008.68ON12231533493e-32
Ecym_73038.68ON12227103484e-32
Smik_6.718.68ON12281533467e-32
KNAG0G009108.68ON12261533467e-32
TDEL0C009608.68ON12224703412e-31
Kpol_1011.58.68ON12211523378e-31
SAKL0F07282g7.186ON11708723342e-30
TBLA0G035308.68ON12321693288e-30
KLLA0D07502g8.68ON12431513252e-29
ZYRO0F03828g8.68ON12171533224e-29
AGL023W8.68ON12221523073e-27
KAFR0G029307.186ON11707482974e-26
Skud_6.1197.186ON11707252742e-23
KLTH0E04774g7.186ON11707322705e-23
ZYRO0D15642g7.186ON117010432706e-23
Kwal_55.204217.186ON11707162643e-22
NDAI0G020707.186ON11713812591e-21
TDEL0H026107.186ON11703282511e-20
AGR236W7.186ON11702942501e-20
Ecym_43907.186ON11702952501e-20
CAGL0D05258g7.186ON11703312455e-20
KLLA0D16005g7.186ON11707012367e-19
YJL074C (SMC3)1.295ON12307252331e-18
Kpol_1063.207.186ON11711862232e-17
TBLA0D046107.186ON11741832223e-17
YFR031C (SMC2)7.186ON11701842204e-17
Smik_7.3467.186ON11701842205e-17
TPHA0C044407.186ON11701862189e-17
Kwal_14.24351.295ON12472222125e-16
Suva_6.1047.186ON1170732043e-15
Kpol_1018.21.295ON12111812044e-15
ZYRO0G21296g1.295ON1227992044e-15
SAKL0D06116g1.295ON12291142034e-15
KAFR0A016101.295ON1227992035e-15
NCAS0E019207.186ON1170792026e-15
KNAG0L011607.186ON1170732001e-14
KLTH0H09966g1.295ON1224971964e-14
NCAS0A093301.295ON12271251937e-14
KNAG0B052301.295ON1225981937e-14
TDEL0D016201.295ON1223951902e-13
NDAI0G056301.295ON1229951892e-13
Smik_10.1671.295ON12291951874e-13
Suva_6.1491.295ON12301961856e-13
TPHA0I010901.295ON12161891856e-13
TBLA0C027401.295ON11191621839e-13
CAGL0H02805g1.295ON1219961802e-12
Ecym_63221.295ON12321001802e-12
CAGL0F02079g8.68ON12231291775e-12
AAL182W1.295ON12311021759e-12
Skud_10.1701.295ON1230951741e-11
KLLA0A00286g1.295ON1224971651e-10
NCAS0I005707.101ON10952401302e-06
KLTH0D02816g7.101ON10941621283e-06
SAKL0B09526g7.101ON10993541221e-05
ZYRO0G01584g7.101ON10883551176e-05
AEL337C7.101ON10972831169e-05
Kwal_26.72047.101ON11173201132e-04
KNAG0L006307.101ON11081601132e-04
TDEL0E013404.237ON1106851113e-04
Skud_15.1217.101ON10931621104e-04
Suva_15.1337.101ON10921851087e-04
AER045C4.238ON12923381070.001
TBLA0E021907.101ON10893561060.001
KAFR0D013307.101ON10801821040.002
YOL034W (SMC5)7.101ON10931621030.002
ZYRO0B12122g4.237ON1109781030.003
KLLA0F07997g7.101ON11194111010.004
Smik_15.1317.101ON10931571010.004
Ecym_26257.101ON10971421000.005
TDEL0H034907.101ON110398970.012
NCAS0J013904.237ON109668970.013
TPHA0B008404.237ON111968960.016
CAGL0H05071g4.237ON111076960.016
Skud_12.4684.237ON112068960.017
NDAI0A084507.101ON1119234960.017
YLR383W (SMC6)4.237ON111468960.018
Smik_12.4704.237ON111468960.018
Suva_10.5004.237ON111568960.019
NDAI0J021804.237ON110868960.020
Kpol_483.104.237ON111892950.020
KNAG0B060104.237ON111768950.026
Kpol_1044.137.101ON110362950.026
CAGL0F01155g7.101ON1105318940.028
TPHA0L006007.101ON111762940.030
Ecym_53444.237ON110254930.041
TBLA0A053001.67ON70763920.052
TBLA0I028904.237ON1098126920.053
KLLA0E05303g4.237ON109870910.061
AER044W4.237ON110353900.097
SAKL0H03322g4.237ON111166870.19
KLTH0D14102g4.238ON1712104870.19
Kwal_26.93804.237ON110285850.35
SAKL0E12716g2.81ON92197840.42
NCAS0B087001.67ON71572840.44
KLTH0D14080g4.237ON110278830.55
TDEL0G028102.351ON109471830.59
KAFR0A060404.237ON110268830.62
CAGL0D00924g4.238ON1980201830.68
Kpol_483.114.238ON2546188820.81
Kwal_33.149482.618ON885184810.98
Skud_10.3574.364ON70586772.5
KLLA0F00770g8.604ON628191772.5
CAGL0L05610g1.227ON53183772.9
TPHA0B028902.159ON63484754.1
ZYRO0F09570g5.414ON835205755.0
AFR683C1.67ON677108746.6
NDAI0J008308.351ON708193738.4
Kpol_505.363.476ON39670728.7
NCAS0J022004.364ON70798738.9
Ecym_31735.296ON839110739.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B02710
         (1416 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  2637   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1496   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1467   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1464   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1459   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1456   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1442   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1400   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1380   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1376   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1374   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1369   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1341   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1314   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1308   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1294   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1242   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1229   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1186   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1162   0.0  
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   257   3e-69
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   175   1e-43
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             149   2e-35
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   146   2e-34
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   144   7e-34
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   143   1e-33
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   140   1e-32
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   140   1e-32
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   139   2e-32
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   139   3e-32
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   138   4e-32
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   137   7e-32
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   137   7e-32
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   135   2e-31
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   134   8e-31
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...   133   2e-30
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   130   8e-30
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   129   2e-29
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   128   4e-29
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   122   3e-27
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   119   4e-26
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...   110   2e-23
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...   108   5e-23
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   108   6e-23
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...   106   3e-22
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....   104   1e-21
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....   101   1e-20
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   100   1e-20
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...   100   1e-20
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    99   5e-20
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    96   7e-19
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    94   1e-18
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    91   2e-17
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    90   3e-17
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    89   4e-17
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    89   5e-17
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    89   9e-17
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    86   5e-16
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    83   3e-15
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    83   4e-15
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    83   4e-15
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    83   4e-15
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    83   5e-15
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    82   6e-15
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    82   1e-14
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    80   4e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    79   7e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    79   7e-14
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    78   2e-13
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    77   2e-13
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    77   4e-13
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    76   6e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    76   6e-13
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    75   9e-13
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    74   2e-12
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    74   2e-12
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...    73   5e-12
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    72   9e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    72   1e-11
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    68   1e-10
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    55   2e-06
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    54   3e-06
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    52   1e-05
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    50   6e-05
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    49   9e-05
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    48   2e-04
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    48   2e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    47   3e-04
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    47   4e-04
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    46   7e-04
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    46   0.001
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    45   0.001
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    45   0.002
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    44   0.002
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.003
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    44   0.004
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    44   0.004
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    43   0.005
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    42   0.012
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.013
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.016
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    42   0.016
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.017
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    42   0.017
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    42   0.018
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    42   0.018
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.019
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    42   0.020
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    41   0.020
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    41   0.026
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    41   0.026
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    41   0.028
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    41   0.030
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    40   0.041
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    40   0.052
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    40   0.053
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.061
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    39   0.097
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.19 
KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa...    38   0.19 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    37   0.35 
SAKL0E12716g Chr5 (1049450..1052215) [2766 bp, 921 aa] {ON} some...    37   0.42 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    37   0.44 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    37   0.55 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    37   0.59 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    37   0.62 
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    37   0.68 
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    36   0.81 
Kwal_33.14948 s33 (883559..886216) [2658 bp, 885 aa] {ON} YKL073...    36   0.98 
Skud_10.357 Chr10 complement(632324..634441) [2118 bp, 705 aa] {...    34   2.5  
KLLA0F00770g Chr6 (65967..67853) [1887 bp, 628 aa] {ON} some sim...    34   2.5  
CAGL0L05610g Chr12 (609615..611210) [1596 bp, 531 aa] {ON} simil...    34   2.9  
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    33   4.1  
ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} simila...    33   5.0  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...    33   6.6  
NDAI0J00830 Chr10 (185771..185801,185919..188014) [2127 bp, 708 ...    33   8.4  
Kpol_505.36 s505 (83512..84702) [1191 bp, 396 aa] {ON} (83512..8...    32   8.7  
NCAS0J02200 Chr10 complement(425055..427178) [2124 bp, 707 aa] {...    33   8.9  
Ecym_3173 Chr3 complement(327173..329692) [2520 bp, 839 aa] {ON}...    33   9.3  

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 2637 bits (6835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1317/1416 (93%), Positives = 1317/1416 (93%)

Query: 1    MSHTPLSKKQKVVSDEERITPNQNEQDNDKTHPEVTASSFLKSHTPRKLLLGSADNKYXX 60
            MSHTPLSKKQKVVSDEERITPNQNEQDNDKTHPEVTASSFLKSHTPRKLLLGSADNKY  
Sbjct: 1    MSHTPLSKKQKVVSDEERITPNQNEQDNDKTHPEVTASSFLKSHTPRKLLLGSADNKYVL 60

Query: 61   XXXXXXXXXXXXXXXXXXNLQPPLSQPSRGRDKKAYXXXXXXXXXXXXXXKLELIQLSPI 120
                              NLQPPLSQPSRGRDKKAY              KLELIQLSPI
Sbjct: 61   SQPIISSSSHGSSSLQVPNLQPPLSQPSRGRDKKAYSQSPPRSPGRSPVRKLELIQLSPI 120

Query: 121  KNNRIELQKLYNSKNQNKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSN 180
            KNNRIELQKLYNSKNQNKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSN
Sbjct: 121  KNNRIELQKLYNSKNQNKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSN 180

Query: 181  VIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDR 240
            VIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDR
Sbjct: 181  VIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDR 240

Query: 241  KPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA 300
            KPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA
Sbjct: 241  KPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA 300

Query: 301  KAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLES 360
            KAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLES
Sbjct: 301  KAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLES 360

Query: 361  DKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQS 420
            DKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQS
Sbjct: 361  DKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQS 420

Query: 421  EIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHD 480
            EIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHD
Sbjct: 421  EIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHD 480

Query: 481  KRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXXXXXQISL 540
            KRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKER                   QISL
Sbjct: 481  KRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDDIKLSLKDKTKDISSQISL 540

Query: 541  YEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSI 600
            YEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSI
Sbjct: 541  YEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSI 600

Query: 601  IENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTVL 660
            IENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTVL
Sbjct: 601  IENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTVL 660

Query: 661  SALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQCIEYLRK 720
            SALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQCIEYLRK
Sbjct: 661  SALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQCIEYLRK 720

Query: 721  NKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIR 780
            NKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIR
Sbjct: 721  NKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIR 780

Query: 781  QANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGDVEK 840
            QANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGDVEK
Sbjct: 781  QANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGDVEK 840

Query: 841  IERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSXXXXXXXXXXX 900
            IERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDS           
Sbjct: 841  IERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSLNDQLNLKEQQ 900

Query: 901  XXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIGGKE 960
                   YTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIGGKE
Sbjct: 901  LKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIGGKE 960

Query: 961  LQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDLETL 1020
            LQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDLETL
Sbjct: 961  LQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDLETL 1020

Query: 1021 QTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIKNKL 1080
            QTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIKNKL
Sbjct: 1021 QTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIKNKL 1080

Query: 1081 EKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNSVGVKQSSNNLDVSSSH 1140
            EKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNSVGVKQSSNNLDVSSSH
Sbjct: 1081 EKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNSVGVKQSSNNLDVSSSH 1140

Query: 1141 TPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVSKGIPXXXXXXXXXXXX 1200
            TPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVSKGIP            
Sbjct: 1141 TPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVSKGIPKLTDDDLKSIDL 1200

Query: 1201 XXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRKLDLNTTVARRDEVRDELEKLKK 1260
               ESEINQLQDYVENSNAD             FKKRKLDLNTTVARRDEVRDELEKLKK
Sbjct: 1201 DSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKLDLNTTVARRDEVRDELEKLKK 1260

Query: 1261 TRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1320
            TRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT
Sbjct: 1261 TRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1320

Query: 1321 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1380
            NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI
Sbjct: 1321 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1380

Query: 1381 SLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILNC 1416
            SLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILNC
Sbjct: 1381 SLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILNC 1416

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1496 bits (3872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 798/1439 (55%), Positives = 1008/1439 (70%), Gaps = 49/1439 (3%)

Query: 1    MSHTPLSKKQKVVSDEE---RITPNQNEQD------NDKTH----PEVTA--SSFLKSHT 45
            M  +PLSK+QK  + EE    I     EQ+      ND+T     P+  +  SS+ KSHT
Sbjct: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60

Query: 46   PRKLLLGSADNKYXXXXXXXXXXXXXXXXXXXXNLQPPLSQPSRGRDKKAYXXXXXXXXX 105
            PRKL+L S +N+Y                    NLQPP   PSRGRD KAY         
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVP----NLQPP-EAPSRGRDYKAYSQSPPRSPG 115

Query: 106  XXXXXKLELIQLSPIKNNRIELQKLYNS---KNQNKVRLYIDKLVLQDFKSYAGTQIVGP 162
                 +LEL+QLSP+KN+RIELQKLY+S     + + RL+IDKLVL++FKSYAG Q+VGP
Sbjct: 116  RSPTRRLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGP 175

Query: 163  FNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVH 222
            F+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSE FPN+QSCSV VH
Sbjct: 176  FHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVH 235

Query: 223  FQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDH 282
            F+YV+DE  GTS+I E++  LV+ RKAF+NNSSKYYINGKESNYT+VT+LLK EGIDLDH
Sbjct: 236  FEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDH 295

Query: 283  KRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICV 342
            KRFLILQGEVENIAQMK+KAEKE DDGLLEYLEDIIGT+ YK LIED++ +IE LNEIC+
Sbjct: 296  KRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICL 355

Query: 343  EKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKIS 402
            EKE RFEIV  EKNSLES K+ ALEF+ KEKQLTLL+SKL Q+KL Q+N+KLA+TL+K S
Sbjct: 356  EKENRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTS 415

Query: 403  NFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEE 462
            +     + E+ K+++   E+D+   + +E  +++++  +QE+ L  +KRE +   VS+EE
Sbjct: 416  SLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEE 475

Query: 463  RIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXX 522
            R KNL  K  KAEK L      I + E +L++L   Q  +++E  +L + L++ER     
Sbjct: 476  RTKNLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDD 535

Query: 523  XXXXXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGS 582
                          +I  +EKD+EPW  ++QEK+ QIQLAESE+SLL+E+Q KLK+   +
Sbjct: 536  IKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEA 595

Query: 583  LKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQR 642
            L+  I   +         I +LKK   SL    S GE + S A  K KEM+ ILN+HRQR
Sbjct: 596  LEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQR 655

Query: 643  AIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDD 702
            A++ARS+L  AENKS VL+AL+RLQKSGRINGFHGRLGDLGVI D +D+AISTAC RLDD
Sbjct: 656  AMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDD 715

Query: 703  IVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKF 762
            +VVD+VEC Q CI+YLRKNKLGYARFILLD+LR F L  + TPENV RLFDLV+P D KF
Sbjct: 716  VVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKF 775

Query: 763  SNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKL 822
            SNAFYSVLRDTLVA D++QAN VAYGKRR+RVVT+DGKLIDISGTM+GGG+HV KGLM++
Sbjct: 776  SNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRI 835

Query: 823  KNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAK 882
              +  + ++ Y   +V KIE +L+ERE NF++A+DT+ EM  ELK+++D+EP++E +I +
Sbjct: 836  GKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILR 895

Query: 883  LLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSK 942
              M+ DS                  Y   +N    L++    L+ LR E+  L+ ++++K
Sbjct: 896  AEMEADSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTK 955

Query: 943  KEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRL 1002
            KE+I  L+++IMKIGG  LQIQNSKV SL++RI I+ AK KK K+ IK++  ++ K Q+ 
Sbjct: 956  KERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQ 1015

Query: 1003 FKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDM 1062
             K  E D     N+L+ ++     I+  L + + +   ILN K DL  Q E LKEK+ +M
Sbjct: 1016 LKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEM 1075

Query: 1063 EESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENAN 1122
            E  ++E+KS E+E+KNKLEKLNSLL Y K DI+   +EL    +RDVT +L  + N    
Sbjct: 1076 EGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDN---- 1131

Query: 1123 NSVGVKQSSNNLDVSSSHTPNVDKHDD---EISMEDADNDSQNEIEEKEQDAD---IMDL 1176
                     N +D+       +DK  +   E + ED   +++ E + +E D D    M++
Sbjct: 1132 ---------NQMDI-------LDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNI 1175

Query: 1177 DNVTEEVSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKK 1236
            D  ++EVS+GIP               E +I +L  Y++ +N D             FK+
Sbjct: 1176 DETSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKR 1235

Query: 1237 RKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVD 1296
            RKLDLN  V +RDEV+++LE LKK R DEFM GF+IIS+TLKEMYQMITMGGNAELELVD
Sbjct: 1236 RKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVD 1295

Query: 1297 SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1356
            SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL
Sbjct: 1296 SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1355

Query: 1357 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415
            DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YKR N T+S T+KN DILN
Sbjct: 1356 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1467 bits (3798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 794/1437 (55%), Positives = 1028/1437 (71%), Gaps = 43/1437 (2%)

Query: 1    MSHTPLSKKQKVVSDEE-RITPNQNEQDNDK------------THPEVTA--SSFLKSHT 45
            MS +PLSK+QK  S +E  ++ +Q + + D               P++ A  +S+ KS+T
Sbjct: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60

Query: 46   PRKLLLGSADNKYXXXXXXXXXXXXXXXXXXXXNLQPPLSQPSRGRDKKAYXXXXXXXXX 105
            PRKL+L S +N+Y                    NLQPP +  SRGRD K+Y         
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVP----NLQPPKTS-SRGRDHKSYSQSPPRSPG 115

Query: 106  XXXXXKLELIQLSPIKNNRIELQKLYN---SKNQNKVRLYIDKLVLQDFKSYAGTQIVGP 162
                 +LEL+QLSP+KN+R+ELQK+Y+   S ++ + RL+I++LVL++FKSYAG Q+VGP
Sbjct: 116  RSPTRRLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGP 175

Query: 163  FNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVH 222
            F+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSEAFP++QSCSV VH
Sbjct: 176  FHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVH 235

Query: 223  FQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDH 282
            FQYVIDE+ GTS+I E++  L++ RKAFKNNSSKYYIN KES+YTEVT+LLK EGIDLDH
Sbjct: 236  FQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDH 295

Query: 283  KRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICV 342
            KRFLILQGEVENIAQMK KAEKE DDGLLEYLEDIIGT+ YK LIE++M +IE LNE+C+
Sbjct: 296  KRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCL 355

Query: 343  EKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKIS 402
            EKE RFEIV+ EKNSLES K+ ALEF+ KEKQLTLLRSKL Q+KL Q+N+KLA+TL+KIS
Sbjct: 356  EKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKIS 415

Query: 403  NFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEE 462
            +    L++E+ K+++   ++D+   + +E  ++I++  ++E+ LV ++RE +G  VS+EE
Sbjct: 416  SSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEE 475

Query: 463  RIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXX 522
            R KNL  K  KAEKTL   +  I + E++L++L+  Q  +++E  +L + L+KER     
Sbjct: 476  RTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDD 535

Query: 523  XXXXXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGS 582
                          +I  +EK++EPW  ++QEK+ QIQLAESE+SLL+E+QAKLK+ + +
Sbjct: 536  IKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVET 595

Query: 583  LKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQR 642
            L+ +I   +        +I +LKK+  SLK E S GE   + A  K KEM+ +LN+HRQR
Sbjct: 596  LEEKILAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQR 655

Query: 643  AIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDD 702
            A++ARS+L  A+NKS VL+AL+RLQKSGRINGFHGRLGDLGVI D +D+AISTAC RLDD
Sbjct: 656  AMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDD 715

Query: 703  IVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKF 762
            +VVD+VEC Q CI+YLRKNKLGYARFILLD+LR F L  + TPENV RLFDLV+P + KF
Sbjct: 716  VVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKF 775

Query: 763  SNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKL 822
            SNAFYSVLRDTLVA +++QAN VAYGK+R+RVVT+DGKLIDISGTM+GGG+HV+KGLMKL
Sbjct: 776  SNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKL 835

Query: 823  KNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAK 882
              +  + ++ Y   +V+KIER+L+ERENNF++A DT+ EM  ELK+L+D EP++E +I+K
Sbjct: 836  GTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISK 895

Query: 883  LLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSK 942
              M+ DS                  Y   ++ K  L+     L+ LR E+  L+ ++++K
Sbjct: 896  AEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTK 955

Query: 943  KEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRL 1002
            KEKI  L++EIMKIGG +LQ+QNSKV S+ +++ I+ AK KK K+  K++  ++ K Q+L
Sbjct: 956  KEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKL 1015

Query: 1003 FKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDM 1062
             + +E D     ++L+ ++  +   +  L E +   +  LN K +L  Q E LKE+++DM
Sbjct: 1016 LQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDM 1075

Query: 1063 EESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENAN 1122
            EES+NE+KS EIE+KNKLEKLNSLL Y K +I    + L    +RDVT +L  + +    
Sbjct: 1076 EESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDD---- 1131

Query: 1123 NSVGVKQSSNNLDVSSSHTPNVDKHDDEI-SMEDADNDSQNEIEEKEQDAD---IMDLDN 1178
                     N +D       N  + D E  S E  D   ++EI++ E   D    M++D 
Sbjct: 1132 ---------NKMDSVKEDVKNNQELDQEYRSCETQD---ESEIKDAETSCDNYHPMNIDE 1179

Query: 1179 VTEEVSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRK 1238
             ++EVS+GIP               ES+IN+L  YVE +N D             FK+RK
Sbjct: 1180 TSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRK 1239

Query: 1239 LDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSL 1298
            LDLN  V +RDEV+++L  LKK R DEFM GF+IIS+TLKEMYQMITMGGNAELELVDSL
Sbjct: 1240 LDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSL 1299

Query: 1299 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1358
            DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF
Sbjct: 1300 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1359

Query: 1359 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415
            RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YKR N T+S T+KN DILN
Sbjct: 1360 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1464 bits (3790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 786/1441 (54%), Positives = 1021/1441 (70%), Gaps = 51/1441 (3%)

Query: 1    MSHTPLSKKQKVVSDEERITPNQNEQDNDKTH----------------PEVTA--SSFLK 42
            M  +PLSK+QK  + EE   P  +  D+D T                 P   A  +S+ K
Sbjct: 1    MCDSPLSKRQKRKAVEE---PELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAK 57

Query: 43   SHTPRKLLLGSADNKYXXXXXXXXXXXXXXXXXXXXNLQPPLSQPSRGRDKKAYXXXXXX 102
            SHTPRKL+L S +N+Y                    NLQPP    SRGRD KAY      
Sbjct: 58   SHTPRKLVLSSGENRYAFSQPTNSATTSLHVP----NLQPP-GTSSRGRDYKAYSQSPPR 112

Query: 103  XXXXXXXXKLELIQLSPIKNNRIELQKLYNS---KNQNKVRLYIDKLVLQDFKSYAGTQI 159
                    +LEL+QLSP+KN+R+ELQKLYNS     + + RL+I++LVL++FKSYAG Q+
Sbjct: 113  SPGRSPTRRLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQV 172

Query: 160  VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSV 219
            VGPF+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSEAFPN+QSCSV
Sbjct: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSV 232

Query: 220  EVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGID 279
             VHF+YVIDE+ GTS+I E++  LV+ RKAFKNNSSKYYINGKES+YTEVT+LLK EGID
Sbjct: 233  AVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGID 292

Query: 280  LDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNE 339
            LDHKRFLILQGEVENIAQMK KAEKE DDGLLEYLEDIIGT+ YK LIE++M +IEALNE
Sbjct: 293  LDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNE 352

Query: 340  ICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLD 399
            +C+EKE RFEIV+ EKNSLES K+ ALEF+AKEKQLTLL+SKL Q+K+ Q+N+KLA+TL+
Sbjct: 353  VCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLE 412

Query: 400  KISNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVS 459
            KIS+     + E+ K+++   ++++   + +E  ++I+++ ++E++LV ++RE +G  VS
Sbjct: 413  KISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVS 472

Query: 460  MEERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXX 519
            +EER KNL  K  K+E+T    +  I + E  LK+L   Q  ++SE  +L + L++ER  
Sbjct: 473  LEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSV 532

Query: 520  XXXXXXXXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEG 579
                             +I  +EK++EPW  ++QEK+ QIQLAESE+SLL+E+Q+KLK+ 
Sbjct: 533  LDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKN 592

Query: 580  LGSLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSH 639
            + +++ +I   +        +I NLKK+  SL+ E S GE   S A  K +EM+ +LN+H
Sbjct: 593  VETMEEKILARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTH 652

Query: 640  RQRAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSR 699
            RQRA++ARS+L  A+NKS VL+AL++LQKSGRINGFHGRLGDLG+I + +D+AISTAC R
Sbjct: 653  RQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPR 712

Query: 700  LDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPID 759
            LDD+VVD+VEC QQCI+YLRKNKLGYARFILLD+LR F L  + TPENV RLFDLV+P D
Sbjct: 713  LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKD 772

Query: 760  LKFSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGL 819
             KFSNAFYSVLRDTLVA  ++QAN VAYG++R+RVVT+DGKLIDISGT++GGG+HVSKGL
Sbjct: 773  PKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGL 832

Query: 820  MKLKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELE 879
            M+L  +    ++ Y   +V KIE +L+ERENNF++A+DT+ EM  ELK L+D+EP IE +
Sbjct: 833  MRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESK 892

Query: 880  IAKLLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQS 939
            I+K  M+ DS                  Y + ++ K  ++     L+ L+ EH  L+ ++
Sbjct: 893  ISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSET 952

Query: 940  QSKKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKV 999
            ++KKEKI  L+ EIMKIGG +LQ+QNSKV SL +R+ I+ AK KK K+ IK++E ++ K 
Sbjct: 953  KTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKF 1012

Query: 1000 QRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKI 1059
            Q+  K +E D     N+L+ ++  +   +  L E + +     N + +L  + E LKE +
Sbjct: 1013 QKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELKEESEQLKEMV 1072

Query: 1060 KDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNE 1119
             + EE+++E+KS EIE+KNKLEKLNSLL + KK+I    + L    +RDVT +LE +   
Sbjct: 1073 AETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILD-- 1130

Query: 1120 NANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNE--IEEKEQDAD---IM 1174
              NN++ + ++ N ++ +             +  E   +++Q+E  I+E+E+  D    M
Sbjct: 1131 --NNTMDIVKTDNKIEQA-------------VVKEKRSSETQDEKNIQEEERTCDDHHSM 1175

Query: 1175 DLDNVTEEVSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXF 1234
            D+D  + EV +GIP               E EI++L  Y++ +N D             F
Sbjct: 1176 DIDETSNEVIRGIPRFSEEELKELDIELLEKEISELSYYIDETNVDIGVLEEYARRLAEF 1235

Query: 1235 KKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELEL 1294
            K+RKLDLN  V +RDEV+ ++E LKK R DEFM GF+IIS+TLKEMYQMITMGGNAELEL
Sbjct: 1236 KRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELEL 1295

Query: 1295 VDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1354
            VDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA
Sbjct: 1296 VDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1355

Query: 1355 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDIL 1414
            ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKR N T+S T+KN DIL
Sbjct: 1356 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDIL 1415

Query: 1415 N 1415
            N
Sbjct: 1416 N 1416

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1459 bits (3778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 779/1442 (54%), Positives = 1011/1442 (70%), Gaps = 56/1442 (3%)

Query: 1    MSHTPLSKKQKVVSDEE--------------RI--TPNQNEQDNDKTHPEVTASSFLKSH 44
            M  +PLSKKQK  + EE              R+    N+ E+  D   P +  SS+ +SH
Sbjct: 1    MCDSPLSKKQKRKATEEPELSLNDTDAERESRVENRVNRTEKTPDPNSPSL-ESSYARSH 59

Query: 45   TPRKLLLGSADNKYXXXXXXXXXXXXXXXXXXXXNLQPPLSQPSRGRDKKAYXXXXXXXX 104
            TPRKL+L S +N+Y                    NLQPP    SRGRD KAY        
Sbjct: 60   TPRKLVLSSGENRYAFSQPTNSATTSLHVP----NLQPP-KVSSRGRDYKAYSQSPPRSP 114

Query: 105  XXXXXXKLELIQLSPIKNNRIELQKLYNS---KNQNKVRLYIDKLVLQDFKSYAGTQIVG 161
                  +LEL+QLSP+KN+RIELQKLY+S     + + RL+I+KLVL +FKSYAG Q+VG
Sbjct: 115  GRSPARRLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVG 174

Query: 162  PFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEV 221
            PF+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSEAFP++Q+CSV V
Sbjct: 175  PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAV 234

Query: 222  HFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLD 281
            HF+Y+IDE  GTS+I E++  LV+ R+AFKNNSSKYYIN KES+YTEVT+LLK+EGIDLD
Sbjct: 235  HFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLD 294

Query: 282  HKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEIC 341
            HKRFLILQGEVENIAQMK KAEKE DDGLLEYLEDIIGT+ YK LIE+++ +IE+LNEIC
Sbjct: 295  HKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEIC 354

Query: 342  VEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKI 401
            +EK  RFEIV+ EKNSLES K+ ALEF+ KEKQLTLL+SKL Q+K+ Q+N+KLA+TL+KI
Sbjct: 355  LEKANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKI 414

Query: 402  SNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSME 461
            S+     + E+ K+++   E+D+   + ++  ++I++S ++E+ L  +KRE +G  VS+E
Sbjct: 415  SSLNREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLE 474

Query: 462  ERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXX 521
            ER KNL  K  KAEK L   +  I ++E + ++LQ  Q  ++ E  +L + L++ER    
Sbjct: 475  ERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILD 534

Query: 522  XXXXXXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLG 581
                           +I  +EK+ EPW  ++QEK+ QIQLAESE+SLL+E++AKLK+   
Sbjct: 535  DIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAE 594

Query: 582  SLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQ 641
            +L+ +I   ++       ++ +L +   SL    S GE +   A  K KEM+ ILN+HRQ
Sbjct: 595  ALEEKIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQ 654

Query: 642  RAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLD 701
            RA++ARS+L  A+NK+ VL+AL++LQKSGRINGFHGRLGDLGVI + +D+AISTAC RLD
Sbjct: 655  RAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLD 714

Query: 702  DIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLK 761
            D+VVD+VEC Q CI+YLRKNKLGYARFILLD+LR F L  + TPENV RLFD+V+P D K
Sbjct: 715  DVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPK 774

Query: 762  FSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMK 821
            FSNAFYSVL+DTLVA D++QAN+VAYGKRR+RVVT+DGKLIDISGTM+GGG+HV KGLM+
Sbjct: 775  FSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMR 834

Query: 822  LKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIA 881
            L  +  + +E Y   +V KIE +LAERE NF++A+DT+ EM  ELK+++D+EP++E +I+
Sbjct: 835  LGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQIS 894

Query: 882  KLLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQS 941
            +  M+ DS                  Y   +N+K  ++     L+ LR E+  L+ ++++
Sbjct: 895  RAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRT 954

Query: 942  KKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQR 1001
            KKE+I  L+++IMKIGG +L  QNSKV SL +RI I+  K KK K+ IK++E ++ K Q+
Sbjct: 955  KKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKYQK 1014

Query: 1002 LFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKD 1061
              K  E D     N+L+ ++  +   +  L E +     I N K +L  Q E LKE++ +
Sbjct: 1015 QLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTE 1074

Query: 1062 MEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENA 1121
            MEE+++E+KS EIE+KNKLEKLNSLL + K +I+  ++EL    +RDVT +L+ + N   
Sbjct: 1075 MEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDN--- 1131

Query: 1122 NNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQ-----DAD---- 1172
                      N +DV        D   DE   +DAD D  + I + E+     DAD    
Sbjct: 1132 ----------NQMDVVE------DGIKDE---QDADQDKPSGIPDDEKIQEKDDADNNHH 1172

Query: 1173 IMDLDNVTEEVSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXX 1232
             M++D ++ E+S+GIP               ES+I+ L  Y+  ++ D            
Sbjct: 1173 SMNIDEMSSEISRGIPKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLI 1232

Query: 1233 XFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAEL 1292
             FK+RKLDLN  V +RDEV+++LE LKK R DEFM GF+IIS+TLKEMYQMITMGGNAEL
Sbjct: 1233 EFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAEL 1292

Query: 1293 ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1352
            ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY+PTPLYVMDEI
Sbjct: 1293 ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEI 1352

Query: 1353 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKD 1412
            DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYKR N T+S T+KN D
Sbjct: 1353 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNID 1412

Query: 1413 IL 1414
            IL
Sbjct: 1413 IL 1414

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1456 bits (3769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 776/1432 (54%), Positives = 991/1432 (69%), Gaps = 51/1432 (3%)

Query: 5    PLSKKQKVVSDEERITPNQNEQDNDKT--------HPE----VTASSFLKSHTPRKLLLG 52
            P +K+QKV   E + TP Q  +D             PE    ++  +  KSHTPRKL+LG
Sbjct: 4    PNTKRQKVTEPESK-TPEQGTEDQQANASLRSPLQRPEHQQSISPINNSKSHTPRKLILG 62

Query: 53   SADNKYXXXXXXXXXXXXXXXXXXXXNLQPPLSQPSRGR-DKKAYXXXXXXXXXXXXXXK 111
              DN+Y                     LQPP S  SRGR D K+Y              +
Sbjct: 63   QNDNRYAFSQPSVSSSSFQVP-----TLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKRR 117

Query: 112  LELIQLSPIKNNRIELQKLYNSKNQN--KVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSA 169
            LELIQLSP+KNNRI+L++LY++ N    K RL+I+KL L +FKSYAG Q+VGPF+TSFSA
Sbjct: 118  LELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSA 177

Query: 170  IVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDE 229
            +VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSE FP++ SCSV+V F Y IDE
Sbjct: 178  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDE 237

Query: 230  NDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQ 289
            +DG +KI E +  LV+ RKAFKNNSSKYYINGKESNYT+VT+LLKEEGIDLDHKRFLILQ
Sbjct: 238  HDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQ 297

Query: 290  GEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFE 349
            GEVENIAQMK KAEKE DDGLLEYLEDIIGTSKYK LIE  ++EIE+LNEIC+EKE RFE
Sbjct: 298  GEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFE 357

Query: 350  IVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQ 409
            IV+ EKNSLES K+ ALEF+ KEKQLTL +SKL QY L+Q N+KL  TL KIS       
Sbjct: 358  IVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEEYN 417

Query: 410  EERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQ 469
             E+SK + +Q+EI+++ + L E+  KI     +E++ ++ KR  +G+ VS++E++KNLTQ
Sbjct: 418  VEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNLTQ 477

Query: 470  KKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXX 529
            KK K EK +      I    S +++L+  Q  Y  E   L ++L  ER            
Sbjct: 478  KKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKE 537

Query: 530  XXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDD 589
                   +I ++E D+EPW  K+QEK+ +IQL ES+ISLL+E Q KLK  +  L  E+ +
Sbjct: 538  KTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEVSN 597

Query: 590  -----VRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAI 644
                 +++E D     + NLKK+Q S+ KE+S GE+EC+  + K KEM+ +LN  RQRA 
Sbjct: 598  QTALKIKREED-----LVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRAS 652

Query: 645  DARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIV 704
            +AR AL   +N+  VL+AL +LQKSGRI GFHGRLGDLG I + YD+A+STAC RLDDIV
Sbjct: 653  EARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIV 712

Query: 705  VDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSN 764
            V++VECGQQCIEYLRKNKLGYARFILLDKLR+F    +QTP+NV RLFDL++P D KF  
Sbjct: 713  VETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVP 772

Query: 765  AFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKN 824
            AFYSVLRDTLVA D++QANRVAYG+RRYRVVTLDGKLID+SGTM+GGG+HVSKGLM L+ 
Sbjct: 773  AFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQR 832

Query: 825  SNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLL 884
                + + Y   DVE+IE+DL+++E NF++A++   EM NEL++L +++PEIELEI+K++
Sbjct: 833  KGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKII 892

Query: 885  MDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKE 944
            M++D+                      +   + L  A   LQ L+ EH AL+D++++KK+
Sbjct: 893  MEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKK 952

Query: 945  KINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFK 1004
            KI +LKE+IMKIGG ELQ+QNSKV+S+ +RI I+ AK KKD+ + K+++ EL+K ++   
Sbjct: 953  KIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLL 1012

Query: 1005 QAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEE 1064
             ++ D T   +D++ +   +  I + L   +   +     K+ L  +C+ LK+K+ D+EE
Sbjct: 1013 TSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEE 1072

Query: 1065 SMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNS 1124
            ++NE+KSFEIE+ NKLEKLN LL++ K  I++L   L    +R + Q L  +  E     
Sbjct: 1073 NINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEE----- 1127

Query: 1125 VGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVS 1184
                        S +  PN     DE   +   ++  N      QD D MD+DN  E +S
Sbjct: 1128 ------------SEAKAPNNGTLSDEQIHDQTGHELTN---TAVQDDDSMDIDNGAEVIS 1172

Query: 1185 KGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRKLDLNTT 1244
             G+P               E+E++ L+ Y+E+++A+             FK RKLDLN  
Sbjct: 1173 NGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDA 1232

Query: 1245 VARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEG 1304
            V +R+ VR +LE+LKKTR++EFM GF IIS+TLKEMYQMITMGGNAELELVDSLDPFSEG
Sbjct: 1233 VDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEG 1292

Query: 1305 VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1364
            VTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV
Sbjct: 1293 VTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1352

Query: 1365 ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILNC 1416
            ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK  N T SAT+KN++ILN 
Sbjct: 1353 ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNS 1404

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1442 bits (3732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 756/1423 (53%), Positives = 990/1423 (69%), Gaps = 34/1423 (2%)

Query: 1    MSHTPLSKKQKVVSDEERITPNQNEQDNDKTHPEVTASS-FLKSHTPRKLLLGSADNKYX 59
            M  TPL+K+Q+V  +E R    + E  N  T   +T++S    SHTP+KL++G+ D+   
Sbjct: 1    MPDTPLTKRQRVNDNESR----EFEAVNGSTKSPLTSNSNSTISHTPKKLVIGTNDD--- 53

Query: 60   XXXXXXXXXXXXXXXXXXXNLQPP-LSQP---SRGRDKKAYXXXXXXXXXXXXXXKLELI 115
                               +LQ P L  P   SRGR+++ Y              KLELI
Sbjct: 54   -------TTSQSQPIVSSSSLQAPSLQHPNSSSRGREQRTYSQSPPRSPGRSPTRKLELI 106

Query: 116  QLSPIKNNRIELQKLYNSKN--QNKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGP 173
            ++SP+K NR+ELQ+LY+++   +N  RL I+KLVLQDFKSYAG Q+VGPF++SFSA+VGP
Sbjct: 107  KISPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGP 166

Query: 174  NGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGT 233
            NGSGKSNVIDSMLFVFGFRANKMRQDRL DLIH SE  PN++SCSVEVHFQYV+DE DGT
Sbjct: 167  NGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGT 226

Query: 234  SKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVE 293
            ++I E++  LVV RKAFKNNSSKYY+N KESNYTEVT+LLK+EGIDLDHKRFLILQGEVE
Sbjct: 227  TRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVE 286

Query: 294  NIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVET 353
            NIAQM+ KAEKEG+DGLLEYLEDI GT+KYK  IE  + EIE LNE C+EKE RF IV+ 
Sbjct: 287  NIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQ 346

Query: 354  EKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERS 413
            EK+SLE+ KD ALEF+ KEK LTLLRSK+ QYK++Q + KL +TLDK S  K  L +E  
Sbjct: 347  EKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENE 406

Query: 414  KYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTK 473
            KY +   E+D    E ++  ++I     +E+ L+ +KR  D Q V++EE+IK++ QK  K
Sbjct: 407  KYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNK 466

Query: 474  AEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXX 533
            AEK L   +  +   E+ L++L+  Q++Y+ E  +L +EL  ER                
Sbjct: 467  AEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVN 526

Query: 534  XXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKE 593
                I+ YEKD+EPW  ++Q+K+ +IQLAESE+SLLK++ A++ + +  LK EI    +E
Sbjct: 527  ISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEE 586

Query: 594  IDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMA 653
               K  +I  LK+E+  +  EV    +ECS A  + K+M  IL + RQR +DAR+A   A
Sbjct: 587  KLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSA 646

Query: 654  ENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQ 713
            +NKSTVL+ALT+LQKSGRI+GFHGRLGDLGVI +KYD+AISTAC RL+DIVV+SVECGQQ
Sbjct: 647  QNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQ 706

Query: 714  CIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDT 773
            CIEYLRKNKLGYARFILLDKLR F  G++QTPENV RLFDLV+P D KF  AFYSVLRDT
Sbjct: 707  CIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDT 766

Query: 774  LVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVY 833
            L A  + QANRVAYGK+R+RVV+LDGKLIDISGTM+GGGSHV +GLM+L  +N    +++
Sbjct: 767  LAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIF 826

Query: 834  EAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSXXXX 893
               +V ++E +L E+E +F+IA DT +EM ++LK+L+D+ PEI+L+++KL+M+ +S    
Sbjct: 827  SPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSE 886

Query: 894  XXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEI 953
                                K +    AEA ++TL++E RAL DQ+ + ++KI  LK++I
Sbjct: 887  LKLKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKI 946

Query: 954  MKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTAC 1013
            M+IGG ELQIQNSKV+S  +R+ I+ +K KK KA+IK+ E EL+K  ++    + D    
Sbjct: 947  MEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQKDLDLY 1006

Query: 1014 VNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFE 1073
              ++ +L+ N   ++  L+  E   D   +   ++  + + LK+++  ME    E+KS +
Sbjct: 1007 SQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLK 1066

Query: 1074 IEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKI-QNENANNSVGVKQSSN 1132
            IEI +KLEKLN+LL +  K++R L  +L +  +RDVT++L+ + + E+ NNS    +  N
Sbjct: 1067 IEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNS----KMPN 1122

Query: 1133 NLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVSKGIPXXXX 1192
             L    +   +  + + E        +S   +EE++ + ++M++D    E+  G+P    
Sbjct: 1123 ELQEKRTEGADATRQEGE--------ESDVSMEEEKSNDEVMEVDEKPHELENGLPRVSE 1174

Query: 1193 XXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRKLDLNTTVARRDEVR 1252
                        ++I  LQ+YV++ N D              K+RK+DLN  V  RD +R
Sbjct: 1175 AELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMR 1234

Query: 1253 DELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP 1312
            ++L +LKK R DEFM+GF IIS+TLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP
Sbjct: 1235 EKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPP 1294

Query: 1313 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1372
            KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT
Sbjct: 1295 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1354

Query: 1373 KNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415
            KNAQFIVISLRNNMFELAQQLVGIYK  NMT+SA+LKN DILN
Sbjct: 1355 KNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILN 1397

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1400 bits (3623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 764/1444 (52%), Positives = 999/1444 (69%), Gaps = 48/1444 (3%)

Query: 1    MSHTPLSKKQKVVSDEERITPNQNEQDND---------KTHP---EVTASSFL--KSHTP 46
            M  TPLSK+ K+V  E  +  N+ + ++D         K  P   +  A S L  KS TP
Sbjct: 1    MPKTPLSKRPKLV--EANLNANELDHNDDDQRYNRQEIKVSPTTQDAAAVSHLNFKSQTP 58

Query: 47   RKLLLGSADNKYXXXXXXXXXXXXXXXXXXXXNLQPPLSQPSRGRDKKAYXXXX----XX 102
            +KL+L      Y                    +L PP    SRGR  + Y          
Sbjct: 59   KKLIL----RDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTYSQSPPRSPAR 114

Query: 103  XXXXXXXXKLELIQLSPIKNNRIELQKLYNSKNQNKV-RLYIDKLVLQDFKSYAGTQIVG 161
                    KLELIQLSP+KN+RI LQK+Y SKN+ ++ RL IDKLVL DFKSYAGTQ+VG
Sbjct: 115  SPARSPTRKLELIQLSPVKNSRIALQKIYESKNEKQIERLCIDKLVLHDFKSYAGTQVVG 174

Query: 162  PFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEV 221
            PF++SFSA+VGPNGSGKSNVIDSMLFVFGFRA+KMRQDRL DLIHKSE FP+++SCSVEV
Sbjct: 175  PFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEV 234

Query: 222  HFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLD 281
            HF+YVID+ DGT+ I   ++ LV+ RKAFKNN+SKYYINGKESNYT VT+LLK+EGIDLD
Sbjct: 235  HFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLD 294

Query: 282  HKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEIC 341
            H RFLILQGEVENIAQMK KAE +GDDGLLEYLEDIIGT+KYK LIE K  EIEALNEIC
Sbjct: 295  HNRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEALNEIC 354

Query: 342  VEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKI 401
            +EKE RFEIV+ EK SLES KD ALEF+ KEK+LTL++SKL QYKL+Q N KL+TTL+K+
Sbjct: 355  IEKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKL 414

Query: 402  SNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSME 461
            SN K   +E + K+   + ++++ ++   E  + I AS  QE++L  +KR YD + VS+E
Sbjct: 415  SNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLE 474

Query: 462  ERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXX 521
            E+ KN+ +KK K EK L D    I   +  ++DL   +  Y+S+   L  +L  ER    
Sbjct: 475  EQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLE 534

Query: 522  XXXXXXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLG 581
                           +IS +EK++EPW  ++Q K+ QIQ+ ESEISL+KE + KL+  + 
Sbjct: 535  EIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIE 594

Query: 582  SLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQ 641
            +L   I    +E  ++   I +L+ E   + KEVS+G++E + AKEK +EM+ +LN HRQ
Sbjct: 595  NLNSLISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQ 654

Query: 642  RAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLD 701
            +AIDAR++L   ENK+ VL++L RLQKSGRI+GF+GRLGDLG I D+YDIAISTAC RL+
Sbjct: 655  KAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLN 714

Query: 702  DIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLK 761
            D+VV++VECGQQCIEYLRKNKLGYARFILL+KLRNF + ++ TP NV RLFDLV   D K
Sbjct: 715  DLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPK 774

Query: 762  FSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMK 821
            F  AFYSVLRDTLV  +++ ANRVAYG +R+RVVTL G+LID+SGTM+GGG+  S+GLMK
Sbjct: 775  FLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTSRGLMK 834

Query: 822  LKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIA 881
            L  S     + Y   DVEKIE++LA RE NF+IA++T  EM  EL+RL+D++P++ELEI+
Sbjct: 835  LTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEIS 894

Query: 882  KLLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQS 941
            K  +++ S                    + ++  + L   E  L TL+N++++L+ +++S
Sbjct: 895  KFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKS 954

Query: 942  KKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQR 1001
            KK++I  LK+EIMK+GG +LQ+Q+SKV S+ ++  I+N KHKKDK  +K+ E EL+++ +
Sbjct: 955  KKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAETELKRLSK 1014

Query: 1002 LFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKD 1061
               +   D     + LE     +  I   L ETE     +   +++     E+LK+++K+
Sbjct: 1015 KQSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFSREESLQNSENLKDQLKE 1074

Query: 1062 MEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNEN- 1120
             EE++N +K F++E +NK EKLN+LL++ KKDIRS + ELQS  +RD+T +L+++ N N 
Sbjct: 1075 FEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQELDNGNI 1134

Query: 1121 ---------ANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDA 1171
                      +N+V V  S+NN   S  ++ N++  + E +  D   D+ N++E      
Sbjct: 1135 DQDEEDVSMKDNAVSV--SANN---SLGNSENMEGVEIETNESDVSPDANNDLE------ 1183

Query: 1172 DIMDLDNVTEEVSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXX 1231
              M++D    E+SKGIP               E++  QLQDY++  N +           
Sbjct: 1184 --MEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRV 1241

Query: 1232 XXFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAE 1291
              +K+RKLDLN  V  R++VR+ L+KLKKTR +EFM+GF +IS+TLKEMYQMITMGGNAE
Sbjct: 1242 AEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAE 1301

Query: 1292 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1351
            LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE
Sbjct: 1302 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1361

Query: 1352 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNK 1411
            IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK +N T+SATL+N 
Sbjct: 1362 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNN 1421

Query: 1412 DILN 1415
            DI+N
Sbjct: 1422 DIIN 1425

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1380 bits (3573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 743/1425 (52%), Positives = 1005/1425 (70%), Gaps = 33/1425 (2%)

Query: 6    LSKKQKVVS----DEERITPNQNEQDNDKTHPEVTAS--SFLKSHTPRKLLLGSADNKYX 59
            LSK+QKV      D +  T + ++ +N  + P  ++S  +F  + TPRKL++G+ DN+Y 
Sbjct: 7    LSKRQKVDGLNQIDGKHPTVDLDQGEN-LSLPTTSSSQNTFAHAKTPRKLVVGNGDNRYA 65

Query: 60   XXXXXXXXXXXXXXXXXXXNLQPPLSQPSRGRDKKAYXXXXXXXXXXXXXXKLELIQLSP 119
                                LQPP +  SRGR  K Y              KLELIQ+SP
Sbjct: 66   HSSQSISSSSLQVPP-----LQPPATS-SRGRGSKTYSQSPPRSPGRSPTRKLELIQISP 119

Query: 120  IKNNRIELQKLYNSK-NQNK-VRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSG 177
            +KN+R+ELQK+Y+++ NQ +  RL ID+L+LQDFKSYAG Q+VGPFNTSFSA+VGPNGSG
Sbjct: 120  LKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSG 179

Query: 178  KSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII 237
            KSNVIDSMLFVFGFRANKMRQDRL DLIHKSE +P++ SCSVEVHF+YVIDE  G ++I 
Sbjct: 180  KSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDEPSGETRID 239

Query: 238  EDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQ 297
            E++  LVV RKAF+NN+SKYY+N +E+NY EVT+LLK+EG+DLDHKRFLILQGEVENIAQ
Sbjct: 240  EEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQ 299

Query: 298  MKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNS 357
            MK+KAE+EG+DGLLEYLEDIIGT+KYK LIE  + ++E+LN+IC+EKE RF+IV+ EKNS
Sbjct: 300  MKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDICIEKENRFQIVDREKNS 359

Query: 358  LESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEK 417
            LE+ K+ AL F+  E++LT+ +SKL QY +  +N KL  TLDKI+N    L++E  K   
Sbjct: 360  LENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLEKESDKNAS 419

Query: 418  IQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKT 477
            ++ E+D+      E   K+     +E++L+ KKRE DG+ V  EE+IKN  +K+ KAEKT
Sbjct: 420  VKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKT 479

Query: 478  LHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXXXXXQ 537
            L      I  +E+ L +L+  Q++Y++    L ++ + E+                   +
Sbjct: 480  LSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKDKTNGISLE 539

Query: 538  ISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNK 597
            I+  EK++EPW +++QEK+ QIQLAES+ISL+KE++AKL + +   K EI+  +++I   
Sbjct: 540  IAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIETRKQQILQG 599

Query: 598  NSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKS 657
            +  +++L  +  S+K+E+S GE EC  A+ + KEM+ ILN+ RQ+A+DARSAL  AENKS
Sbjct: 600  SKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSALSNAENKS 659

Query: 658  TVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQCIEY 717
             VL+AL+RLQKSGRI+GFHGRLGDLGVI +KYD+AISTAC RL+DIVV++VECGQQCIEY
Sbjct: 660  KVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVECGQQCIEY 719

Query: 718  LRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVAT 777
            LRKNKLGYARFILLDKLR F L  + TPE+V RLFDL+ P D KFS+AF+SVL +TLVA 
Sbjct: 720  LRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSVLGNTLVAN 779

Query: 778  DIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGD 837
            D++QANRVAYGK+R+RVVTLDG LIDISGTM+GGGS VS+GLM++  +  E +E+Y + +
Sbjct: 780  DLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEE 839

Query: 838  VEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSXXXXXXXX 897
            V ++E +L ERE NF++A DT+ +M  +LK L++KEP IE  I++L M+++S        
Sbjct: 840  VAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIESWNSEIKIK 899

Query: 898  XXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIG 957
                      Y+   +    L      +Q+L++E +++++Q++SKK +I TLK EIM+IG
Sbjct: 900  EIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIG 959

Query: 958  GKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDL 1017
            G EL+IQ+SKV S+ +RI IV +K KK+++ IK+TE E+ K  ++  +   D      ++
Sbjct: 960  GAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRDLENFNQEI 1019

Query: 1018 ETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIK 1077
            +TL+T +  ++  L +       + + K+ L  +  +L++K+ D+ E +  +KSFE+E+K
Sbjct: 1020 QTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIFKSFEMEMK 1079

Query: 1078 NKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNSVGVKQSSNNLDVS 1137
            N+LEKLNSL  + KK+I+   ++L    +RDVTQ L  +++E+ N S             
Sbjct: 1080 NELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNAS------------D 1127

Query: 1138 SSHTPNVDKHDDEISM-----EDADNDSQNEIEEKEQDAD-IMDLDNVTEEVSKGIPXXX 1191
             S  P  D  + E S+     E+ D D+Q+++++ E+  D  MD+++  E   +G+    
Sbjct: 1128 PSENPVSDVEESESSVGEGKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEYSDRGLTQFS 1187

Query: 1192 XXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRKLDLNTTVARRDEV 1251
                        E EI  LQ++++ SNAD             FK R+LDLN  V  R++V
Sbjct: 1188 EDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNKV 1247

Query: 1252 RDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1311
            +++L++LKK R DEFM+GF IIS+TLKEMYQMITMGGNAELELVD+LDPFSEGVTFSVMP
Sbjct: 1248 KEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMP 1307

Query: 1312 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1371
            PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER
Sbjct: 1308 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1367

Query: 1372 TKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILNC 1416
            TKNAQFIVISLRNNMFELAQQLVGIYKR N T+SAT+KN D ++ 
Sbjct: 1368 TKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVSV 1412

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1376 bits (3562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 744/1449 (51%), Positives = 980/1449 (67%), Gaps = 42/1449 (2%)

Query: 1    MSHTPLSKKQKVVSDEERITPNQN---EQD---ND-----------------KTHPEVTA 37
            M  TP SKK++ V  E+ +TP Q+   E+D   ND                 K    V+ 
Sbjct: 1    MLDTPSSKKRRTVG-EDAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKLQSSVSP 59

Query: 38   SSFLKSHTPRKLLLGSADNKYXXXXXXXXXXXXXXXXXXXXNLQPPLSQPSRGRDKKAYX 97
              F K+ TPRKL++G ++NKY                     L  PLSQ SRGR  K Y 
Sbjct: 60   LDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKL-VPLSQDSRGRRIKMYS 118

Query: 98   XXXXXXX----XXXXXXKLELIQLSPIKNNRIELQKLYNSKNQNKV----RLYIDKLVLQ 149
                             KLELIQLSPIKN+R+ELQKLY++ N  K+    RLYI KLVL 
Sbjct: 119  QSPPRSPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNA-KIGKMNRLYIHKLVLH 177

Query: 150  DFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSE 209
            +FKSYAG Q +GPF+ SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSE
Sbjct: 178  NFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 237

Query: 210  AFPNIQSCSVEVHFQYVIDE----NDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESN 265
             F N+  CSVEVHF+YV DE     DG +  +E    LV+ RKAFKNNSSKY+INGKESN
Sbjct: 238  RFTNLNFCSVEVHFRYVKDEYTAPTDGDT--MEAENTLVITRKAFKNNSSKYFINGKESN 295

Query: 266  YTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKT 325
            +TEVT+LLKE+GIDLDHKRFLILQGEVENIAQMKAKAEK+ +DGLLEYLEDIIGT  YK 
Sbjct: 296  FTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKP 355

Query: 326  LIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQY 385
            LIE K VEIEA+NE+C+EKE RF IV+ EKNSLE DKDAALEF+ KEKQLTLL+SKLTQY
Sbjct: 356  LIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQY 415

Query: 386  KLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERE 445
             LY  N K+ TTL +I + +   ++E+ ++ +   E++     + E+   + +   +E+ 
Sbjct: 416  HLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKS 475

Query: 446  LVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSE 505
            L+Q+KRE + Q VS+EE  KNL QK  KA+ T+   +  I KNE  L++    Q  Y++E
Sbjct: 476  LIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAE 535

Query: 506  FSNLQKELDKERXXXXXXXXXXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESE 565
             ++L K+ + E                    +I+  EK++EP  ++IQEK+ QI+L E E
Sbjct: 536  VNDLSKQREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEME 595

Query: 566  ISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRA 625
            I L+++S+ K+   + SLK E+  ++K++++    + +L K + +L KE   G+ EC  A
Sbjct: 596  IDLIRDSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKDA 655

Query: 626  KEKEKEMRVILNSHRQRAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVI 685
              K  EM+ ILNSHRQ+ ++ARS +  A+NK+ VL++L R+Q+SGRINGFHGRLGDLG+I
Sbjct: 656  GVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGII 715

Query: 686  ADKYDIAISTACSRLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTP 745
            AD+YD+AISTAC RLDD+VV+SVECGQ CIE+LRKNKLGYARF++LDKL+ F +  +QTP
Sbjct: 716  ADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTP 775

Query: 746  ENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDIS 805
            ENV RLFDLV+P + +F+ A YSVLRDTLVA D++QANRVAYGKRR+RVVTLDG+LIDIS
Sbjct: 776  ENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDIS 835

Query: 806  GTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNE 865
            GTM+GGGS V KGLM L        E++   D++K+E +LA RE  F +A +T   M  E
Sbjct: 836  GTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQE 895

Query: 866  LKRLQDKEPEIELEIAKLLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFL 925
            L++L D+EP++ELEI+K L+D+D+                  Y   I   D LD     L
Sbjct: 896  LRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGNL 955

Query: 926  QTLRNEHRALEDQSQSKKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKD 985
            + L  E + L+DQS++  E+++ LK+EIM+IGG ELQ+QNSKVSSL +RI I+ AK KK 
Sbjct: 956  EALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKKS 1015

Query: 986  KATIKRTEKELQKVQRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEK 1045
            K  +K+   EL+K ++    +  ++T    ++   +      +  L +     + I +EK
Sbjct: 1016 KTVVKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDEK 1075

Query: 1046 DDLTGQCESLKEKIKDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYH 1105
             +L  + E+  +K+ +  E++NE+K+ ++E++NK+E+ NS+L Y KK+   L +EL ++ 
Sbjct: 1076 INLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFR 1135

Query: 1106 VRDVTQSLEKIQNENANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIE 1165
            +RDVT +L+ ++ E    +   +Q +   D ++S+  N      +  +E+ +  S +   
Sbjct: 1136 LRDVTHTLDLLREEEGTEA--NQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSV 1193

Query: 1166 EKEQDADIMDLDNVTEEVSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXX 1225
            +   D   MD+D+  + VS+GIP                 EINQLQ ++ N + +     
Sbjct: 1194 KVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILE 1253

Query: 1226 XXXXXXXXFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMIT 1285
                    FKKRK+DLN +V  R+++   +E+LKK R++EFMEGFSIIS+TLKEMYQMIT
Sbjct: 1254 EYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMIT 1313

Query: 1286 MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTP 1345
            MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTP
Sbjct: 1314 MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTP 1373

Query: 1346 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQS 1405
            LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK  NMT++
Sbjct: 1374 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKN 1433

Query: 1406 ATLKNKDIL 1414
            AT++N++ L
Sbjct: 1434 ATIRNREDL 1442

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1374 bits (3557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 754/1443 (52%), Positives = 980/1443 (67%), Gaps = 51/1443 (3%)

Query: 1    MSHTPLSKKQKVVSDEE-RITPNQNEQDNDKTHPEVTASSF------------LKSHTPR 47
            MS +PL+KKQK  +D+  +I  N          P V+ SS             L S TPR
Sbjct: 1    MSDSPLAKKQKTRTDDRGQIQSNPTVS----PIPPVSGSSLMAVKSSPTRQDRLPSPTPR 56

Query: 48   KLLLGSADNKYXXXXXXXXXXXXXXXXXXXXNLQPPLSQPSRGRD--KKAYXXXXXXXXX 105
            KL+LGS + KY                    NLQPP    SRGR    ++          
Sbjct: 57   KLVLGSPEKKYAYSQPSTSSSLSVP------NLQPPNVDGSRGRRFYSQSPPRSPHRSPN 110

Query: 106  XXXXXKLELIQLSPIKNNRIELQKLYNSKN----QNKVRLYIDKLVLQDFKSYAGTQIVG 161
                 +LELIQLSP+KNNR ELQK+Y+ KN    Q   RL IDKL L +FKSYAGTQI+G
Sbjct: 111  RSPTRRLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIG 170

Query: 162  PFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEV 221
            PF+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSEA+PN++SCSV++
Sbjct: 171  PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDI 230

Query: 222  HFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLD 281
            HF+YV+DE+DGT++  +++ P+V+ RKAF+NNSSKYYI+GKESNYTEVT+LL+++GIDLD
Sbjct: 231  HFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLD 290

Query: 282  HKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEIC 341
            HKRFLILQGEVE+I+QMK KAE+E DDGLLEYLEDIIGT+KYK  IE  +VEI+ LN++C
Sbjct: 291  HKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVC 350

Query: 342  VEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKI 401
            VEKE RFE+VE EKNSLES KD ALEF+ KEK LTLL+SKL QY ++Q   KL+ TL KI
Sbjct: 351  VEKENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKI 410

Query: 402  SNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSME 461
            S     L +E++KY++ Q E+ Q      +  +++     + ++L  K+R  D +  SME
Sbjct: 411  SELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSME 470

Query: 462  ERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXX 521
            E+ +NL +K+ KAEK L      +  ++  L++L + Q  Y  +   L + L +ER    
Sbjct: 471  EKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLD 530

Query: 522  XXXXXXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLG 581
                           +I+ +E+D+EPW +++QEK+ Q++L ES+I++LKES+ K  + + 
Sbjct: 531  EIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNII 590

Query: 582  SLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQ 641
             LK EI+   ++ + +   I  L+ EQ ++ K + +GE EC  A  K  EM+ +L SHRQ
Sbjct: 591  QLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQ 650

Query: 642  RAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLD 701
            RA++ARS L   ENK+ VLSAL RLQ+SGRI GFHGRLGDLG I D YD+AISTAC RLD
Sbjct: 651  RAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLD 710

Query: 702  DIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLK 761
            DIVVD+VECGQQCIE+LRKNKLGYARFI+LDKLR F L  +QTPE V RLFDLV+  + K
Sbjct: 711  DIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGK 770

Query: 762  FSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMK 821
            F  AFYSVLRDTLV +D++QANRVAYGKRR+RVVTLDGKLID SGT++GGG+HV KGLMK
Sbjct: 771  FLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMK 830

Query: 822  LKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIA 881
               S  +    Y   +V+ IE++L ERE NF IA +T  +M   LK+ +D+EPEIE+EIA
Sbjct: 831  ---SKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIA 887

Query: 882  KLLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQS 941
            K  +D++S                        +   L  AE+ LQ L  E+  +E+++++
Sbjct: 888  KRRLDIESSSTELKLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIENETKN 947

Query: 942  KKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQR 1001
            K++ IN+LKE+IMKIGG +LQ+QNSKV+S+ E+I I+++K KKD+   K+ E +L++++ 
Sbjct: 948  KQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLEN 1007

Query: 1002 LFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIK- 1060
              ++A  D  +C  +LE  + +V  + T L+    + D  LNE + L  + E   E++K 
Sbjct: 1008 QCREASNDIESC--NLEISKISV--LNTELEAKIYKLDTSLNETESLKEEVEEEFERVKT 1063

Query: 1061 DMEESMN---EYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLE--- 1114
            ++EE  N   ++KS EIEI N+LEKLN L  + KK+I+    EL S  +RD+TQ+L+   
Sbjct: 1064 NLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALN 1123

Query: 1115 --KIQNENANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDAD 1172
              K+  EN ++     +         S  PN    D+E + E      Q ++++ + + D
Sbjct: 1124 EGKLPEENEDDFEVQDEEVQREQREMSSDPNAMDIDEEQAAE------QFQVQQTDGEID 1177

Query: 1173 IMDLDNVTEEVSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXX 1232
             MD+D    E S G+P               E +I++L  YV+N++ D            
Sbjct: 1178 SMDIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLA 1237

Query: 1233 XFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAEL 1292
             +KKRKLDLN  V +RDEVR   E+LKK R D+FMEGFSIIS+TLKEMYQMITMGGNAEL
Sbjct: 1238 EYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAEL 1297

Query: 1293 ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1352
            ELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEI
Sbjct: 1298 ELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEI 1357

Query: 1353 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKD 1412
            DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK +NMT+S TL+N D
Sbjct: 1358 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNID 1417

Query: 1413 ILN 1415
            ILN
Sbjct: 1418 ILN 1420

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1369 bits (3544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 749/1432 (52%), Positives = 991/1432 (69%), Gaps = 46/1432 (3%)

Query: 2    SHTPLSKKQKVVSDEERITPNQNEQDN--DKTHP----------EVTASSFLKSHTPRKL 49
            ++ P  K+QKV+   E  TP Q E++   D   P           ++  +  KSHTPRKL
Sbjct: 5    TNIPSPKRQKVL---ESHTPEQQEENRREDDESPLRFEHQQSAVSLSPPAISKSHTPRKL 61

Query: 50   LLGSADNKYXXXXXXXXXXXXXXXXXXXXNLQPP--LSQPSRGR-DKKAYXXXXXXXXXX 106
            +L  +DN+Y                    +LQPP   S  SRGR D K Y          
Sbjct: 62   ILHQSDNRYAFSQPTVSASSLQVP-----SLQPPETSSSSSRGRRDIKVYSQSPPRSPGR 116

Query: 107  XXXXKLELIQLSPIKNNRI-ELQKLYNSKNQNKVRLYIDKLVLQDFKSYAGTQIVGPFNT 165
                KLELIQLSP+KNNRI +LQ+LYNS+ + K RL+I+KLVL +FKSYAG Q++GPFNT
Sbjct: 117  SPTRKLELIQLSPVKNNRIRKLQELYNSQIK-KERLFINKLVLNNFKSYAGEQVIGPFNT 175

Query: 166  SFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQY 225
            +FSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSE+FPN+ SCSV+V FQY
Sbjct: 176  NFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQY 235

Query: 226  VIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRF 285
            V+D+++G+SKI +++  L++ RKAFKNNSSKY+INGKES+YTEVT+LLKEEGIDLDHKRF
Sbjct: 236  VVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKRF 295

Query: 286  LILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKE 345
            LILQGEVENIAQMK KAE+EGDDGLLEYLEDIIGT+ YK+ IE   +E++ LNEIC+EKE
Sbjct: 296  LILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEKE 355

Query: 346  KRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFK 405
             RFEIVE EKNSLES K+AALEF+ KE++LTL +SKL QY + + + KLA+TL K+S  +
Sbjct: 356  NRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVLQ 415

Query: 406  NALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIK 465
               Q E +K+E  Q E ++     ++ N+KI +     +    KKRE   +  S+EE+IK
Sbjct: 416  EEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKIK 475

Query: 466  NLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXX 525
            + T+KK KA K++   +  ++   + ++ L   Q   +S   +L  EL KE+        
Sbjct: 476  SYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIKL 535

Query: 526  XXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKV 585
                       +I+ +E+++EPW  ++QEK+++IQ+AES+ISLL+E+Q+KLK+ +  LK 
Sbjct: 536  SLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLK- 594

Query: 586  EIDDVRKEIDNKNSIIE---NLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQR 642
              +D++ + +NK +  E   +LK +  ++  E   GESEC+ AK K K+M+ +L + RQ+
Sbjct: 595  --NDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQK 652

Query: 643  AIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDD 702
             +DARS L   ENKS VLSAL +LQKSGRI+GF+GRLGDLGVI ++YDIAISTA +RLDD
Sbjct: 653  VMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDD 712

Query: 703  IVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKF 762
            IVVDSVECGQ CIEYLRKNKLGYARFILL+KLRN  L ++QTPENV RLFDLV+P    F
Sbjct: 713  IVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIF 772

Query: 763  SNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKL 822
              AFYSVLR+TLVA D++QANRVAYG  R+RVVT+DGKLIDISGT+TGGG   ++GLMKL
Sbjct: 773  IPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKL 832

Query: 823  KNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAK 882
            +    E++++Y   D+EKIE++L ERENNFK A+DT  EM   L+RL+D++PE+ELEI+K
Sbjct: 833  RKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISK 892

Query: 883  LLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSK 942
             LMD D                   Y      KD +   E  L  L+ E++ L D +++ 
Sbjct: 893  CLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNI 952

Query: 943  KEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRL 1002
             EKI+ LK+ IM+IGG +LQ+QNSKV+S+ + I I+ +K K+  +++K+ E E+++ ++ 
Sbjct: 953  SEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKA 1012

Query: 1003 FKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDM 1062
               AELD   C  ++++    + ++   L   +  F  + NE  +L  +C +LKEKI + 
Sbjct: 1013 LSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEA 1072

Query: 1063 EESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENAN 1122
            E    ++KS+EI++K++LEKLN+LL + K+ I+  +++L++  +R+ T       +E  N
Sbjct: 1073 EIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIF---GDEGDN 1129

Query: 1123 NSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEE 1182
            NS+      N +D  +SH   V   D    +   +N+ +NE    E +   M++D+V +E
Sbjct: 1130 NSI------NGVD-RTSHGGGVPLQDQNKVVR--ENNMRNEKNSTEAE---MEIDDVADE 1177

Query: 1183 VSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRKLDLN 1242
             S GIP               E+EI QL++YV  +N +             +  RKLDLN
Sbjct: 1178 FSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLN 1237

Query: 1243 TTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFS 1302
              V RR+ ++  L++LKK R+DEFM+GF IIS+TLKEMYQMITMGGNAELEL+DSLDPFS
Sbjct: 1238 QAVERREALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFS 1297

Query: 1303 EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1362
            EGVTFSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS
Sbjct: 1298 EGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1357

Query: 1363 IVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDIL 1414
            IVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYKR N T+SA ++NKD L
Sbjct: 1358 IVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1341 bits (3470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 733/1418 (51%), Positives = 945/1418 (66%), Gaps = 29/1418 (2%)

Query: 4    TPLSKKQKVVSDEERITPNQNEQDNDKTHPEVTASSFLKSHTPRKLLLGSADNKYXXXXX 63
            +PLSKKQK   +         ++D  +T   V  +   +S TPRKL+LGS D ++     
Sbjct: 3    SPLSKKQKTFVN--------RDEDFSQTEESVDVTRASRSRTPRKLVLGSPDKRFAFSQP 54

Query: 64   XXXXXXXXXXXXXXXNLQPPLSQ--PSRGRDKKAYXXXXXXXXXXXXXXKLELIQLSPIK 121
                            LQP  S+   SRGR    Y              KLELIQLSP K
Sbjct: 55   VTSSSSNVPY------LQPLKSELSSSRGR---VYSQSPPRSPTRSPTRKLELIQLSPTK 105

Query: 122  NNRIELQKLYNSKN--QNKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKS 179
              R+E QK    +   Q   RL I++L L +FKSYAGTQ+VGPF++SFSA+VGPNGSGKS
Sbjct: 106  KTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKS 165

Query: 180  NVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIED 239
            NVIDS+LFVFGFRANKMRQ +L DLIHKSEA PN+ SC VEV FQYV DE DG + + +D
Sbjct: 166  NVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQD 225

Query: 240  RKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMK 299
            R  LVV RKAFKNN+SKYY+NGKES+YT+VT LL++EGIDLDHKRFLILQGEVE+IAQMK
Sbjct: 226  RPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMK 285

Query: 300  AKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLE 359
             KAEKEGDDGLLEYLEDIIGT+KYK LIE  +V+I+ LN++C EKE R+EIVE EK+SLE
Sbjct: 286  PKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLE 345

Query: 360  SDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQ 419
            S KD ALEF+ KEK+LT LRSKL Q+KL++ + K   T +KI   +  L  ER+KY + +
Sbjct: 346  SGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHK 405

Query: 420  SEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLH 479
             EI Q   E +  N  I      E  L  +KR  D   VS+EE++KN++QKK KAEKT H
Sbjct: 406  REIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHH 465

Query: 480  DKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXXXXXQIS 539
                 I   ++ L++L   Q+ Y+ E   L K L  E+                   QI 
Sbjct: 466  ATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIG 525

Query: 540  LYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNS 599
              E+++EPW  K+QEK+ QI+L E++IS+LKES AK+ E +   + +I + RK++  ++ 
Sbjct: 526  EIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQ 585

Query: 600  IIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTV 659
             IE L+KE   +++++ +G++EC  A  K KEM+ +L +HRQR++DA+S+L   ENK+ V
Sbjct: 586  AIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKV 645

Query: 660  LSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQCIEYLR 719
            LSAL RLQ+SGRI+GFHGRLGDLG I DKYD+AISTAC RLDD+VV++VECGQQCIE+LR
Sbjct: 646  LSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLR 705

Query: 720  KNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDI 779
            KNKLGYARFILLDKLR+F +  +QTP NV RLFDLV PID KF NAFYSVLRDTLVA D+
Sbjct: 706  KNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDL 765

Query: 780  RQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGDVE 839
            ++ANRVAYGK+R+RVVTLDGKLID+SGTM+GGG+H + G+MK +  N      + A +V 
Sbjct: 766  KEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTGA--SFTAEEVR 823

Query: 840  KIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSXXXXXXXXXX 899
            +I+ +L ERE NFKIA DTL EM + L+ L+D+EPEIE +I+K  M++DS          
Sbjct: 824  QIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCED 883

Query: 900  XXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIGGK 959
                         +  D L  A + L +L+ E + LE + +SKK KI  L+E+IMKIGG 
Sbjct: 884  RAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGT 943

Query: 960  ELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDLET 1019
            +LQ+Q S V S+ +RI I   K K+DK  +K+ E +L++ ++   Q  +D   C N+LE+
Sbjct: 944  KLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNELES 1003

Query: 1020 LQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIKNK 1079
            ++  + +   ++ E EA  D +  E +++  +   ++  I++      ++  FE++I N+
Sbjct: 1004 IKELISSSDNKILELEASIDKLQKEGEEIEEKVREIERLIEEKSSEGQDFAVFEVDINNQ 1063

Query: 1080 LEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNSVGVKQSSNNLDVSSS 1139
            LEKLN LL++  KD   L ++L+S  +RDVT +L+ +     + S    +S + L   SS
Sbjct: 1064 LEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSES----RSGDELHGQSS 1119

Query: 1140 HTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTE-EVSKG-IPXXXXXXXXX 1197
               + +  + ++   D             Q  D MD+D   E E S   +P         
Sbjct: 1120 EARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKE 1179

Query: 1198 XXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRKLDLNTTVARRDEVRDELEK 1257
                  E EI QL D+VEN+ AD             F+ RKL+LN  V +RD VR   + 
Sbjct: 1180 LNVEEVELEIGQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDN 1239

Query: 1258 LKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR 1317
            L+K R DEFM GF+ IS+TLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWR
Sbjct: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR 1299

Query: 1318 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1377
            NI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
Sbjct: 1300 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1359

Query: 1378 IVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415
            IVISLRNNMFELAQQLVGIYK  NMT+S  L+NKD++N
Sbjct: 1360 IVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1314 bits (3401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/1376 (51%), Positives = 930/1376 (67%), Gaps = 21/1376 (1%)

Query: 45   TPRKLLLGSADNKYXXXXXXXXXXXXXXXXXXXXNLQPP-LSQPSRGRDKKAYXXXXXXX 103
            TP KL+ GS   K+                    +LQPP  SQ SRGR    Y       
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGP----SLQPPTYSQLSRGRS--VYSQSPPRS 68

Query: 104  XXXXXXXKLELIQLSPIKNNRIELQKLYNSKNQNKVRLYIDKLVLQDFKSYAGTQIVGPF 163
                   ++ELIQLSPIKN+R+ELQK+Y+ K     RL I  L+L +FKSYAG Q+VGPF
Sbjct: 69   PNRSPARRIELIQLSPIKNSRLELQKIYDGKQTTTKRLSIKNLILNNFKSYAGVQVVGPF 128

Query: 164  NTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHF 223
            ++SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L +LIHKSE   N+  CSVE+ F
Sbjct: 129  HSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITF 188

Query: 224  QYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHK 283
            QYV+D+ DG +K++ D + L VMRK FKNN+SKYYINGKES+YTEVT+ L+ EGIDLDHK
Sbjct: 189  QYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHK 248

Query: 284  RFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVE 343
            RFLILQGEVE+IAQMK KA+ EGDDGLLEYLEDIIGT+KYK+ I D +VE++ LN+IC+E
Sbjct: 249  RFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICME 308

Query: 344  KEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISN 403
            KE RFE+VE EK SLE+ K+ ALEFIAKEKQLTLL+SK  Q+ + +   KLA TLDKIS 
Sbjct: 309  KEIRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISA 368

Query: 404  FKNALQEERSKYEKIQSEIDQSTRELRE-ANEKINASVAQERELVQKKREYDGQCVSMEE 462
            F   L+ ER+KY ++Q EI    REL +   E+I    A++ +LV+ K +   + VS EE
Sbjct: 369  FTEKLENERNKYGELQKEI-TDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEE 427

Query: 463  RIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXX 522
            ++K+L QK+TKAEKTL      I+  E+ ++ L + Q  +++    L + L  ER     
Sbjct: 428  KLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDA 487

Query: 523  XXXXXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGS 582
                          +++  EK++EPW +K++ K  QI+LAESEI ++KES+ KL++ +  
Sbjct: 488  IKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQ 547

Query: 583  LKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQR 642
            L+ +I+  +  I+N    I  L+KE  ++   +S  + EC  AK+K  +M+ +L +HRQR
Sbjct: 548  LRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQR 607

Query: 643  AIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDD 702
              DAR AL   ENK+ VL AL RLQKSGRI+GFHGRLGDLG I DKYDIAIS AC RLDD
Sbjct: 608  MTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDD 667

Query: 703  IVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKF 762
            IVV++VEC QQCIE+LRKNKLGYARFILLDKL+ F + ++ TPENV RLFDL  P +  F
Sbjct: 668  IVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIF 727

Query: 763  SNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKL 822
            + A YSVLRDTLVA D+ QANRVAYG RR+RVVTLDGKLIDISGTM+GGG  V KGLMK 
Sbjct: 728  APALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKS 787

Query: 823  KN-SNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIA 881
            K  SN    ++Y + +V+++E +L +RE NFKIA DT QEM   L++ +D++P I++EI+
Sbjct: 788  KQRSN----DMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEIS 843

Query: 882  KLLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQS 941
            K  +D+D+                    +      PL+  E  L  L +E  AL+D+S+ 
Sbjct: 844  KHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKV 903

Query: 942  KKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQR 1001
            K E+I+ L+ +IMKIGG +LQ QNSKV SLT+++ I+ AK KK++  +K+ E E+ +  +
Sbjct: 904  KNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASK 963

Query: 1002 LFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKD 1061
                AE D   C  +L     +  A++  L+ETE   ++I ++K+ L  + E+ K+ + D
Sbjct: 964  QKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDD 1023

Query: 1062 MEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENA 1121
                + ++KS EIE+   LEKL +L  + K +I   ++EL +  +RDV Q L+K+   N 
Sbjct: 1024 KAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNL 1083

Query: 1122 NNSVGVKQSSNNLDVSSSH--TPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNV 1179
                   +S  +  V+ S+   P +   D +  M D +    +E      D + MD+D  
Sbjct: 1084 -----PLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQD 1138

Query: 1180 TEEVSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRKL 1239
               +  G+P                 EI QL++Y++ + AD             +K+RKL
Sbjct: 1139 ASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKL 1198

Query: 1240 DLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLD 1299
            DLN +V +R+E+R+  E LKK+R +EFM+GF IIS+T+KE+YQMITMGGNAELELVDSLD
Sbjct: 1199 DLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLD 1258

Query: 1300 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1359
            PFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR
Sbjct: 1259 PFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1318

Query: 1360 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415
            NVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK SNMT+S TL+N DILN
Sbjct: 1319 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1308 bits (3384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/1380 (51%), Positives = 923/1380 (66%), Gaps = 32/1380 (2%)

Query: 45   TPRKLLLGSADNKYXXXXXXXXXXXXXXXXXXXXNLQPPLS-QPSRGRDKKAYXXXXXXX 103
            TP KLL  S D K                     +LQPP++ Q SRGR +  Y       
Sbjct: 14   TPVKLLATSPDRK---NVVSRGSSVSTTMGLRGPSLQPPVAHQISRGRSQ--YSQSPPRS 68

Query: 104  XXXXXXXKLELIQLSPIKNNRIELQKLYNSKNQNKVRLYIDKLVLQDFKSYAGTQIVGPF 163
                    +ELIQLSPIKN+R+ELQ+LY++K +   RL I  LVL++FKSYAG Q+VGPF
Sbjct: 69   PNRSPGRAVELIQLSPIKNSRLELQRLYDTKQKKVERLCIRTLVLENFKSYAGRQVVGPF 128

Query: 164  NTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHF 223
            ++SFSA+VGPNGSGKSNVIDSMLF FGFRANKMRQ +L  LIHKSE +P++  CSVE+ F
Sbjct: 129  HSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQF 188

Query: 224  QYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHK 283
            QYV+DE DGT++++  +  L VMRKAFKNN+SKYY+NGKES YTEVTRLL++EGIDLDHK
Sbjct: 189  QYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHK 248

Query: 284  RFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVE 343
            RFLILQGEVE+IAQMK KAE EGDDGLLEYLEDIIGT+KYK  IE  +VE+++LN+IC+E
Sbjct: 249  RFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICME 308

Query: 344  KEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISN 403
            KE RF++VE EK SLE  KD AL F+ KEK LTLL SK  QY L+   +KLA TL  +SN
Sbjct: 309  KENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSN 368

Query: 404  FKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQ----ERELVQKKREYDGQCVS 459
              N L++E++K  + Q EI     EL +A+E++   +       +E + K R+ + + VS
Sbjct: 369  TMNKLEQEKAKKVEAQKEI----VELTDASEQLANRLVSMNNTNKESLAKMRQLERELVS 424

Query: 460  MEERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXX 519
             EE+ K+L QK++KAEKTL+     I++ E+ +++       Y++  + L   +   +  
Sbjct: 425  NEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAE 484

Query: 520  XXXXXXXXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEG 579
                             ++++ EK++EPW +K++EK+ +I+L ESEIS++KE+  KL+  
Sbjct: 485  LEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESE 544

Query: 580  LGSLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSH 639
            + +L  EI+ +R  I ++   IE L  E  S++  + +GE EC+ A+ K +EM+ +L +H
Sbjct: 545  IANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTH 604

Query: 640  RQRAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSR 699
            RQR  DARSA+  AENK+ VL+AL+RLQKSGRI+G+HGRLGDLG I DKYDIAISTAC R
Sbjct: 605  RQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPR 664

Query: 700  LDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPID 759
            LDDIVVD+VECGQQCIE+LRKNKLGYARFILLDKLR F L    TPENV RLFDLV+P +
Sbjct: 665  LDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKE 724

Query: 760  LKFSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGL 819
             KF+ AFYSVLRDTLV TD+ QANRVAYGK+RYRVVTLDGKLIDISGTMTGGG   + GL
Sbjct: 725  PKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGL 784

Query: 820  MKLKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELE 879
            MK    + +   +Y   +V+++E +L ERE NFK+A +T QEM + L+   D++PEIE+E
Sbjct: 785  MK----STQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVE 840

Query: 880  IAKLLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQS 939
            ++K  MD+++                      I     L  AE  L  L  +  +    S
Sbjct: 841  LSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSAS 900

Query: 940  QSKKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKV 999
            +SK ++I  L+ +IM+IGG ELQ  NSKV SL ++I IV AK KKDK   K+ E EL++ 
Sbjct: 901  ESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRA 960

Query: 1000 QRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKI 1059
            ++    A+ D   C  +++ ++++   I T +QE + +   +  E   LT +    K ++
Sbjct: 961  RKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHEL 1020

Query: 1060 KDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNE 1119
                E ++ Y S EIE+  +L+KL +L +Y KK++   + +L    +RD+ Q +  ++  
Sbjct: 1021 DQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEEN 1080

Query: 1120 NANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDAD---IMDL 1176
             +  S            S S TP+  + + + SM +    S +  E K   A+    M++
Sbjct: 1081 KSLQS-----------FSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSMEV 1129

Query: 1177 DNVTEEVSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKK 1236
            D     +  G+P               E +I QLQDY++NS  D             +++
Sbjct: 1130 DEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRR 1189

Query: 1237 RKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVD 1296
            R++DLN  + +RDE R   E LKK R DEFMEGF IIS+TLKEMYQMITMGGNAELELVD
Sbjct: 1190 RRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVD 1249

Query: 1297 SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1356
            SLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL
Sbjct: 1250 SLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1309

Query: 1357 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILNC 1416
            DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ+LVGIYK SNMT+S TL+N+DI+N 
Sbjct: 1310 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIINV 1369

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1294 bits (3348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/1429 (49%), Positives = 964/1429 (67%), Gaps = 54/1429 (3%)

Query: 4    TPLSKKQKVVSDEERITPNQNEQDNDKTHPEVTASSFLKSHTPRKLLLGSADNKYXXXXX 63
            +PL+KKQK          N++E  + +  P+VT +S  +S TPRKL+LGS D ++     
Sbjct: 3    SPLAKKQKTH------VSNESENSSTEESPDVTRAS--RSRTPRKLVLGSPDKRFAFSQP 54

Query: 64   XXXXXXXXXXXXXXXNLQPPLSQ--PSRGRDKKAYXXXXXXXXXXXXXXKLELIQLSPIK 121
                           +LQP  ++   SRGR    Y              KLELIQLSP+K
Sbjct: 55   VSSSSSNVP------HLQPLKNELSSSRGR---VYSQSPPRSPNRSPTRKLELIQLSPMK 105

Query: 122  NNRIELQKLYNSKNQ--NKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKS 179
             +R+E QK   S+    +  RL ID+LVL +FKSYAGTQ+VGPF+ SFSA+VGPNGSGKS
Sbjct: 106  KSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKS 165

Query: 180  NVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIED 239
            NVIDS+LFVFGFRANKMRQ +L +LIHKSE  P++ SC V++ FQYV DE DGT+ II+ 
Sbjct: 166  NVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQ 225

Query: 240  RKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMK 299
            +  +V+ RKAF+NN+SKYY+NGKES+YT +T+LL++EGIDLDHKRFLILQGEVE+IAQMK
Sbjct: 226  KPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMK 285

Query: 300  AKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLE 359
             KAEKE DDGLLEYLEDIIGT++YK LIE+ + EI  LN+IC EKE RFEIVE EK+SLE
Sbjct: 286  PKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLE 345

Query: 360  SDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQ 419
              K+ ALE++ KEK LT+LRSKL QY L++   KL +T +KI+  +  L  E++K  K  
Sbjct: 346  QGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHS 405

Query: 420  SEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLH 479
             E+     +L+     +      E++L  +KR  D   VS+EE++KNLTQK+ K+ ++L 
Sbjct: 406  EEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKEVKSSRSLQ 465

Query: 480  DKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXXXXXQIS 539
                 I   ++ +++L + Q  ++ +   L   + +E+                   QI 
Sbjct: 466  SITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKLDEIKSSLKDKISLISEQIR 525

Query: 540  LYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNS 599
              EK++EPW  K+QEK+ Q++L E+ IS+ KES AK+++ +  +   ID++R +++ +  
Sbjct: 526  EIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQRG 585

Query: 600  IIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTV 659
             + +L+KEQV + +++++G+SEC  A +K KEM+ IL +HRQR+IDARS+L   ENK+ V
Sbjct: 586  SVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLSTFENKNKV 645

Query: 660  LSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQCIEYLR 719
            L+AL RLQ+SGRI+GFHGRLGDLG I DKYD+AISTAC RLDDIVV++VECGQQCIEYLR
Sbjct: 646  LAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECGQQCIEYLR 705

Query: 720  KNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDI 779
            KNKLGYARFILLDKLRNF L  ++TPENV RL+DLV+P + KF NAFYSVLRDTLVA D+
Sbjct: 706  KNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDL 765

Query: 780  RQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGDVE 839
            ++AN+VAYGK+RYRVVTLDGKLID+SGTM+GGG+  ++G+MK   S  +    + A +V+
Sbjct: 766  KEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMK---SEQQSNSAFTAEEVQ 822

Query: 840  KIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSXXXXXXXXXX 899
            +I+++L+ERE+NF+IA DTL EM   L++L+D+EPEIEL+I+K  +D+DS          
Sbjct: 823  QIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEG 882

Query: 900  XXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIGGK 959
                         +  + L  AE  L++L++E+R LE++ QSKK+++  L+E+IMK+GG 
Sbjct: 883  RLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGT 942

Query: 960  ELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDLET 1019
            +LQ+Q+S V S+ +RI IV AK KK K  +K+ + ++++ Q+  +Q   +  +C  +   
Sbjct: 943  KLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDIKRYQKQAEQLAEELKSCSQEKSL 1002

Query: 1020 LQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNE-------YKSF 1072
            ++ N+ +   ++ E     + +   KD+L    E  +E+++  EES++E       +++ 
Sbjct: 1003 IENNLDSSSKKVDELSESINKL---KDEL----ELTEERVRKAEESIDEKTVEGRDFEAL 1055

Query: 1073 EIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSL----EKIQNENANNSVGVK 1128
            EI+   +L+KL  L     K+       L S  +RDVT +L    E ++NE+ N      
Sbjct: 1056 EIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDESLENESKNEVAAET 1115

Query: 1129 QSSNNLDVSSS-HTP-NVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVSKG 1186
                + + SSS H P +VD++  E +   +  ++Q +  E E+        N  E +  G
Sbjct: 1116 PGEEDGEHSSSLHDPMDVDENQGEST---STTEAQLQAGEAER-------RNTEESLPNG 1165

Query: 1187 IPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRKLDLNTTVA 1246
            +P               E EI+QLQDYVEN+ AD             +K RK+DLN  V 
Sbjct: 1166 LPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQ 1225

Query: 1247 RRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVT 1306
             RD+VR   E LKK R DEFMEGF+ I + LKEMYQMITMGGNAELELVDSLDPFSEGV 
Sbjct: 1226 ERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVL 1285

Query: 1307 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1366
            FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1286 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1345

Query: 1367 YIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415
            YIKERTKNAQFIVISLRNNMFELA+QLVG+YK  NMT+S  L+N D+++
Sbjct: 1346 YIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLID 1394

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1242 bits (3214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 708/1431 (49%), Positives = 949/1431 (66%), Gaps = 58/1431 (4%)

Query: 1    MSHTPLSKKQKVVSDEERITPNQN------EQDNDKTHPEVTASSFLKSHTPRKLLLGSA 54
            MS  P +KKQKV  D E  +P  N      +  ND   P   A+  LKS+TP K+++ + 
Sbjct: 1    MSALPDAKKQKV-KDIESNSPLNNDIPKIAQSRND--SPLQVANDPLKSYTPMKVIISN- 56

Query: 55   DNKYXXXXXXXXXXXXXXXXXXXXNLQPP-LSQPS---RGRDKKAYXXXXXXXX----XX 106
                                    + QPP L  PS   RGR  KAY              
Sbjct: 57   --------NHSNSISPLPSQLMSSSTQPPSLQHPSSSSRGRAVKAYSQSPPRSPDRSPVR 108

Query: 107  XXXXKLELIQLSPIKNNRIELQKLYNSKNQNKV-RLYIDKLVLQDFKSYAGTQIVGPFNT 165
                KLELIQLSPIKN+R ELQK+Y+SK + K+ R+ ++KLVL +FKSYAGTQ +GPF++
Sbjct: 109  SPTRKLELIQLSPIKNSRSELQKIYSSKQEEKIERICLNKLVLHNFKSYAGTQTIGPFHS 168

Query: 166  SFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQY 225
            SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +P++ SC+V+VHF+Y
Sbjct: 169  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEY 228

Query: 226  VIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRF 285
            +ID  D T+KI   ++PL++ R+AFKN++SKYY+NGKESNY  +T LLKEEGIDLDH RF
Sbjct: 229  LIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRF 288

Query: 286  LILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKE 345
            LILQGEVENIAQMK KAEKEGDDGLLEYLEDIIGT+KYK LI+ K +EIEALN+IC+E+E
Sbjct: 289  LILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIERE 348

Query: 346  KRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFK 405
             RF+I++ EK SLES+K++ALE+++KEK+  +++SKL QYK++Q N KL+ TL+KI+  +
Sbjct: 349  NRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITKLE 408

Query: 406  NALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIK 465
            +   +E++K  +++++ID+  +   +  +++ A +  E+ELV  KR  D   VS  E++K
Sbjct: 409  DEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLK 468

Query: 466  NLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXX 525
            N+ +K  K  K + +    I  +   LK+  D +  ++++   L   L  E         
Sbjct: 469  NIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKL 528

Query: 526  XXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKV 585
                       +I   EKD+EPW  K+ E + +IQ+ ESE +L +ES+ KLK  + +L+ 
Sbjct: 529  DLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEALEK 588

Query: 586  EIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAID 645
            ++++  K  +++   ++NL  +  ++ KEV  G +E  +A EK  EM+ IL   RQ+A D
Sbjct: 589  DVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKAND 648

Query: 646  ARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVV 705
            AR++L   EN+S VL AL +LQKSGRINGFHGRLG+LGVI +KYD+AISTAC RL+DIVV
Sbjct: 649  ARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVV 708

Query: 706  DSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNA 765
            DSVECGQQCIEYLRKN LG+ARFILLDKL  F + ++ TP NV RLFDL++  D KF  A
Sbjct: 709  DSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPA 768

Query: 766  FYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNS 825
            FYSVLR+TLVA D+++AN VAYGK RYRVVTL G LIDISGTM+GGG+  SKG M+L NS
Sbjct: 769  FYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLSNS 828

Query: 826  NMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLM 885
              +    Y + +V +IE++L+ RE N++ A++T+QEM  EL+ L++ EP+IELEI+KL  
Sbjct: 829  TSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNF 888

Query: 886  DVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEK 945
            ++DS                  ++   N    +   +  L TL  + + +E Q +SKK++
Sbjct: 889  EIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKSKKDR 948

Query: 946  INTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQ 1005
            I  L+++IMKIGG +LQ+QNSKV SL E+  I+  K K +KA I + E +++K+ +  K+
Sbjct: 949  IKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDVRKLSKKLKE 1008

Query: 1006 AELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEES 1065
            +E DNT        L+  +  I   L + E   + I ++K  L  + E    ++ +ME  
Sbjct: 1009 SESDNTKLNEKKIALENELKNIEELLAQNENNMNCIQDKKFTLREKSEITMNELTEMEGL 1068

Query: 1066 MNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLE--KIQNENANN 1123
            ++E+K+ E+E K K EKL SLL+  KK +++L ++  S  +R+V   L+   I+ + A  
Sbjct: 1069 LSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLNIKEQEA-- 1126

Query: 1124 SVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEV 1183
                ++    L        + D  +DE+ +ED +N                       E+
Sbjct: 1127 ----QKIKTELYADFEQNQSNDVINDEMIIEDNNN-----------------------EI 1159

Query: 1184 SKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRKLDLNT 1243
            +KGIP               E+E+ QLQDY E +  D             +++RK DLN 
Sbjct: 1160 AKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQ 1219

Query: 1244 TVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSE 1303
            +V +RD+VR ELE LKK R +EFME F+IIS+TLKEMYQ+ITMGGNAELELVDSLDPFSE
Sbjct: 1220 SVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSE 1279

Query: 1304 GVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1363
            GVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI
Sbjct: 1280 GVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1339

Query: 1364 VANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDIL 1414
            VANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK  N T+SATLKN DIL
Sbjct: 1340 VANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDIL 1390

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1229 bits (3179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/1388 (49%), Positives = 921/1388 (66%), Gaps = 49/1388 (3%)

Query: 42   KSHTPRKLLLGSADNKYXXXXXXXXXXXXXXXXXXXXNLQPPLSQPS--RGRDKKAYXXX 99
            +S TPRKL++ SAD+++                       P L  PS   GR+ K Y   
Sbjct: 67   RSRTPRKLIVSSADHRFTMSQPNLLSADSQT---------PSLQHPSVSTGREHKFYSQS 117

Query: 100  X----XXXXXXXXXXKLELIQLSPIKNNRIELQKLYNSKNQNK--VRLYIDKLVLQDFKS 153
                            LELIQLSPIKNNR ELQK+Y  +   K  +RL I++LVL +FKS
Sbjct: 118  PPRSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKS 177

Query: 154  YAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPN 213
            YAG Q+VGPF+T+FSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +P 
Sbjct: 178  YAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPE 237

Query: 214  IQSCSVEVHFQYVIDE-NDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRL 272
            + SCSVE+HFQYVID+ N G SKI E ++ LVVMRKAFKNNSSKYYIN KES++T+VT L
Sbjct: 238  LSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTL 297

Query: 273  LKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMV 332
            LK EGIDLDHKRFLILQGEVENIAQMK K+EKEGDDGLLEYLEDIIGTS YK  IE  + 
Sbjct: 298  LKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLS 357

Query: 333  EIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNT 392
            ++EALNEIC+EKE RF IVE EK+SL   K+ AL+++A EK L L +SK  Q++LY  N 
Sbjct: 358  KVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNK 417

Query: 393  KLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKRE 452
            KL +TL KI++ +    +E  KY  I  E+     E    N+++N +   E +L+  +R+
Sbjct: 418  KLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRK 477

Query: 453  YDGQCVSMEERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKE 512
             + + +S +E IKN+ +KK  AEK ++     I +  + L+ L + Q +Y  +   L ++
Sbjct: 478  NNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNEK 537

Query: 513  LDKERXXXXXXXXXXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKES 572
            L  E+                   +I   EK++EP+  ++QEK  QIQL +SEISLL E+
Sbjct: 538  LKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNEN 597

Query: 573  QAKLKEGLGSLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEM 632
            +  L   + S+K  I++ +  +   +  I   K++ +  +KEV  G+ E ++  +K +EM
Sbjct: 598  KDNLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEM 657

Query: 633  RVILNSHRQRAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIA 692
            R  L+SHRQ+A D+R++L   +NK++VL+AL +LQKSGRI+GF+GRLGDLGVI +KYD+A
Sbjct: 658  RDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVA 717

Query: 693  ISTACSRLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLF 752
            ISTAC RL+D+VVDSV+CGQQCI+YLRKN+LGYARFILLDKLR F L +++TP+N  RLF
Sbjct: 718  ISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLF 777

Query: 753  DLVQPIDLKFSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGG 812
            DL+Q  + KF  AFYSVLRDTLVAT++  AN+VAYGKRR+RVVTLDGKLIDISGTM+GGG
Sbjct: 778  DLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGG 837

Query: 813  SHVSKGLMKLKNSNMEH-LEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQD 871
            ++V +GLMKL     E+  E     +V+K+ER+L   E NFK+A+++L+EMN E+  +++
Sbjct: 838  NYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKE 897

Query: 872  KEPEIELEIAKLLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNE 931
            + P  EL I+K  ++++                   +    N  D +  A+  LQ L+ E
Sbjct: 898  QIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKE 957

Query: 932  HRALEDQSQSKKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKR 991
            + +L DQ++  K++I  L+++IM  GG EL++QNSKV+SL  ++ IVN+K K DK+ IK+
Sbjct: 958  YYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKK 1017

Query: 992  TEKELQKVQRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQ 1051
                L+K+Q      + ++     +LE  +  V  +   L + E++ +   N K+++   
Sbjct: 1018 NNNILKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLN 1077

Query: 1052 CESLKEKIKDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQ 1111
             +  KEK +++EE    +KSFE+EIKNKL+KL  L  + +K I  L+ EL +  +R+++Q
Sbjct: 1078 IDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALTIREISQ 1137

Query: 1112 SLEKIQNENANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQ-- 1169
            +LE                        S    ++K+D  IS   A  D+Q+         
Sbjct: 1138 NLE------------------------SFDERLEKYD--ISKNGATEDTQHTSSALNSVS 1171

Query: 1170 --DADIMDLDNVTEEVSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXX 1227
              + D MD+D+   E++ GI                ++EI  L++ +E+S A+       
Sbjct: 1172 NINTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEY 1231

Query: 1228 XXXXXXFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMG 1287
                  +KKRK DL+ +++ ++  ++E E LKK R +EF  GF IISLTLKEMYQMITMG
Sbjct: 1232 VRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMG 1291

Query: 1288 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLY 1347
            GNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLY
Sbjct: 1292 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1351

Query: 1348 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSAT 1407
            VMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK  NMTQSAT
Sbjct: 1352 VMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSAT 1411

Query: 1408 LKNKDILN 1415
            L N D+LN
Sbjct: 1412 LVNNDMLN 1419

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1186 bits (3067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/1380 (48%), Positives = 901/1380 (65%), Gaps = 42/1380 (3%)

Query: 43   SHTPRKLLLGSADNKYXXXXXXXXXXXXXXXXXXXXNLQPPLSQPSRGRD-KKAYXXXXX 101
            + TPRKL+LGS + KY                    +LQPP +   RGR+  ++      
Sbjct: 26   TRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPP--SLQPPTAHAVRGREYSQSPPRSPT 83

Query: 102  XXXXXXXXXKLELIQLSPIKNNRIELQKLYNSKNQNKVRLYIDKLVLQDFKSYAGTQIVG 161
                     KLELI+LSP K+ R+ELQK++ +  Q   RL IDKLVL +FKSYAG Q +G
Sbjct: 84   RSPTRSPTRKLELIRLSPKKSTRLELQKMHEANTQTSQRLCIDKLVLNNFKSYAGIQEIG 143

Query: 162  PFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEV 221
            PF+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L +LIHKSE FP++ SCSV++
Sbjct: 144  PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQI 203

Query: 222  HFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLD 281
            HF YV D ++G +KI+     +VV R+AFKNNSSKYY+NGKESNYTEVTRLLKEEGIDLD
Sbjct: 204  HFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLD 263

Query: 282  HKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEIC 341
            HKRFLILQGEVE+IAQMKAKAEK+ DDGLLEYLEDIIGT+K+K  IE  + EIE LNE+C
Sbjct: 264  HKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVC 323

Query: 342  VEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKI 401
            +EKE RFE+V+ EK +LES K+ ALEF+ KE++ T+L+++L Q ++Y +N KLAT+ DKI
Sbjct: 324  MEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLATSCDKI 383

Query: 402  SNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSME 461
            S      QEE+S+YE +Q E +  T E+    ++  A   + + +  KKR  +   ++ +
Sbjct: 384  SALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATD 443

Query: 462  ERIKNLTQKKTKAEKTL----HDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKER 517
            E++K++ +K   AEK       + +  + + ES+ K+  D ++    E  NL   +  E+
Sbjct: 444  EKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEI----ELHNLNHSISIEK 499

Query: 518  XXXXXXXXXXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLK 577
                               ++   E+ +EP+  +IQEKQ +I+L+E++I++LK S + L 
Sbjct: 500  EKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLL 559

Query: 578  EGLGSLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILN 637
            +   +++ +I+D++ E   +     +L+ E+  ++  +S  + EC  A+++  EMR +L 
Sbjct: 560  KEKATIESKIEDLQLEELKQKETETSLRNEKSKVEARISTAQKECEEAQKQTNEMRDVLI 619

Query: 638  SHRQRAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTAC 697
              RQ   +A++ L+  +NK+ VL ALT+LQ SGRI GFHGRLGDLG I D+YDIAISTAC
Sbjct: 620  QQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTAC 679

Query: 698  SRLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQP 757
             RLDDIVV++VECGQQCI++LRKNKLGY RFILLDKLR   L ++ TPENV RLFDL+ P
Sbjct: 680  PRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITP 739

Query: 758  IDLKFSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSK 817
            +   F  AFYSVLRDTLVA D++QANRVAYGKRR+RVVTLDGKLIDISGTM+GGGS    
Sbjct: 740  VRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQS 799

Query: 818  GLMKLKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIE 877
            GLM+ K +       Y   +VEK+E  L+ +E N++ A   + EM + L++L D+ PEI+
Sbjct: 800  GLMRSKATTASQ---YSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEID 856

Query: 878  LEIAKLLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALED 937
            ++I+K+ ++  S                   +     + PL   E  L  LR   +   D
Sbjct: 857  IQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTID 916

Query: 938  QSQSKKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQ 997
             S+  ++KI+ LK+ IM+ GG EL++Q +KV+SL + I I++ K KK+K   K+ + +L 
Sbjct: 917  ASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKEKTRSKKLDIDLA 976

Query: 998  KVQRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILN--EKDDLTGQCESL 1055
            +  R   +   +   C  D+  L   + +I  RL++   E  +I N   K +L    E L
Sbjct: 977  RATREKNKYSEEVLVCNKDISILSEQLESI--RLEKERIEEQVIENNERKAELNSSVEKL 1034

Query: 1056 KEKIKDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEK 1115
            K+++  +E   NE+K+ E+E  ++LEKL+ L +Y KK +RS    LQS  +RDV++ L +
Sbjct: 1035 KQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQ 1094

Query: 1116 IQNENANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMD 1175
            + +    +   V     N D+  +            S+ D  N+            D M+
Sbjct: 1095 LNDGIIESCTDVTAKVMNGDIVQTQ-----------SITDVGNN------------DAME 1131

Query: 1176 LDNVTEEVSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFK 1235
             D+       G+P               E E++QLQDY++N N D             ++
Sbjct: 1132 -DSGEAATHSGLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQ 1190

Query: 1236 KRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELV 1295
            +RKLDLN  VA+R+EVR++ E  K  R ++FMEGF IIS+TLKEMYQMITMGGNAELELV
Sbjct: 1191 RRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELV 1250

Query: 1296 DSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1355
            DSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA
Sbjct: 1251 DSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1310

Query: 1356 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415
            LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVGIYK +NMT+S TL+N DIL+
Sbjct: 1311 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILH 1370

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1162 bits (3005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1420 (48%), Positives = 911/1420 (64%), Gaps = 31/1420 (2%)

Query: 1    MSHTPLSKKQKVVSDEERITPNQNEQDNDKTHPEVTASSFLKSHTPRKLLLGSADNKYXX 60
            MS  P+SK+QKV       T    E+D   T   VT     ++ TPR LL GS +     
Sbjct: 1    MSDRPVSKRQKV-------TEEDEEEDVIHTPKAVTFEQSPRAITPRNLL-GSENRNVLP 52

Query: 61   XXXXXXXXXXXXXXXXXXNLQPPLSQPS-RGRDKKAYXXXXXXXXXXXXXXKLELIQLSP 119
                              +L PP S  S RGRD K+Y              +L+LI+LSP
Sbjct: 53   TGGSQNLQIP--------SLLPPESLGSARGRDFKSYSQSPPRSPGRSPTRRLKLIELSP 104

Query: 120  IKNNRIELQKLYNSK--NQNKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSG 177
            IKN+R ELQKLY SK  +  K RL+I +LVL DFKSYAG Q++GPF+TSFSAIVGPNGSG
Sbjct: 105  IKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSG 164

Query: 178  KSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII 237
            KSNVIDSMLFVFGFRANKMRQDRL DLIHKSE FP+++SCSVEVHF+YVID++DG++ I 
Sbjct: 165  KSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTID 224

Query: 238  EDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQ 297
            E +  LVV RKAFKNN+SKY++NGKESNYTEVT LLK+EGIDLDHKRFLILQGEVENIAQ
Sbjct: 225  ETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQ 284

Query: 298  MKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNS 357
            MKAKAEKE DDGLLEYLEDIIGTSKYK  IE   +EIE+LNEICVEKE RF IVE EKNS
Sbjct: 285  MKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNS 344

Query: 358  LESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEK 417
            LES K+ AL+F+ KEK+L L +SKL QY L Q N KL   L+K +N +    ++  ++ K
Sbjct: 345  LESGKEEALQFLNKEKELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQQEQTKQEDEFRK 404

Query: 418  IQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAE-- 475
              S I   T  L      +     +E  L + KR  + + V  E+ + NL  K+ + E  
Sbjct: 405  ANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQ 464

Query: 476  -KTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXXX 534
             K L DK   I   +  ++ + + Q +     + L   LD E+                 
Sbjct: 465  SKILQDK---INSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHL 521

Query: 535  XXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEI 594
              QI+ YEK++ PW  + Q+ + +I++ ESE+S+++E++  L+  +  L+  I   ++++
Sbjct: 522  TIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDL 581

Query: 595  DNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAE 654
            + +   I++L +++  + +E  LGE EC  A+     +R  + + RQ+AI+ RS     E
Sbjct: 582  EVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATE 641

Query: 655  NKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQC 714
            N + VLSAL RLQKSGR+NGFHGRLGDL VI  KYD+AISTAC RL+D+VVD+VE GQQC
Sbjct: 642  NNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQC 701

Query: 715  IEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTL 774
            IEYLRKNKLGYARFILLDKL  F   ++ TP+   RLFDL+   + +F+NAFYSVLRDTL
Sbjct: 702  IEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTL 761

Query: 775  VATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVYE 834
            V  ++ QANRVAYGK+RYRVVTLDG LID+SGTMTGGG +VSKGLMKL  S+ +    + 
Sbjct: 762  VCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKSSSKGSAFFS 821

Query: 835  AGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSXXXXX 894
              +V+ IE +L ++EN +K A D   EM  EL+RL+D+ PEI+  ++K  MD+++     
Sbjct: 822  PEEVQAIENELNQKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEMDIETAHNDI 881

Query: 895  XXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIM 954
                            + N+ DP     A L+ L+++   ++ Q++S K+KI T+K++I+
Sbjct: 882  NSNINVLEEKRKKLESMKNQNDPSITLLAKLKELKSKLDDIDVQTKSTKDKIKTIKDKII 941

Query: 955  KIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACV 1014
            ++GG EL+ Q+  V+ +T +I   + + KK K+   + E  L+K  +   +A  + T   
Sbjct: 942  ELGGDELKNQSLLVTDITNKISENSRRLKKIKSNKLKKESLLKKFNKELTEANEELTNFS 1001

Query: 1015 NDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEI 1074
             + E        I ++L + +   + +   +  L  + E    +++  ++ +++YKS  +
Sbjct: 1002 KNAENADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISL 1061

Query: 1075 EIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNSVGVKQSSNNL 1134
            E  NKLEKL +     KK I+  N  L    +RDVTQ L  I  E    +  V +S   L
Sbjct: 1062 EYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTE---ENASVDKSDPKL 1118

Query: 1135 DVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVSKGIPXXXXXX 1194
            + ++S   N D  DD IS    +    +  E  + D++ M++D+    ++ GIP      
Sbjct: 1119 E-NTSAVINAD--DDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASE 1175

Query: 1195 XXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRKLDLNTTVARRDEVRDE 1254
                     E  I  L D++ +S A+             F KRK DLN+ V  RD V+D 
Sbjct: 1176 LAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDR 1235

Query: 1255 LEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKK 1314
            LE +K+ R+DEFMEGF IIS+TLKEMYQMIT+GGNAELELVDSLDPFSEGVTFSVMPPKK
Sbjct: 1236 LEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKK 1295

Query: 1315 SWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            SWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN
Sbjct: 1296 SWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1355

Query: 1375 AQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDIL 1414
            AQFIVISLRNNMFEL +QLVGIYK  NMT+SA L N+D++
Sbjct: 1356 AQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLV 1395

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  257 bits (657), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 336/1327 (25%), Positives = 594/1327 (44%), Gaps = 201/1327 (15%)

Query: 146  LVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLI 205
            L L +FKSY G   +G  +++F++I+GPNGSGKSN++D++ FV G R++ +R + L DLI
Sbjct: 7    LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 206  HKSEAFPNIQSCSVEVHFQYVIDENDG-----TSKIIE-----DRKPLVVMRKAFKNNSS 255
            ++      I+  S E       D  DG     TS  ++     D K + +MR    N  +
Sbjct: 67   YRGV----IRDFSEE-------DPEDGEEQHPTSAYVKAFYEMDGKVVELMRTININGDT 115

Query: 256  KYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLE 315
             Y I+ K  +Y +    L++E I +  K FL+ QG+VE IA   A         L +  E
Sbjct: 116  TYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSAL-------DLSKLFE 168

Query: 316  DIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQL 375
            +I G+ +YK   +    E+E L +   E  +    +  E  + +       E I+K+++ 
Sbjct: 169  EISGSIQYKKEYDSLKDELEKLGKSTTESIRNRRRIHGELKTYK-------EGISKDEEY 221

Query: 376  TLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTREL---REA 432
                 K  +Y++Y T  KL     +   FK+ L++ +++  K++ +I+   + L   + A
Sbjct: 222  KNNVEKKKKYEMYFTLWKLFHLDAQRIQFKDKLKQAKTEMSKLKEKINNEEKHLTRSKSA 281

Query: 433  NEKINASVAQERE----LVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHDKRIEIQKN 488
              K N+ + ++R      V++K +   QC S++  ++  +++    EK +          
Sbjct: 282  FLKENSILTKKRSQLDYTVKEKEKVISQCNSIKIPLRASSKRIMNIEKRI---------- 331

Query: 489  ESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXXXXXQISLYEKDIEPW 548
            ES  +D++  Q +Y S F N  K + K +                   +  L + D++ W
Sbjct: 332  ESFKRDIER-QKDYVSTFENQLKVVTKAK----ELFEVEIKKSARNHDKFRLTDTDLK-W 385

Query: 549  VSKIQEKQVQI--QLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSII-ENLK 605
              ++ EK +     L E +ISLL   + +  + +  L   ID  +  +  + +I  ENL+
Sbjct: 386  YEQLNEKYLSTGGSLLEQKISLLNNDKQEKTDEMELLNRHIDVSKNRVTEELNITGENLQ 445

Query: 606  KEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTVLSALTR 665
             +   +   ++   +  +   +K K+ ++ + S   +  D    L     K   LSA  R
Sbjct: 446  NQVTDMTSTLNEKNATYAEQMKKLKDYQMQVESSNNQEYDLNYKLRETLVKLDDLSANQR 505

Query: 666  ---LQKSGRIN---------GFHGRLGDLGVI-ADKYDIAISTACSR-LDDIVVDSVECG 711
                +K  R N         G  G + DL     +KY +A+S    +  D I+V+++   
Sbjct: 506  ESLKEKKLRENVTMLKRFFPGVKGLVHDLCRPKKEKYGLAVSVMLGKNFDSIIVENLSVA 565

Query: 712  QQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLR 771
            ++CI +L+K + G A FI LD + + Q      P     L       DL +  A   V  
Sbjct: 566  RECISFLKKQRAGTASFIPLDTIDSEQPTLSAPPSQEYILTINAIEYDLAYERAMQYVCG 625

Query: 772  DTLVATDIRQANRVAYGKR-RYRVVTLDGKLIDISGTMTGGGSHVSK---------GLMK 821
            D+++   +  A  + + +  R ++V+LDG LI  +G MTGG S  SK          LM 
Sbjct: 626  DSIICDTLDIARDLKWNRGVRSKLVSLDGSLIHKAGLMTGGISKDSKNRWDKEEYQSLMT 685

Query: 822  LKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIA 881
            LK+  +  +E     +V  + RD A +    +    +L  +N EL  L+ +  +++  + 
Sbjct: 686  LKDKLLIQIE-----EVSTVGRDAAAKARELE---SSLSLLNAELSSLRTQLVQVKRSVE 737

Query: 882  KLLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQS 941
            +                           + IN  + L   E +   L           +S
Sbjct: 738  E-------------------------NANEINYHNKL-LTEQYTPKL-----------ES 760

Query: 942  KKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTE-KELQKVQ 1000
             +E+I  ++  I  I  +++ +Q +    LT+++G     +++    + R + KELQ++Q
Sbjct: 761  LQEEIQAIENSISSITAEKVSLQETIFKELTDKVGFSIQDYERYSGDLMREQSKELQQLQ 820

Query: 1001 RLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIK 1060
            +            +N    LQ        RL+ TE ++   L   +      +SL+E+  
Sbjct: 821  K----------QILNIKNKLQFE----SERLKTTEGKYHASLESLESAKSNLQSLEEEEN 866

Query: 1061 DMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSL-------NQELQSY-HVRD-VTQ 1111
            + ++   + +    E + +L +L  + D  + D  +L       N ELQS  H R+ + +
Sbjct: 867  ECQQKRKQIEQHISEDEAELNRLQRVYDARQLDFNNLDDVLAEYNNELQSLKHNRNQIRE 926

Query: 1112 SLEKIQNENANNSVGVKQSS--NNL------DVSSSHTPNVDKHD-DEISMEDADNDSQN 1162
             +EKI  E     VGV ++    N+      D++ S+ P +DK D D I++        N
Sbjct: 927  DMEKIDLER----VGVLKNCKITNMEIPILSDINLSNLP-IDKIDEDTIAI-------SN 974

Query: 1163 EIEEKEQDADIMDLDNVTEEVSKGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXX 1222
            EI     D D  DL           P               E+ I  ++D +     +  
Sbjct: 975  EI-----DVDYNDL-----------PAKYKESSATTIREELENHIRSIEDTLNVLQPNAR 1018

Query: 1223 XXXXXXXXXXXFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQ 1282
                       F+  + +     AR  +   +  K+KK R + F   F  ++  L  +Y+
Sbjct: 1019 AVERFDDAQERFEVVEKETEDLKAREKKALTQFLKIKKRRRELFENAFDFVNEHLDPIYR 1078

Query: 1283 MITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLA 1333
             +T          GGNA L L D  +PF+ G+ +  MPP K ++++  LSGGEKT+++LA
Sbjct: 1079 ELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYHAMPPLKRFKDMEYLSGGEKTVAALA 1138

Query: 1334 LVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQ 1392
            L+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     + QFIVISL+N MFE +  
Sbjct: 1139 LLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPDLQFIVISLKNTMFEKSDA 1198

Query: 1393 LVGIYKR 1399
            LVG+Y++
Sbjct: 1199 LVGVYRQ 1205

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  175 bits (444), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 201/776 (25%), Positives = 350/776 (45%), Gaps = 146/776 (18%)

Query: 674  GFHGRLGDL-GVIADKYDIAISTACSR-LDDIVVDSVECGQQCIEYLRKNKLGYARFILL 731
            G  G + DL     +KY +A+ST   +  D +VVD++   Q+CI YL+K + G   FI L
Sbjct: 522  GVKGLVSDLCHPKKEKYALAVSTILGKNFDSVVVDTLSVAQECITYLKKQRAGIISFIPL 581

Query: 732  DKLRNFQLGQLQTPENVLRLFDLVQPIDL--KFSNAFYSVLRDTLVATDIRQANRVAYGK 789
            D +  F +  L T  N+  +  ++  ID   ++  A   V  D+++   +  A  + +  
Sbjct: 582  DTIDAF-VPTLPTT-NIQGITLVLNAIDYDQEYDKAMQYVCSDSIMCDTLSIAKSLKWKH 639

Query: 790  R-RYRVVTLDGKLIDISGTMTGG-----GSHVSK----GLMKLKNSNMEHLEVYEAGDVE 839
                ++VTL+G LI  +G MTGG     G+   K    GL+ LK+  +  +E        
Sbjct: 640  NVTSKLVTLEGTLIHRAGLMTGGVSKEQGNRWDKEEYQGLVTLKDKLLIQIE-------- 691

Query: 840  KIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSXXXXXXXXXX 899
                   +  NN K      +++ + + +L     ++  +I++                 
Sbjct: 692  -------QLSNNSKTFAIEARDLESNISQLNSSISDLRTQISQ----------------- 727

Query: 900  XXXXXXXXYTDVINKKDPLDRAEAFLQ--TLRNEHRALEDQSQSKKEKINTLKEEIMKIG 957
                        IN+    ++AE       L+ E+   ++Q  +K E I   K EI  IG
Sbjct: 728  ------------INRSIEENKAEVQYHEDMLKKEYEPKQNQLNTKLESIEKSKSEI--IG 773

Query: 958  GKELQIQNSKVSSLTERIG--IVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVN 1015
             KEL +QN+       ++G  I   +H   +A ++++ KELQ++++            +N
Sbjct: 774  QKEL-LQNTVFKEFHNKLGFTIQEYEHHSGEA-LRQSNKELQQLEK----------QVLN 821

Query: 1016 DLETLQTNVIAIRTRLQETE-----AEFDIILNEKDDLTGQCESLKE-------KIKDME 1063
                LQ  V     R + TE     A+ D+     ++     ESL+E       KIKD+E
Sbjct: 822  IESKLQFEV----ERYESTEKRHKKAQIDL-----ENNNSTIESLQENEAEVVAKIKDIE 872

Query: 1064 ESMNEYKSFEIEIKNKLEKLNSLLDYCKK------DIRSLNQELQSYHVRDVTQSLEKIQ 1117
              M       +EIK  LE  +  +D  KK      D  S   EL +    +     E+I+
Sbjct: 873  NGM-------LEIKKVLEDFSKEIDRKKKKLAIAEDSLSEKSELLTTSTNEKISIKEEIE 925

Query: 1118 NENANNSVGVKQSSNNLDVSSSHTPNVDKHD-DEISMEDADNDSQNEIEEKEQDADIMDL 1176
             ++    +G+     N  +S+   P   K D + + +   DND+            I+  
Sbjct: 926  KKDLEK-LGI---LTNCKISNIQVPVASKIDLNNLPIGKIDNDA------------IL-- 967

Query: 1177 DNVTEEVS---KGIPXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXX 1233
              ++ E+S   K +P               E EI  ++D +++   +             
Sbjct: 968  --ISNEISLDYKTLPAKYKESSSSKIRSALEHEIEVVEDLLQDLQPNARAVDRFDEAKER 1025

Query: 1234 FKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMIT-------- 1285
            F     +  T   +  ++  +   +KK R + F + F  +S  ++ +Y+ +T        
Sbjct: 1026 FDSASDETETLKKQERKLLTQFLAIKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAE 1085

Query: 1286 -MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPT 1344
              GGNA L L D  +PF  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+
Sbjct: 1086 LSGGNASLTLEDEDEPFDAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPS 1145

Query: 1345 PLYVMDEIDAALDFRNVSIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGIYKR 1399
            P +++DE+DAALD  N+  +ANYI++ +  + QFIVISL+N+MFE +  LVGI+++
Sbjct: 1146 PFFILDEVDAALDVTNIERIANYIRKHSNSDIQFIVISLKNSMFEKSDALVGIHRQ 1201

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  149 bits (376), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 184/701 (26%), Positives = 325/701 (46%), Gaps = 64/701 (9%)

Query: 146 LVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLI 205
           L L +FKSY G   VG  +++F++I+GPNGSGKSN++D++ FV G R++ +R + + DLI
Sbjct: 7   LELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVKDLI 66

Query: 206 HKSEAFPN--------IQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKY 257
           ++     N        + S  V+  ++    ++       ++R P+ +MR    N  + Y
Sbjct: 67  YRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDER-PVELMRAISTNGDTTY 125

Query: 258 YINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDI 317
            INGK   Y E +  L+ E I +  K FL+ QG+VE IA             L +  E++
Sbjct: 126 KINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPM-------DLSKLFEEV 178

Query: 318 IGTSKYKTLIEDKMVEIEALNEICVEK-EKRFEI---VETEKNSLESDKDAALEFIAKEK 373
            G+ +YK   ++   +IE LN+   E    R  I   ++T K  +  D++     I K K
Sbjct: 179 SGSIQYKKEYDELKEQIEKLNQSAAESIRNRRRIHGELKTYKEGITKDEEYK-NNIEKRK 237

Query: 374 QLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREAN 433
           +  +    L  ++LY    +   +LD + N K+ + + ++K    +  + +S     + N
Sbjct: 238 KYYMY---LVLWQLYHLENEKKKSLDNLKNAKSEISQLKNKITNEEKNLQRSKSSFLKEN 294

Query: 434 EKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHDKRI-EIQKN-ESI 491
            K+N          +K+ + + Q    ++ +++L     K  +    KRI  I+K  ESI
Sbjct: 295 LKVN----------KKREQLNYQLKEKDKLLEDLNS--IKIPQRAASKRINNIEKRIESI 342

Query: 492 LKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXXXXXQISLYEKDIEPWVSK 551
            KD++  Q  Y + F N  K + K +                   + SL + D++ + S 
Sbjct: 343 QKDIE-RQQGYINTFENQLKVVTKAK----ESFEREIKESAQNSNKYSLSDDDLKLYES- 396

Query: 552 IQEKQV--QIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSII-ENLKKEQ 608
           + EK +       E +ISLL   + ++ E +  L  +ID  +K I  +  I  E ++ E 
Sbjct: 397 LNEKYLMENGSAIEQQISLLNNDKQEVLEEMDRLNRKIDASKKRITEELLISQERIQNEN 456

Query: 609 VSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTVLSALTR--- 665
           + L   ++   S  S    + K ++  + S   +  D    L     K   L+A  R   
Sbjct: 457 IELVSSLNEKNSIFSEKTHELKTLQAEIESSNNQEYDTNYKLRETLLKLDDLNANQRESI 516

Query: 666 LQKSGRIN---------GFHGRLGDLGVI-ADKYDIAISTACSR-LDDIVVDSVECGQQC 714
            +K  R N         G  G + DL     DKY +A+ST   +  D I+VD++   Q+C
Sbjct: 517 KEKKLRENVTMLKRFFPGVRGLVHDLCRPKKDKYGLAVSTILGKNFDSIIVDNLNVAQEC 576

Query: 715 IEYLRKNKLGYARFILLDKLRNFQLG-QLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDT 773
           I + +K + G A FI LD + + Q    L + ++ +   + ++  D ++  A   V  D+
Sbjct: 577 IAFFKKQRSGTASFIPLDTISSEQPTLNLPSSQDYILTINAIE-YDPEYERAMQYVCSDS 635

Query: 774 LVATDIRQANRVAYGKR-RYRVVTLDGKLIDISGTMTGGGS 813
           ++   +  A  + + K  R ++VT++G LI  +G MTGG S
Sbjct: 636 IICNSLDIARDLKWNKGVRSKLVTIEGALIHKAGLMTGGIS 676

 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 99/153 (64%), Gaps = 10/153 (6%)

Query: 1257 KLKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTF 1307
            K+KK R + F   F  +S  L  +Y+ +T          GGNA L L D  +PF+ GV +
Sbjct: 1061 KIKKKRKELFENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRY 1120

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1367
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A Y
Sbjct: 1121 HATPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAY 1180

Query: 1368 IKER-TKNAQFIVISLRNNMFELAQQLVGIYKR 1399
            I+     N QFIVISL+N MFE +  LVG++++
Sbjct: 1181 IRRHGNPNLQFIVISLKNTMFEKSDALVGVFRQ 1213

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  146 bits (368), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 69/170 (40%), Positives = 111/170 (65%), Gaps = 12/170 (7%)

Query: 1251 VRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVDSLDPF 1301
            V ++  K+++ R D F   F  +S  + ++Y+ +T          GGNA L L D  +P+
Sbjct: 1052 VNEQFAKIRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPY 1111

Query: 1302 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1361
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV
Sbjct: 1112 LAGIRYHATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNV 1171

Query: 1362 SIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGIYK--RSNMTQSATL 1408
              +A YI++R   N QFIVISL+N MFE +Q LVG+++  R N +++ TL
Sbjct: 1172 ERIATYIRQRALSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTL 1221

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 94/186 (50%), Gaps = 20/186 (10%)

Query: 148 LQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHK 207
           L +FKSY G   +G   ++F++++GPNGSGKSN++D++ FV G ++  +R   L DLI++
Sbjct: 9   LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 208 SEAFPNIQSCSVEVHFQYVID-ENDGTSKII--------EDRKPLVVMRKAFKNNSSKYY 258
                 +Q    +  +    D EN+ +S  +        ++     + R    +  S Y 
Sbjct: 69  G----TLQDGDADSGYSETHDNENNPSSAYVKAFYSPSGQENDVAELTRTITLSQESTYK 124

Query: 259 INGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDII 318
           +NG+  ++ +    L+ E I +  + FL+ QG+VE +A  K +        L    E + 
Sbjct: 125 LNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------LTTLFEQVS 177

Query: 319 GTSKYK 324
           G+ +YK
Sbjct: 178 GSIQYK 183

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  144 bits (363), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 117/175 (66%), Gaps = 12/175 (6%)

Query: 1246 ARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVD 1296
            A+  +V ++  ++K+ R + F + F  +S ++ E+Y+ +T          GGNA L L D
Sbjct: 1044 AKEKKVNEDFTRIKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLED 1103

Query: 1297 SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1356
              +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAAL
Sbjct: 1104 EDEPYLAGIRYHATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAAL 1163

Query: 1357 DFRNVSIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGIYK--RSNMTQSATL 1408
            D  NV  VA+YI+ +   + QFIVISL+N MFE +Q LVG+++  ++N +++ TL
Sbjct: 1164 DISNVERVASYIRRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTL 1218

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 144/290 (49%), Gaps = 41/290 (14%)

Query: 146 LVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLI 205
           L L +FKSY G   +G  +++F++I+GPNGSGKSN++D++ FV G ++  +R   L DLI
Sbjct: 7   LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 206 HK--------------SEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFK 251
           ++              SE  PN  S  V+  +    +E+D    ++E      + R   +
Sbjct: 67  YRGTLSEEEASSADFESENHPN--SAYVKAFYSPSNNEDD----VVE------LSRTVTR 114

Query: 252 NNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLL 311
           +  S Y I+GK   Y + ++ L+ E I +  + FL+ QG+VE +A  K +        L 
Sbjct: 115 SQESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-------LT 167

Query: 312 EYLEDIIGTSKYKT---LIEDKMVEIEALNEICVEKEKRFEI-VETEKNSLESDKDAALE 367
           +  E + G+ +YK     I +++    +    C++  KR  I +++ K  ++ D+    E
Sbjct: 168 DLFEQVSGSLQYKQDYDRIREELERARSETSDCIQSRKRAHIGLKSFKEGVDKDE----E 223

Query: 368 FIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEK 417
           +    +    L+ +L  ++L+    K    +DK+ + K  LQ  +S + +
Sbjct: 224 YRKHLEDRNNLQQQLIVWQLFHLQAKRENLIDKLKHSKEVLQNLQSNFNR 273

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 134/570 (23%), Positives = 242/570 (42%), Gaps = 134/570 (23%)

Query: 569  LKESQAKLKEGLGS----LKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSR 624
            L  S+ KL E LGS    L++E+ D+ K  D K+       K+   LK+  S  ES  +R
Sbjct: 429  LDSSKEKLAEELGSEKENLEIEVQDITKSFDKKSHETSRTVKK---LKELQSRAESNNNR 485

Query: 625  AKEKEKEMRVILNSHRQRAIDARSALHMAENKSTVL----SALTRLQKSGRINGFHGRLG 680
              E   +++  L       +D  +A+     K   L    S L RL       G  G + 
Sbjct: 486  EYEINYKLKETLTK-----LDDMNAVQRESAKEKKLRENVSMLRRL-----FPGVRGLVH 535

Query: 681  DLG-VIADKYDIAISTACSR-LDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQ 738
            DL     +K+ +A+ST   +  D ++VD+    QQC+ +L+K + G   FI LD +   +
Sbjct: 536  DLCHPKKEKFAVAVSTVLGKNFDAVIVDNFLVAQQCVSFLKKQRSGVVSFIPLDTVDVSK 595

Query: 739  LGQLQTP-ENVLRLFDLV--QPIDLKFSNAFY---SVLRDTL-VATDIRQANRVAYGKRR 791
            +  + +  +  +   D +  +P DL+ +  +    S++ DTL +A D++  + +     R
Sbjct: 596  VPMIASEFKGCILAIDAIDYEP-DLERAMQYVCSDSIICDTLQIAKDLKWKHNI-----R 649

Query: 792  YRVVTLDGKLIDISGTMTGGGSHVS---------KGLMKLKNSNMEHLEVYEAGDVEKIE 842
             ++V+++G ++  +G MTGG S            + LM LK+  ++ L    A  +   E
Sbjct: 650  SKLVSINGSIVHRAGLMTGGASKGGNNRWDKEEYQSLMSLKDVFLKELSELSAASISDAE 709

Query: 843  RDLAERENNFKIAHDTLQEMNNEL----KRLQDKEPEIELEIAKLLMDVDSXXXXXXXXX 898
            R +   EN+  I +  L  +  +L    + L++KE EI+ +I                  
Sbjct: 710  R-IRILENDLSILNTDLMSLKTQLAQSKRMLKEKETEIQYQI------------------ 750

Query: 899  XXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIGG 958
                                D AE            +E + ++ K+ ++   +EI  +  
Sbjct: 751  --------------------DLAEG----------EIEPRIKTLKDDLHRYNQEIADLEK 780

Query: 959  KELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDLE 1018
            ++ ++QNS  + +   +G    +++     I            L KQAE        DL 
Sbjct: 781  QKAKLQNSVYADVFRDVGFTAVEYEMHSGII------------LKKQAE--------DLR 820

Query: 1019 TLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIK-----DMEESMNEYKSFE 1073
             LQ  +++I  +L E E E      E+     Q +  K KIK     + EES+N     +
Sbjct: 821  KLQMQMVSIDKKL-EFEVERLHATQERQQ-KAQVDLEKAKIKLEALNNDEESIN----LK 874

Query: 1074 IEIKNKL-----EKLNSLLDYCKKDIRSLN 1098
            IE++ ++     ++L+SL D   +++  LN
Sbjct: 875  IEMEERIIDEEQKQLDSLQDEASQNLAGLN 904

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  143 bits (361), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 118/450 (26%), Positives = 214/450 (47%), Gaps = 39/450 (8%)

Query: 963  IQNSKVSSLTERIGIVNAKHKKDKATIKRTE-KELQKVQRLFKQAELDNTACVNDLETLQ 1021
            +QN+     T +IG    +++     + R + KELQ++Q+     E       N L+   
Sbjct: 784  LQNNIFKEFTSKIGFTIKEYENHSGELMRQQSKELQQLQKQILTVE-------NKLQFET 836

Query: 1022 TNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIKNKLE 1081
              +   + R ++ + + +    E   L  Q  +++ KI  +E  + E+K+   E++ K  
Sbjct: 837  DRLSTTQRRYEKAQKDLENAQVEMKSLEEQEYAIEMKIGSIESKLEEHKNHLDELQKKFV 896

Query: 1082 KLNSLLDYCKKDIRSLNQELQSY-HVRD-VTQSLEKIQNENANNSVGVKQSSNNLDVSSS 1139
               S L+  +  +  +N  LQ     RD + + +EK   E        K S+ N+ +SS 
Sbjct: 897  TKQSELNSSEDILEDMNSNLQVLKRERDGIKEDIEKFDLERVTALKNCKISNINIPISSE 956

Query: 1140 HTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTEEVSKGIPXXXXXXXXXXX 1199
             T       D++ +   DN++             + + N  +   KG+P           
Sbjct: 957  TTI------DDLPISSTDNEA-------------ITISNSIDINYKGLPKKYKENNTDSA 997

Query: 1200 XXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRKLDLNTTVARRDEVRDELEKLK 1259
                E +I+++++ +     +             F+    +     A   ++ ++  K+K
Sbjct: 998  RKELEQKIHEVEEILNELQPNARALERYDEAEGRFEVINNETEQLKAEEKKILNQFLKIK 1057

Query: 1260 KTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVM 1310
            K R + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +   
Sbjct: 1058 KKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHAT 1117

Query: 1311 PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-K 1369
            PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI +
Sbjct: 1118 PPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRR 1177

Query: 1370 ERTKNAQFIVISLRNNMFELAQQLVGIYKR 1399
             R  + QFIVISL+N MFE +  LVG+Y++
Sbjct: 1178 HRNPDLQFIVISLKNTMFEKSDALVGVYRQ 1207

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  140 bits (353), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 65/164 (39%), Positives = 113/164 (68%), Gaps = 10/164 (6%)

Query: 1246 ARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVD 1296
            A+  ++R++  K+K++R + F + ++ +S  + ++Y+ +T          GG+A L L D
Sbjct: 1047 AKEKKIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLED 1106

Query: 1297 SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1356
              +P+  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAAL
Sbjct: 1107 EDEPYLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAAL 1166

Query: 1357 DFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKR 1399
            D  NV  +A YIK   + N QFIVISL+N+MFE +Q LVG++++
Sbjct: 1167 DNTNVEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQ 1210

 Score = 96.3 bits (238), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 99/192 (51%), Gaps = 28/192 (14%)

Query: 146 LVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLI 205
           L L +FKSY GT  VG  + +F++I+GPNGSGKSN++D++ FV G R++ +R   L DL+
Sbjct: 7   LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 206 HKSEAFPNIQSCSVEVHFQ-------------YVIDENDGTSKIIEDRKPLVVMRKAFKN 252
           ++     + +    E                 + + E + +        P+  MR   ++
Sbjct: 67  YRGRRTGDEEESMEEEPSSSKISSTRSAYVKAFYLKEGEES--------PIEFMRTISRS 118

Query: 253 NSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLE 312
             S Y +NGK   Y + T +L++E I +  + FL+ QG+VE IA   A     G+  L +
Sbjct: 119 GESAYKVNGKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIASQSA-----GE--LTK 171

Query: 313 YLEDIIGTSKYK 324
             E I G+ +YK
Sbjct: 172 LFEQISGSVQYK 183

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  140 bits (352), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/162 (41%), Positives = 104/162 (64%), Gaps = 10/162 (6%)

Query: 1257 KLKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTF 1307
            K+KK R + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +
Sbjct: 1094 KIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSTVELAGGNASLTIEDEDEPFNAGIKY 1153

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1367
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A Y
Sbjct: 1154 HATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAY 1213

Query: 1368 I-KERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATL 1408
            I + R  + QFIVISL+N MFE +  LVG+Y++     S T+
Sbjct: 1214 IRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTV 1255

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 104/162 (64%), Gaps = 10/162 (6%)

Query: 1257 KLKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTF 1307
            K+K+ R + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +
Sbjct: 1060 KIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKY 1119

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1367
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A Y
Sbjct: 1120 HATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAY 1179

Query: 1368 I-KERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATL 1408
            I + R  + QFIVISL+N MFE +  LVG+Y++     S T+
Sbjct: 1180 IRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTI 1221

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  139 bits (349), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 101/153 (66%), Gaps = 10/153 (6%)

Query: 1257 KLKKTRHDEFMEGFSIISLTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTF 1307
            K+KK R + F + F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ +
Sbjct: 1053 KIKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRY 1112

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1367
               PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A Y
Sbjct: 1113 HATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAY 1172

Query: 1368 IKER-TKNAQFIVISLRNNMFELAQQLVGIYKR 1399
            I+     N QFIVISL+N MFE +  LVG+Y++
Sbjct: 1173 IRRHGNPNLQFIVISLKNTMFEKSDALVGVYRQ 1205

 Score = 98.6 bits (244), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 84/319 (26%), Positives = 154/319 (48%), Gaps = 43/319 (13%)

Query: 146 LVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLI 205
           L L +FKSY G+  +G   ++F++I+GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 206 HKS------------EAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNN 253
           ++              +  N  +  V+  ++             ++ K + +MR   +N 
Sbjct: 67  YRGVITGEDSESDEDGSVNNPSTAYVKAFYE-------------KENKTIELMRTISRNG 113

Query: 254 SSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEY 313
            + Y I GK  +Y + +  L+ E I +  K FL+ QG+VE IA        +    L   
Sbjct: 114 DTNYKIGGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIAS-------QSPMDLSRL 166

Query: 314 LEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEK 373
            E++ G+ +YK   +    ++E L++   E  K    +  E  + +   +   E+ +K  
Sbjct: 167 FEEVSGSIQYKKEYDQLKEKMEQLSKAATESIKNRRRIHGELKTYKEGINKDEEYKSKVA 226

Query: 374 QLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREAN 433
           +   L++ L  ++LY    K      KI+  KN + + +SK   ++ +I    R L+ A 
Sbjct: 227 KKKELQTILVLWQLYHLEQK------KINIMKN-MADTKSKMSVLKDKIHNEERNLQRA- 278

Query: 434 EKINASVAQERELVQKKRE 452
                S+A+E  ++ KK++
Sbjct: 279 ---KTSIAKEMSIITKKKD 294

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
           Ashbya gossypii AGL023W
          Length = 1222

 Score =  138 bits (348), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 201/710 (28%), Positives = 316/710 (44%), Gaps = 96/710 (13%)

Query: 146 LVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLI 205
           L L +FKSY GT  VG  N  F +IVGPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 206 HKS-------EAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYY 258
           ++        E   + +S  V+    Y+ D+N      IE       MR       S Y 
Sbjct: 67  YRGRMDDRSDEHVASPKSAYVKAF--YLKDDNGEQGTKIE------FMRIIQNTGDSVYR 118

Query: 259 INGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDII 318
           I+GK  ++      L+ E I +  + FL+ QG+VE IA             L +  E + 
Sbjct: 119 IDGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIASQSGIE-------LTKLFEQVS 171

Query: 319 GTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKE---KQL 375
           G+ +Y+        E E L E   +  + +      K  ++ D  +  E + KE   K L
Sbjct: 172 GSVQYQR-------EYERLKEEYQKATEEYGDSLKSKRKMQIDLKSFKEGVHKEQHYKNL 224

Query: 376 TLLRSKLT-QYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREANE 434
              R+KL  QY L+Q    L    D+ S   ++L++ +SK  +++S++      L     
Sbjct: 225 LSERTKLNRQYVLWQ----LYHLEDRRSGLISSLKDSKSKLAQLKSKLTNEEHILH---- 276

Query: 435 KINASVAQERELVQKKREYDGQCVSMEERIK-NLTQKKTKAEKTLHDKRI-EIQKNESIL 492
           K  +  A++  ++ +K+E   Q    +ER K N       + +    KRI  I+K    L
Sbjct: 277 KSKSQAAKDEIVITRKKEKLSQL--QQERSKLNSELLPVGSSRQSASKRINHIEKRIDSL 334

Query: 493 KDLQDYQMNYDSEFSNLQKELDKER-XXXXXXXXXXXXXXXXXXXQISLYEKDIEPWV-- 549
           K     Q +Y  +F N  K + K +                    Q+  YE   E ++  
Sbjct: 335 KRDITRQESYVQQFQNQLKVVTKAKDSLEIDIKASSSGKFNLSKEQLKEYESLKETYLCS 394

Query: 550 --SKIQEKQVQIQ-----LAESEISLLKE----SQAKLKEGLG----SLKVEIDDVRKEI 594
             S ++EK   +Q     L E EISL +     S++++   L      L++E+ +V + +
Sbjct: 395 GGSALEEKMTLLQNKREELLE-EISLYERRANISKSRISVELNVEREKLELELSEVTRVL 453

Query: 595 DNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAE 654
           ++KN+    L   +V   KEV   +S    A  KE E+   L     + +D  +A     
Sbjct: 454 NSKNA----LHSAKVKEWKEV---QSAIESANNKEYELNYKLKEVLVK-LDDLTADQRES 505

Query: 655 NKSTVL----SALTRLQKSGRINGFHGRLGDLGVI-ADKYDIAISTACSR-LDDIVVDSV 708
           NK   L    + L RL       G  G + DL     DKY +A+S+   +  D IVVDSV
Sbjct: 506 NKERKLRENVATLKRL-----FPGVKGLVHDLCRPKKDKYALAVSSMLGKNFDSIVVDSV 560

Query: 709 ECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTP----ENVLRLFDLVQPI--DLKF 762
              QQCI YL+K++ G A FI LD +       + TP     N+      V  I  D + 
Sbjct: 561 SVAQQCISYLKKHRSGAASFIPLDTI------DINTPTLPVRNLKGCILTVNAIEYDSEL 614

Query: 763 SNAFYSVLRDTLVATDIRQANRVAYGKR-RYRVVTLDGKLIDISGTMTGG 811
             A   V  D+++   +  A  + + +  + ++VT+ G LI  +G MTGG
Sbjct: 615 EKAMQYVCSDSIICDTLDIAKNLKWDRGIKSKLVTIQGALIHRAGLMTGG 664

 Score =  124 bits (312), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 103/169 (60%), Gaps = 10/169 (5%)

Query: 1250 EVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVDSLDP 1300
            E +++  K+K+ R   F+  F  ++  +  +Y+ +T          GG+A L L D  +P
Sbjct: 1043 ESKEKYLKIKEKRVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEP 1102

Query: 1301 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1360
            +  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N
Sbjct: 1103 YLAGIRYHATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTN 1162

Query: 1361 VSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATL 1408
            V  +A YIK   +   QFIVISL++N+F  +Q + G+++      S  +
Sbjct: 1163 VERIAAYIKRHASPKFQFIVISLKSNLFGKSQSMAGVFRNQQANSSMVI 1211

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  137 bits (346), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 101/153 (66%), Gaps = 10/153 (6%)

Query: 1257 KLKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTF 1307
            K+K+ R + F + F  +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +
Sbjct: 1058 KIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKY 1117

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1367
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A Y
Sbjct: 1118 HATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAY 1177

Query: 1368 I-KERTKNAQFIVISLRNNMFELAQQLVGIYKR 1399
            I + R  + QFIVISL+N MFE +  LVG+Y++
Sbjct: 1178 IRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQ 1210

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  137 bits (346), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 100/153 (65%), Gaps = 10/153 (6%)

Query: 1257 KLKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTF 1307
            K KK R + F   F  +S  +  +Y+ +T          GG+A L L D  +PF+ G+ +
Sbjct: 1056 KTKKKRKELFDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKY 1115

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1367
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A Y
Sbjct: 1116 HATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAY 1175

Query: 1368 I-KERTKNAQFIVISLRNNMFELAQQLVGIYKR 1399
            I K    + QFIVISL+N+MFE +  LVG+Y+R
Sbjct: 1176 IRKHGNPSLQFIVISLKNSMFEKSDALVGVYRR 1208

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 97/184 (52%), Gaps = 17/184 (9%)

Query: 146 LVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLI 205
           L L +FKSY G   VG   ++F++I+GPNGSGKSN++D++ FV G R++ +R   + DLI
Sbjct: 7   LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 206 HKSEAFP-----NIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYIN 260
           ++    P            + H  YV   +   SK  ++   + + R   KN  S Y I+
Sbjct: 67  YRG-VVPEEEDDGEGEGDGDAHRAYV---SAFYSKGPQE-STVELKRTISKNGDSTYQID 121

Query: 261 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGT 320
            ++  Y + +  L+ + I +  K FL+ QG+VE +A        +    L +  E++ G+
Sbjct: 122 RRQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVAS-------QSPLQLTKLFEEVSGS 174

Query: 321 SKYK 324
           ++YK
Sbjct: 175 AQYK 178

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  135 bits (341), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 129/470 (27%), Positives = 220/470 (46%), Gaps = 67/470 (14%)

Query: 963  IQNSKVSSLTERIGIVNAKHKKDKATIKRTE-KELQKVQRLFKQAELDNTACVNDLETLQ 1021
            +Q       T+++G    +++      KR + KELQ++Q+     E       N LE  +
Sbjct: 781  LQTQTFKEFTDKLGFSMKEYETHSGDAKRQQSKELQQLQKQILNVE-------NKLEFEK 833

Query: 1022 TNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYK----SFEIEIK 1077
              + +   RL++TE +   +  E   L  Q E +  + K +E+++ ++K      E E+K
Sbjct: 834  ERLTSTSNRLEKTETDMKKVFIELQSLQKQEEDVGVQTKKVEKAIKDHKIKLKKVEEELK 893

Query: 1078 NKLEKLN----SLLDYCKKDIRSLNQELQSYHVRDVTQS--LEKIQNENANNSVGVKQSS 1131
            NK   +N     L++Y    ++SL +E     V+DV +   LE+I               
Sbjct: 894  NKQRTMNLNDEQLIEY-NSSLQSLKRERD--EVKDVIEKGDLERIC------------VL 938

Query: 1132 NNLDVSSSHTPNVDKHD-DEISMEDADNDSQNEIEEKEQDADIMDL---DNVTEEVSKGI 1187
             N  +S+   P V   D   + ++  D ++     E E D D +     +N  E V KG 
Sbjct: 939  KNCKISNMQIPIVSDVDLQSLPIDRIDAEAIRTSNEIEIDYDALPAKYKENGGEAVEKGF 998

Query: 1188 PXXXXXXXXXXXXXXXESEINQLQDYVENSNADXXXXXXXXXXXXXFKKRKLDLNTTVAR 1247
                            E E+ Q+ + +     +             F    ++  T   +
Sbjct: 999  ----------------ERELKQVDEILNVLQPNAKATDRFNEAQQKFGS--INDETEQLK 1040

Query: 1248 RDE--VRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVD 1296
            +DE  V  +  K+K+ R   F E F  ++  +  +Y+ +T          GG+A L L D
Sbjct: 1041 KDEKKVLAQFIKIKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLED 1100

Query: 1297 SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1356
              +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAAL
Sbjct: 1101 EDEPFNAGIRYHATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAAL 1160

Query: 1357 DFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQS 1405
            D  NV  VA YI+     + QFIVISL+N MFE +  LVG+Y++  +  S
Sbjct: 1161 DTTNVERVATYIRRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQELNTS 1210

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 96/194 (49%), Gaps = 39/194 (20%)

Query: 146 LVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLI 205
           L L +FKSY GT  VG  +++F++I+GPNGSGKSN++D++ FV G R+  +R + L DLI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 206 HKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAF--------------- 250
           ++  A                 +E DG S ++ +  P     KAF               
Sbjct: 67  YRGVASE---------------EEGDGESDVVNN--PTTAYVKAFYSKGDSTIELSRSIS 109

Query: 251 KNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGL 310
           K   + Y +NGK  +Y      L++E I +  K FL+ QG+V  IA   A         L
Sbjct: 110 KGGDTTYRMNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIASQSAME-------L 162

Query: 311 LEYLEDIIGTSKYK 324
            ++ E+  G+ +YK
Sbjct: 163 TQFFEEFSGSIQYK 176

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  134 bits (337), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 101/152 (66%), Gaps = 12/152 (7%)

Query: 1258 LKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1308
            +KK R + F + F  ++  +  +Y+ +T          GGNA L L D  +P++ GV + 
Sbjct: 1052 IKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKYH 1111

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1368
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A YI
Sbjct: 1112 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERIATYI 1171

Query: 1369 KERTKNA--QFIVISLRNNMFELAQQLVGIYK 1398
             +R  N   QFIVISL+N+MFE ++ LVGIY+
Sbjct: 1172 -QRHGNPELQFIVISLKNSMFEKSEALVGIYR 1202

 Score =  129 bits (324), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 185/715 (25%), Positives = 330/715 (46%), Gaps = 106/715 (14%)

Query: 146 LVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLI 205
           L L +FKSY G   VG   ++F++I+GPNGSGKSN++D++ FV G +++ +R + L DLI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 206 HKS------------EAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNN 253
           ++             +  PN  S  V+  +Q    + D T ++         MR    + 
Sbjct: 67  YRGFLSGDDEDNNNEDVNPN--SAYVKAFYQ----KEDVTHEL---------MRSISNSG 111

Query: 254 SSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEY 313
            S Y IN K  +Y + T  L++E I +  K FL+ QG+VE IA        +    L + 
Sbjct: 112 DSTYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIAS-------QSTTDLTKL 164

Query: 314 LEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEK 373
            E++ G+ +YK   E+   ++E L++   E  K    +    N ++  KD   +    + 
Sbjct: 165 FEEVSGSIQYKKEYEELKEKVEKLSQSTAESIKNRRRI---NNEIKVYKDGITKDEKYKA 221

Query: 374 QLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREAN 433
           QL   R+ L    L+Q    L    +K S  KN L+E +SK  K++ ++    + L++A 
Sbjct: 222 QLEKRRNLLVYSSLWQ----LYHLDEKKSQSKNKLKEAKSKVSKLKEKLANEEKILQKAK 277

Query: 434 EKI---NASVAQERELVQ----KKREYDGQCVSMEERIKNLTQKKTKAEKTLH--DKRIE 484
             I    A++ + +  ++    +K +   Q + ++   +N T+K +  E+ +   ++ IE
Sbjct: 278 NSIVKDTAAITKYKNKLEYRSKEKEKLASQLIPIKVSQRNTTKKISNIERRIEGIERDIE 337

Query: 485 IQKN-----ESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXXXX---- 535
            QK+     ES LK +   + +++ E     K  DK R                      
Sbjct: 338 RQKSYVERYESQLKVVTKSKESFELEIKESAKNFDKYRLSDEDLVTYDALSEKYLSSGGF 397

Query: 536 ---XQISLYEKDIEPWVSKIQEKQVQIQLAESEIS--LLKESQAKLKEGLGSLKVEIDDV 590
               +ISL   D +    ++   + +I+LA+S+I+  L+ + +         L++EI ++
Sbjct: 398 DIDTKISLLNNDKQETSDEVAMFKNRIELAKSKIADDLVLQGE--------RLELEISEL 449

Query: 591 RKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKE-----KEKEMRVILNSHRQRAID 645
              ++ KNS    L  ++VS  K +  GE E +  KE     K +E  V L+       +
Sbjct: 450 TSSLNEKNS----LHSQKVSELKTLQ-GEIESTSNKEYDLNYKLRETLVKLDDLSASQRE 504

Query: 646 ARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVI-ADKYDIAISTACSR-LDDI 703
           + +   + EN    +S L RL       G  G + DL     +KY +A+ST   +  D I
Sbjct: 505 STNERKLREN----VSMLRRL-----FPGVRGLVSDLCQPKKEKYALAVSTILGKNFDSI 555

Query: 704 VVDSVECGQQCIEYLRKNKLGYARFILLDKLRN------FQLGQLQTPENVLRLFDLVQP 757
           + D++   Q+CI YL+K + G A FI L+ + +      F  GQ       +   + ++ 
Sbjct: 556 ITDNISVAQECIAYLKKQRAGVASFIPLESIESEVPTLPFSDGQ-----GCILTINAIE- 609

Query: 758 IDLKFSNAFYSVLRDTLVATDIRQANRVAYGKR-RYRVVTLDGKLIDISGTMTGG 811
            + ++  A   V  D+++   +  A  + +    + ++VTL+G LI  +G MTGG
Sbjct: 610 YEPEYERAMQYVCSDSIICDTLTIAKDLKWKHNVKSKLVTLEGALIHKAGLMTGG 664

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  133 bits (334), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 213/872 (24%), Positives = 363/872 (41%), Gaps = 119/872 (13%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRAN-KMRQD 199
           + +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++DS+ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRAS 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII--EDRKPLVVMRKAFKNNSSKY 257
            L DLI+K      +   SV +    V D  D +S  I  E    + V R+     +SKY
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTI----VFDNTDKSSSPIGFESYPKISVTRQIILGGTSKY 115

Query: 258 YINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDI 317
            ING  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+ 
Sbjct: 116 LINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEA 168

Query: 318 IGTSKY--------KTLI--EDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALE 367
            GT  +        KT+   E K+ EI  L E         E +E +   L + K A LE
Sbjct: 169 AGTRMFEDRREKAEKTMAKKETKLQEIRTLLE---------EEIEPKLEKLRNQKRAFLE 219

Query: 368 FIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTR 427
           F   +  L      L  Y+ Y   TK +T        K  LQ   ++ E++ + I ++  
Sbjct: 220 FQETQTDLEKTLRILNAYEYYDMATKNST-------IKETLQNSTARVEELNNFIQKTKN 272

Query: 428 ELREANEKINASVAQERELVQKKREYDGQCVSMEER------------------IKNLTQ 469
           E+   +E +     Q++E VQK    DG+   +E++                  ++N+ +
Sbjct: 273 EISNLDEDLKTIKIQKQEQVQK----DGKLSQLEKQENDLANEISRLKTALGISVENINE 328

Query: 470 KKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQ---KELDKERXXXXXXXXX 526
           +  K +K LH+    +QK E  L +      + +SEF++L    K L  +          
Sbjct: 329 ESYKLKK-LHEN---VQKFERDLSEKSVIYTSTESEFNDLNEGVKRLKGQFKAKEELLST 384

Query: 527 XXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVE 586
                       S Y   +    +K+ + Q+ I+ +  +I +LK+  A  +  +   + E
Sbjct: 385 LTTGISSTGGTDSGYNSQLSAAKTKLNDAQICIKRSTMKIDMLKKESAINEPKIAHAERE 444

Query: 587 IDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDA 646
            +   +EI     + ENLK +      ++          K+KE ++R   N   Q + D 
Sbjct: 445 NEQNIREIKGYEQVCENLKAQL----NDLGFNPMMIKDLKQKEFKLR---NESYQLSNDT 497

Query: 647 RSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAIS---TACSRLDDI 703
                   N     S  +       + G   +L  L    + +D A +    A  RL ++
Sbjct: 498 EHLRRKTANLEFTYSTPSANFDPKSVKGVAAQLFTLE--KENFDSATALQVCAGGRLFNV 555

Query: 704 VVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKF- 762
           VVD+     Q +E  R  K      I L+K+ +  L      EN L+L   V P +++  
Sbjct: 556 VVDNEVTASQLLERGRLRK--RVTIIPLNKIASRTLN-----ENALKLAKSVAPGNVELA 608

Query: 763 ----------SNAFYSVLRDTLVATDIRQANRVAYGKR-RYRVVTLDGKLIDISGTMTGG 811
                     S A   +   +L+  D   A RV +  + R R +TLDG + D  GT++GG
Sbjct: 609 LNLIGYEDEVSRAMEFIFGTSLICKDAETAKRVTFHPQIRARSITLDGDIYDPEGTLSGG 668

Query: 812 GSHVSKGLMKLKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQD 871
             +        KNS +  ++ + A      E +L  ++ N KIA    ++ + + K LQ+
Sbjct: 669 SRNT-------KNSLLIDIQTFNAASKRLNEMELELKQINSKIAE--YEQTSQKTKSLQN 719

Query: 872 KEPEIELEIAKLLMDVDSXXXXXXXX----XXXXXXXXXXYTDVINKKDPLDRAEAFLQT 927
              E+ L   KL +   S                       T  IN++  L  +E F Q 
Sbjct: 720 ---ELNLATHKLSLAKKSLAANSATQIIRRNNEISDEISSCTAEINRQTLL--SEEFEQE 774

Query: 928 LRNEHRALEDQSQSKKEKINTLKEEIMKIGGK 959
           +    + +E+ +Q K  K+  LKEEI  +  K
Sbjct: 775 IIKIQKDMEEFNQDKGSKLRELKEEITNLSKK 806

 Score = 72.4 bits (176), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 83/140 (59%), Gaps = 1/140 (0%)

Query: 1248 RDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1307
            + ++++ +EKL + + D  ++ +  +S+    ++  +     A+L   +  D  +EG+  
Sbjct: 1011 KTKIQETIEKLNEYKRDTLLKTWEKVSVDFGNIFGDLLPNSFAKLVPCEGKD-VTEGLEV 1069

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1367
             V        ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGSIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1368 IKERTKNAQFIVISLRNNMF 1387
            IK R K +QFIV+SL+  MF
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMF 1149

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  130 bits (328), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 104/169 (61%), Gaps = 10/169 (5%)

Query: 1250 EVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITM---------GGNAELELVDSLDP 1300
            E+  +   +KK R + F   F  ++  ++ +Y+ +T          GG A L L D  +P
Sbjct: 1055 EILTKFLNIKKKRKELFESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEP 1114

Query: 1301 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1360
            F+ GV +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  N
Sbjct: 1115 FNGGVKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDHTN 1174

Query: 1361 VSIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATL 1408
            V  +A YI K   K+ QFI+ISL+N MFE +  LVG++++     S  L
Sbjct: 1175 VERIAAYIRKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQTENSSKAL 1223

 Score = 99.8 bits (247), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 99/179 (55%), Gaps = 13/179 (7%)

Query: 146 LVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLI 205
           L L +FKSY GT  +G  +++F++I+GPNGSGKSN++D++ FV G R+N +R   + DLI
Sbjct: 7   LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 206 HKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESN 265
           H+S    + QS + +    YV        K+ +  +   +MR    +  + Y INGK ++
Sbjct: 67  HRS--VRDSQSSNDDPTSAYV----KAFYKVTDASEITELMRIVNLSGETIYKINGKTTS 120

Query: 266 YTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYK 324
           +   +  L +E I +  K FL+ QG+VE IA   +         L +  E + G+ +YK
Sbjct: 121 FKNYSDWLAKENILIKAKNFLVFQGDVETIASQSSLE-------LTKLFEQVSGSIQYK 172

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  129 bits (325), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 97/151 (64%), Gaps = 10/151 (6%)

Query: 1258 LKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1308
            +K  R + F   F  +   + ++Y+ +T          GGNA L + +  +P+  G+ + 
Sbjct: 1073 VKAKRKELFEACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYF 1132

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1368
              PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YI
Sbjct: 1133 ATPPLKRFKDMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYI 1192

Query: 1369 KERT-KNAQFIVISLRNNMFELAQQLVGIYK 1398
            K     NAQFIVISL+N MFE +Q LVGI++
Sbjct: 1193 KRNANPNAQFIVISLKNAMFEKSQSLVGIFR 1223

 Score =  129 bits (323), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 193/800 (24%), Positives = 349/800 (43%), Gaps = 116/800 (14%)

Query: 146 LVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLI 205
           L L +FKSY  T  VG   + F++I+GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 206 HK----------------------SEAFPNIQSCSVE------VHFQYVIDENDGTSKII 237
           ++                      SEA P   + S E      V   Y  D+ D      
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLD------ 120

Query: 238 EDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQ 297
              +P    R    +  S Y IN +  +Y +    L+ E I +  K FL+ QG+VE IA 
Sbjct: 121 ---EPTKFTRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIAS 177

Query: 298 MKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNS 357
                  +G + L   LE + G+  YK        + E L E        F      +  
Sbjct: 178 -------QGPESLTLLLEQVSGSINYKN-------DYEKLKEEHKLALAEFTDAHNSRKK 223

Query: 358 LESDKDAALEFIAKEKQLTL-------LRSKLTQYKLYQTNTKLATTLDKISNFK---NA 407
           +++D  +  E + +++Q          L+     ++L+    +    +D ++  K    A
Sbjct: 224 VQNDLKSFKEGVQRDEQYRTSLEIRDQLKHNFILWELFHILKRRKKLVDSLTVSKTETTA 283

Query: 408 LQEERSKYEKIQSEIDQSTRELREANEKINASVAQ---ERELVQKKREYDG-QCVSMEER 463
           L+ + S  E+I ++I  +T +      K+  ++ Q   E+  +Q      G + ++  +R
Sbjct: 284 LKNKLSDEERILTKIKSTTAKHELQLSKLKDTLVQLENEKTSLQSSLLPVGSERLATIKR 343

Query: 464 IKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXX 523
           I NL ++ +  +K +  ++  +++ E+ LK +   + +++ E  N+   L+K        
Sbjct: 344 IHNLEKRISSFKKDMERQQAYVKQFENQLKVVSKTKKSFEKELENIHANLNKFNLSEEDL 403

Query: 524 XXXXXXXXXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEIS--------LLKESQAK 575
                           L EK +    S I+EK   ++  E E++         LK ++ +
Sbjct: 404 KQYEL-----------LKEKYLSSGGSHIEEKLAILKNDEFELNEESELINKRLKTTRER 452

Query: 576 LKEGL----GSLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKE 631
           + + L     +L+ ++++V + +++KNSI     KE   ++  +   ES  ++  E    
Sbjct: 453 ISDELQVDVDALEADLNEVTQRLNDKNSIAAAKSKEWKGIQTNL---ESLKNKEYELNFS 509

Query: 632 MRVILNSHRQRAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLG-VIADKYD 690
           +R +L        D R      + +  V S L RL       G  G + DL     +KY 
Sbjct: 510 LRDVLLKIDDLNADQRETKKERKLRENV-SMLKRLYP-----GVKGLVHDLCHPKKEKYA 563

Query: 691 IAISTACSR-LDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTP-ENV 748
           IA+ST   +  D I+VDS+    +CI YL+K + G A FI LD +    +     P  NV
Sbjct: 564 IAVSTILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLDTI---DVNPPSLPVSNV 620

Query: 749 LRLFDLVQPIDLK--FSNAFYSVLRDTLVATDIRQANRVAYGKR-RYRVVTLDGKLIDIS 805
                 +  I+ +     A   V  D+++  ++  A  + + +  + ++VTL+G LI  +
Sbjct: 621 QGCLLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNGALIHKA 680

Query: 806 GTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGDV--EKIERDLAERENNFKIAHDTLQEMN 863
           G MTGG +         KN N  + + Y+   V  ++I  +L    + F+  +   +E+ 
Sbjct: 681 GQMTGGTAQ--------KNQNRWNKDEYQGLMVLKDQITEELTALSDKFRADNMKSRELE 732

Query: 864 NELKRLQDKEPEIELEIAKL 883
           NE+  L ++   +  +I +L
Sbjct: 733 NEISLLNNEISSLRTQITQL 752

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  128 bits (322), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 97/153 (63%), Gaps = 10/153 (6%)

Query: 1257 KLKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTF 1307
            K+KK R   F   F   S  +  +Y+ +T          GG+A L L D  +PF+ G+ +
Sbjct: 1047 KIKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRY 1106

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1367
               PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A Y
Sbjct: 1107 HATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAY 1166

Query: 1368 I-KERTKNAQFIVISLRNNMFELAQQLVGIYKR 1399
            I +   ++ QFIVISL+N MFE +  LVG+Y++
Sbjct: 1167 ISRHGNRDLQFIVISLKNTMFEKSDALVGVYRQ 1199

 Score =  109 bits (272), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 148/306 (48%), Gaps = 25/306 (8%)

Query: 146 LVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLI 205
           L L +FKSY GT  VG  +++F +I+GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7   LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 206 HKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESN 265
           ++            E    YV       +  ++    + + R   +N  ++Y +NGK   
Sbjct: 67  YRG-VEGEEDEEDGEGRTAYV------KAFYLKSDSTVELSRSISRNGDTQYKMNGKNCG 119

Query: 266 YTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKT 325
           Y +    L+EE I +  + FL+ QG+V  IA   A         L +  E+I G+ +YK 
Sbjct: 120 YKQYAEFLEEENILIKAQNFLVFQGDVVQIASQSAT-------DLTKLFEEISGSIQYKK 172

Query: 326 LIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQY 385
             +    ++++LN+   E  K    +  E  S     D   EF  + ++   L+     +
Sbjct: 173 EYDSLKGKVDSLNQSAAESIKNRRRIHGELKSYREGIDKNQEFYHQVEKRKELQRHYALW 232

Query: 386 KLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERE 445
           +LY   T+     DK++N KN+++  R K E  Q +I Q +R          AS A+E  
Sbjct: 233 QLYHLETQRHELEDKLANLKNSIKTIRGK-ETSQEQILQRSR----------ASFARESA 281

Query: 446 LVQKKR 451
            + K+R
Sbjct: 282 SILKQR 287

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  122 bits (307), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 98/152 (64%), Gaps = 10/152 (6%)

Query: 1257 KLKKTRHDEFMEGFSIISLTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTF 1307
            K+K+ R + F+  F+ +   +  +Y+ +T          GG+A L L D  +P+  G+ +
Sbjct: 1050 KIKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRY 1109

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1367
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A Y
Sbjct: 1110 HATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAY 1169

Query: 1368 IKER-TKNAQFIVISLRNNMFELAQQLVGIYK 1398
            I+   +   QFIVISL++N+F  ++ + G+++
Sbjct: 1170 IRRHASPKMQFIVISLKSNLFSKSESMAGVFR 1201

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score =  119 bits (297), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 181/748 (24%), Positives = 323/748 (43%), Gaps = 139/748 (18%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 199
           + I++L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  + + +R  
Sbjct: 1   MKIEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRAS 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYI 259
            L DLI+K      +   SV V F     + D +     +   + V R+     +SKY I
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTVVFDN--SDRDNSPIGFTNSPKISVTRQVVLGGTSKYLI 117

Query: 260 NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIG 319
           NG  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 320 TSKYKTLIEDKMVEIE---ALNEICVEKEKRF--EIVETEKNSLESDKDAALEFIAKEKQ 374
           T     + ED+  + E   A  E  +++ +    E +E +   L S+K   L+F   +  
Sbjct: 171 TK----MFEDRREKAERTMAKKETKLQENRALLAEEIEPKLEKLRSEKRIFLDFQTTQTD 226

Query: 375 LTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREANE 434
           L      ++ +  Y  N K      + S+F+  LQ+   K   ++ EI++ + E++  NE
Sbjct: 227 LERTSRVVSAFNYY--NMK-----HRQSSFEQTLQDSEDKCNHLKEEIEKVSEEIKSLNE 279

Query: 435 KINASVAQERELVQKKREYD--GQCVSMEERIKNLTQKKTKAEKTLHDKRIEIQKNESIL 492
            +      E   +QKK E D  G+ V+ E+   +L ++ ++ + TL  K   I + E   
Sbjct: 280 DL------EELKLQKKNEMDNEGRLVNFEKEESDLLKQISRIKTTLSIKNDSIDEAE--- 330

Query: 493 KDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXXXXXQISLYEKDIEPWVSKI 552
           K+LQ  ++N ++E   L KEL+                      Q +  EK+ E      
Sbjct: 331 KELQ--KLNSNNE--ELTKELE------------------MKLAQYTSTEKEYE------ 362

Query: 553 QEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEI------DD--------VRKEIDNKN 598
                   +A SE++ LKE Q K  E L +L   I      DD         +K++++  
Sbjct: 363 --------IANSELTRLKELQGKKSELLSTLSTGISSNGATDDGYSAQLVATKKKLNDTE 414

Query: 599 SIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSAL-------- 650
            +I+ L  ++  L+KE++  E +  +AK + ++   I+  + +   + RS L        
Sbjct: 415 VLIKKLNMKRSMLQKELASNEPKLFQAKREHEKSSKIMEQNEKYCGELRSQLASFGYDPD 474

Query: 651 ---HMAENKSTVLSALTRLQKSGRINGFHGRLGDL-----------------GVIAD--- 687
               + + +S V   L R  +         R+ ++                 GV A    
Sbjct: 475 LLKFLRKEESEVQQQLYRANEEAE--ALKRRVANIEFNYTRPSANFDPKSVKGVAAQLFT 532

Query: 688 ----KYDIAIS---TACSRLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKL------ 734
               ++D AI+    A  RL +I+VD+     Q +E  R  K      I L K+      
Sbjct: 533 VDQQQFDNAIALQVCAGGRLYNIIVDNEITASQLLERGRLKK--RVTIIPLSKIATRTLN 590

Query: 735 -RNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIRQANRVAYGKR-RY 792
                L +   P  V    +L+   D + S A   +  + LV  D   A +V +    R 
Sbjct: 591 KNTLALAKELAPGKVELALNLI-GYDDEVSKAMEFIFGNGLVCKDADTAKKVTFHPNIRT 649

Query: 793 RVVTLDGKLIDISGTMTGGGSHVSKGLM 820
           R +T  G + D  GT++GG  + ++ L+
Sbjct: 650 RSITQQGDVYDPEGTLSGGSRNTTRSLL 677

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMF 1387
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  110 bits (274), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 165/725 (22%), Positives = 305/725 (42%), Gaps = 97/725 (13%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 201
           +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 202 GDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLV-VMRKAFKNNSSKYYIN 260
            DLI+K      +   SV + F    + +   S I     P + V R+     +SKY IN
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFN---NTDKLNSPIGFTNSPQISVTRQVVLGGTSKYLIN 118

Query: 261 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGT 320
           G  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 321 SKYKTLIEDKMVEIEALNEICVEKEKRF--------EIVETEKNSLESDKDAALEFIAKE 372
                + ED+    E       +KE +         E +E +   L ++K   LEF + +
Sbjct: 172 K----MFEDRR---EKAERTMSKKETKLQESRTLLTEEIEPKLEKLRNEKRMFLEFQSTQ 224

Query: 373 KQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREA 432
             L      +  Y  Y  N K      K ++ +  L+   +  +K+   I +++ E+   
Sbjct: 225 TDLEKTERIVASYDYY--NIK-----HKHTSIRETLENGEAHMKKLNDFIRKTSEEIESL 277

Query: 433 NEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHDKRIEIQKNESIL 492
           NE I     Q+ + + K    +G+   +E +   L  + ++++ +L  K   +      L
Sbjct: 278 NEDIREIKHQKEKELHK----EGRIFKLEAQENGLLNEISRSKTSLSIKMENLNDTNGKL 333

Query: 493 KDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXXXXXQISLYEKDIEPWVSKI 552
           K +       +SE ++   +L++++                   Q  LY++  E  VS +
Sbjct: 334 KAV-------ESEIASASAKLNEKKTEYIKTEEDYKTAQGQLSKQRDLYKRK-EELVSTL 385

Query: 553 QEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSIIENLKKEQVSLK 612
                      + IS    +       L   K E++D+   I   N  +E LKKE ++++
Sbjct: 386 T----------TGISSTGAADGGYNAQLIKAKTELNDISLAIKKSNMKMELLKKELLAIE 435

Query: 613 --------------KEVSLGESECSRAKEKEKEMRV---ILNSHRQRAIDARSALHMAEN 655
                         K V   +  C+R + +  E       +   +QR  + +S  +   N
Sbjct: 436 PKLKNATMDNELNIKHVKDCQEVCNRLQAQLTEYGFDPSRIKDLKQRENELKSRYYQISN 495

Query: 656 KSTVLS-ALTRLQ----------KSGRINGFHGRLGDLGVIADKYDIAIST-ACSRLDDI 703
            S  L   +  L+          K+  ++G  G+L  L     +Y  A+ T A  RL ++
Sbjct: 496 DSEYLKRRVANLEFNYTTPYPDFKANFVHGVVGQLFQLDYDNIRYSTALQTCAGGRLFNV 555

Query: 704 VVDSVECGQQCIEYLRKNKLGYARFILLDKL-------RNFQLGQLQTPENVLRLFDLVQ 756
           VV   +   Q +E  R  K      I LDK+       +  +L +   P  V    +L++
Sbjct: 556 VVQDSQTATQLLERGRLRK--RVTIIPLDKIYARTINPQVLELAKTVAPGKVELAINLIK 613

Query: 757 PIDLKFSNAFYSVLRDTLVATDIRQANRVAY-GKRRYRVVTLDGKLIDISGTMTGGGSHV 815
             D   + A   +  ++L+  D   A ++ +  K R R +TL G + D  GT++GG  + 
Sbjct: 614 -FDKTVTKAMEFIFGNSLICEDPETAKKITFHPKIRIRSITLQGDVYDPEGTLSGGSKNT 672

Query: 816 SKGLM 820
           S  L+
Sbjct: 673 SDSLL 677

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1316 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQL 1393
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score =  108 bits (270), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 164/732 (22%), Positives = 309/732 (42%), Gaps = 131/732 (17%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 199
           + +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAS 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKI-IEDRKPLVVMRKAFKNNSSKYY 258
            L DLI+K      +   SV + F    +++   S I  E    + V R+     +SKY 
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTIVF---TNDDKANSPIGFESYPKISVTRQIVLGGTSKYL 116

Query: 259 INGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDII 318
           ING  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  
Sbjct: 117 INGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAA 169

Query: 319 GTS-------KYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAK 371
           GT        K +  +  K  +++ +  + +E+      +E + N L ++K A LEF  +
Sbjct: 170 GTKMFEDRREKAERTMNKKETKLQEIRTLLIEE------IEPKLNKLRNEKRAFLEF--Q 221

Query: 372 EKQLTLLR-SKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELR 430
           E Q    + S++     Y T   LA +     NF+   +   S+ E+++  I ++ + + 
Sbjct: 222 ETQSDFEKTSRIVNAFTYST---LAQSR---KNFEETFKSNESRIEQLEEAIQKTRQGMT 275

Query: 431 EANEKINASVAQERELVQKKREYDGQCVSMEERIKN--------LT----------QKKT 472
              E ++ +  Q+R  + K  +  GQ  ++E ++ N        LT           ++ 
Sbjct: 276 NLEEDLDVARTQKRNEMGKNGKL-GQLEALENQLNNDLSRLKASLTITTDNLNEENVRRE 334

Query: 473 KAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXX 532
             E+++ D    ++KN +  K+ +D  ++ ++  SNL+K+L  +                
Sbjct: 335 SLERSICDYESSLEKNTTHSKNTEDEYLSLNNLVSNLEKQLQTKEELLSTLTTGISSTGA 394

Query: 533 XXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRK 592
                 S Y   +    ++  + QVQ+Q                        ++ID +RK
Sbjct: 395 TT----SGYNLQLSSAKARFNDAQVQVQ---------------------RFGMKIDLLRK 429

Query: 593 EIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQR-AIDARSALH 651
           E+      +   K      KKE+     +CS+           LN+H ++   +      
Sbjct: 430 ELSANEPKLAKAKSICEEAKKEIEAHRMQCSK-----------LNAHLEKLGFNPDLFKQ 478

Query: 652 MAENKSTVLSALTRLQKSGRINGFHGRLGDL-----------------GVIA-----DKY 689
           + E +ST+  ++ +L  S  +     R+ ++                 GV A     D+ 
Sbjct: 479 LKEEESTLRQSIYKL--SSEMESLKRRVANIEFTYSKPSENFNPSSVKGVAAQLFSLDEK 536

Query: 690 DIAISTA---CS--RLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQ- 743
           + + +TA   C+  RL ++VVD+     Q +E  R  K      I L+K+    L Q   
Sbjct: 537 NYSSATALQVCAGGRLFNVVVDNEGTASQLLERGRLRK--RVTIIPLNKISARSLHQNAV 594

Query: 744 ------TPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIRQANRVAYGKR-RYRVVT 796
                  P NV    +L+   + + S A   +   +L+  D   A +V +  R R R +T
Sbjct: 595 KAAKELAPGNVELALNLI-GYEEEVSKAMEFIFGTSLICQDAETAKKVTFHPRVRARSIT 653

Query: 797 LDGKLIDISGTM 808
           L G + D  GT+
Sbjct: 654 LQGDIYDPEGTL 665

 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 88/146 (60%), Gaps = 2/146 (1%)

Query: 1243 TTVAR-RDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPF 1301
            TT+ + + +++D + KL + + +  ++ +  +++   +++  +     A+L  ++  D  
Sbjct: 1005 TTIEKDKTKIQDTIAKLNEYKRETLIKTWEKVTVDFGQVFSELLPNSFAKLVPLEGKD-V 1063

Query: 1302 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1361
            +EG+   +        ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEVKIQLGNIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHT 1123

Query: 1362 SIVANYIKERTKNAQFIVISLRNNMF 1387
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
            {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
            YFR031C SMC2 Component of the condensin complex essential
            SMC chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score =  108 bits (270), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 233/1043 (22%), Positives = 438/1043 (41%), Gaps = 160/1043 (15%)

Query: 143  IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 201
            I++L++  FKSYA   ++  ++  F+AI G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3    IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 202  GDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKI-IEDRKPLVVMRKAFKNNSSKYYIN 260
             DLI+K      +   SV + F  +   +   S I  E+   L V R+     +SKY IN
Sbjct: 63   QDLIYK-RGQAGVTKASVTIVFSNL---DPKCSPIGFENSPKLSVTRQIILGGTSKYLIN 118

Query: 261  GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGT 320
            G  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119  GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 321  SKYKTLIEDKMVEIE---ALNEICVEKEKRF--EIVETEKNSLESDKDAALEFIAKEKQL 375
                 + ED+  + E      E+ +++ +    E +E +   L ++K   LEF   +  L
Sbjct: 172  K----MFEDRKGKAERTMGKKELKLKENRTLLQEEIEPQLEKLRNEKRIFLEFQEIQTDL 227

Query: 376  TLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREANEK 435
              ++  +  Y+ +       + + K S+ K  L    S+  ++   I ++  E+    E 
Sbjct: 228  EKIQRIVLAYEYH-------SLVGKQSSIKETLDTGESRMAELHGLISKTGEEVMHLTED 280

Query: 436  INASVAQERELVQKKREYDGQCVSMEER----IKNLTQKKT----------KAEKTLHDK 481
            +N  +  E+   QK+ + DG+   +E++    + NL++ +           +  K L   
Sbjct: 281  LN-RINYEK---QKELDSDGKLGKLEKQESTLMNNLSRLRASFDICVENINETAKNLEST 336

Query: 482  RIEIQKNESILKDLQDYQMNYDSEFSNLQ---KELDKERXXXXXXXXXXXXXXXXXXXQI 538
            +  I+ N+  L++  +   N ++E+ +L    KEL +                       
Sbjct: 337  KANIKTNKGKLEEKSEAWKNMEAEYRHLNKKGKELKESHSKKSELLSTLQTGISSVGTTG 396

Query: 539  SLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKN 598
              Y + +      +QE ++ +Q +  +I  L +     K  L   +++ ++   +I    
Sbjct: 397  GGYTEQLAATKGNLQEAEIVVQKSRLKIEHLNKELHANKPKLEKARMDNEEGLNQIKKHK 456

Query: 599  SIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVIL-NSHRQRAIDARSALHMAENKS 657
            SI +   +E      + S+        ++KE  MR  L N  R+     RS  ++  N +
Sbjct: 457  SIQDTFTEELNRYGYDPSV----VKELRQKEYSMRQELHNVGRETEYLRRSVANIEFNYT 512

Query: 658  TVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAIS---TACSRLDDIVVDSVECGQQC 714
                          + G   +L  L    + YD A++    A  RL +++VD      Q 
Sbjct: 513  MPSEKF----DPNSVKGVAAQLFTLS--ENNYDSALALQVCAGGRLFNVIVDDQNTASQL 566

Query: 715  IEY--LRKNKLGYARFILLDKL-------RNFQLGQLQTPENVLRLFDLVQPIDLKFSNA 765
            +E   LRK        I L+K+        + +L +   P  V    +LV   + + S A
Sbjct: 567  LERGKLRKR----VTIIPLNKIATRVINSESLKLAKQLAPGKVQLALNLV-GYEEEVSKA 621

Query: 766  FYSVLRDTLVATDIRQANRVAYGKR-RYRVVTLDGKLIDISGTMTGGGSHVSKGLM---K 821
               +  ++LV  D   A R+ +  + R R +T  G + D  GT++GG  +    L+   +
Sbjct: 622  MEYIFGNSLVCNDAETAKRLTFHPQIRTRSITQQGDVYDPEGTLSGGSRNNKSTLLVDIQ 681

Query: 822  LKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIA 881
              NS  + ++V E  ++  I   L E+E+    A    +E+ N+L  +  K     L I 
Sbjct: 682  KYNSAAKRMKVLE-DELLVISNKLKEQES----ASAKTKEIQNKLNLVSHK-----LSIF 731

Query: 882  KLLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQS 941
            +  ++ +                    T +I + D L R          + R  E++ + 
Sbjct: 732  QRTLNENPA------------------TQIIKRNDDLTR----------QIRECEEEIEQ 763

Query: 942  KKEKINTLKEEIMKI----------GGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKR 991
            K+  ++ L++EI KI           G +L+    ++ SLT+ IG      K D  T K+
Sbjct: 764  KQSYMSQLQDEIRKIQDDMEEFNNDKGTKLEKLKKEIDSLTKEIG------KLDSITDKK 817

Query: 992  TEKELQKVQRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQ 1051
             +        L++  +L+        E L + + +    L+      D   N+K  L  +
Sbjct: 818  YD--------LYQNLQLET-------EQLTSEISSDEDALEHMNTSLDNFQNQKKSLIAE 862

Query: 1052 CESLKEKIKDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQ 1111
             E  +  + D+   ++E K   ++I  +L++LN L+    +   SL  ELQ     D+T 
Sbjct: 863  LEHAEHTLADVHSEVDEEKKRLVDIDEELKELNGLIHAKAEKKSSLELELQQLK-NDIT- 920

Query: 1112 SLEKIQNENANNSVGVKQSSNNL 1134
               K QN  +    G++QS + L
Sbjct: 921  ---KFQNSTS----GIEQSISQL 936

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQL 1393
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score =  106 bits (264), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 166/716 (23%), Positives = 310/716 (43%), Gaps = 93/716 (12%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 199
           + +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  + + +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRAS 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKI-IEDRKPLVVMRKAFKNNSSKYY 258
            L DLI+K      +   SV + F    + +   S I  E    + V R+     +SKY 
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTIVFA---NSDKNNSPIGFESYPKISVTRQIVLGGTSKYL 116

Query: 259 INGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDII 318
           ING  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  
Sbjct: 117 INGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAA 169

Query: 319 GTSKY--------KTL--IEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEF 368
           GT  +        +T+   E K+ EI +L +         E VE + N L ++K A L+F
Sbjct: 170 GTKMFEDRREKAERTMNKKETKLQEIRSLLQ---------EEVEPKLNKLRNEKRAFLDF 220

Query: 369 IAKEKQLTLLR-SKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTR 427
             +E Q  L   SK+    ++      ++ + K  N +NA Q   S+  ++ + + Q+  
Sbjct: 221 --QETQSDLENTSKIVNAFVF------SSLVQKRKNIENAFQNSESRISELTASVQQTKV 272

Query: 428 ELREANEKINASVAQERELVQKKREYDGQCVSME----ERIKNLTQKKTKAEKTLHDKRI 483
           EL    E ++    Q+R  ++K    DG    +E    + I  +++ KT    T+ +   
Sbjct: 273 ELTNLEEDLDTIRTQKRNEMRK----DGALSKLEALETQLINEVSRLKTSLSLTIENINQ 328

Query: 484 EIQKNESILKDLQDYQM-------------NYDSEFSNLQKELDKERXXXXXXXXXXXXX 530
           E  K ES+ + ++  Q              N  +E  +L + L ++              
Sbjct: 329 ENGKRESLERSIRGIQTSLQEKSAISKNAENEYNELHDLVQNLSQQLQTKEELLSTLTTG 388

Query: 531 XXXXXXQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDV 590
                   S Y   +    +++ + ++Q+Q  E +I++LK+  A  +  +   K   ++ 
Sbjct: 389 ISSTGATNSGYSAQLSNTKARLNDARIQVQRFEMKINILKKELAANEPKIVDAKSLSEEA 448

Query: 591 RKEIDNKNSIIENLKK--EQVSLKKEV--SLGESECSRAKEKEKEMRVILNSHRQRAIDA 646
           +K+++       +LK   E++    ++  SL E E S  K K   +   +   R++  + 
Sbjct: 449 KKQVEVTGIQCSDLKMHLEKLGFNPDLFKSLKEEESS-LKSKIYNLSNDMEGLRRKVANI 507

Query: 647 RSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAIS---TACSRLDDI 703
             A     +K    S          + G   +L  L    + +  A +    A  RL ++
Sbjct: 508 DFAYSKPSDKFDPTS----------VKGVAAQLFSLN--EENFSSATALQICAGGRLFNV 555

Query: 704 VVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQ-------LQTPENVLRLFDLVQ 756
           VV++     Q +E  R  K      I L+K+   +L Q          P++V    +L+ 
Sbjct: 556 VVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDTVNFAKQLAPDSVELALNLIG 613

Query: 757 PIDLKFSNAFYSVLRDTLVATDIRQANRVAY-GKRRYRVVTLDGKLIDISGTMTGG 811
             D + + A   +   +L+  D   A +V +  K R R +TL G + D  GT++GG
Sbjct: 614 YED-EVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIYDPEGTLSGG 668

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMF 1387
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 101/381 (26%), Positives = 191/381 (50%), Gaps = 41/381 (10%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 199
           + +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRAS 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII--EDRKPLVVMRKAFKNNSSKY 257
            L DLI+K      I   SV + F    D  D T+  I   +   + V R+     +SKY
Sbjct: 61  NLQDLIYK-RGQAGITKASVTIVF----DNTDKTNSPIGFNNSAKISVTRQVVLGGTSKY 115

Query: 258 YINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDI 317
            ING  +    V +L +   +++++  FLI+QG++  +  MK K        +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEA 168

Query: 318 IGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTL 377
            GT  +    ED+    E       +KE +   ++  +  L+ + +  LE +  EK++  
Sbjct: 169 AGTKMF----EDRR---EKAERTMAKKETK---LQENRTLLQEEIEPKLEKLRNEKRI-F 217

Query: 378 LRSKLTQYKLYQTNTKLATTLD------KISNFKNALQEERSKYEKIQSEIDQSTRELRE 431
           L  ++TQ   Y+  +K+    D      +  +F+N+L   +++ E++ + I + + EL  
Sbjct: 218 LEFQVTQAD-YEKISKVIFAFDYKNLTRRYDSFQNSLNSNKARAEELNTLIPKLSNEL-- 274

Query: 432 ANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHDKRIEIQKNESI 491
             E +N  + Q R   Q++ E +G+   +EE+   +  + ++ + +L    I IQ  E  
Sbjct: 275 --ESLNDDLGQIRSAKQEEVEKNGKISILEEKESKILNEISRTKTSLS---ICIQDYEEN 329

Query: 492 LKDLQDYQMNY-DSEFSNLQK 511
           +K+L   + N  +++ S+LQK
Sbjct: 330 IKELDKIKRNIEENKTSSLQK 350

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1375 AQFIVISLRNNMFELAQQL 1393
            +QFIV+SL+  MF  A ++
Sbjct: 1138 SQFIVVSLKEGMFSNANRV 1156

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score =  101 bits (251), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 90/328 (27%), Positives = 162/328 (49%), Gaps = 29/328 (8%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 199
           + I++L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  A   +R  
Sbjct: 1   MKIEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRAS 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII--EDRKPLVVMRKAFKNNSSKY 257
            L DLI+K      +   SV V    V D +D ++  I   +   + V R+     SSKY
Sbjct: 61  SLQDLIYK-RGQAGVTKASVTV----VFDNSDKSNSPIGFTNSAKISVTRQVMLGGSSKY 115

Query: 258 YINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDI 317
            ING  +    V +L +   +++++  FLI+QG++  +  MK K        +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEA 168

Query: 318 IGTSKYKTLIEDKMVEIEALNEICVEKEKRF--EIVETEKNSLESDKDAALEFIAKEKQL 375
            GT  ++   +DK     A  E  +E+ +    E +E +   L S+K+  ++F  +E Q 
Sbjct: 169 AGTKMFEDR-KDKAERTMAKKEAKLEENRALLVEEIEPKLGKLRSEKEIFIKF--QETQS 225

Query: 376 TLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREANEK 435
            L +++   Y     N      ++K S+ K  L     + E+++  I +++ E+   NE 
Sbjct: 226 ELEKTERVVYAFDYHN-----MINKSSSLKQHLNSSNKRSEQLKELISRTSDEISSLNED 280

Query: 436 INASVAQERELVQKKREYDGQCVSMEER 463
           +  +   +    QK+ +  G   ++EER
Sbjct: 281 LEETKRNK----QKEIDEQGTLANLEER 304

 Score = 85.9 bits (211), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 83/137 (60%), Gaps = 1/137 (0%)

Query: 1251 VRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM 1310
            +++ + KL + + D  ++ +  +++   +++  +     A+L  ++  +  +EG+ F V 
Sbjct: 1014 IQETIHKLNEYKKDTLIKTWKKVTVDFGQVFADLLPNSFAKLVPLEGKE-VTEGLEFKVR 1072

Query: 1311 PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1370
                   ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK 
Sbjct: 1073 LGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKT 1132

Query: 1371 RTKNAQFIVISLRNNMF 1387
            R K +QFIV+SL+  MF
Sbjct: 1133 RFKGSQFIVVSLKEGMF 1149

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 94/209 (44%), Gaps = 26/209 (12%)

Query: 672 INGFHGRLGDLGVIADKYDIAIS---TACSRLDDIVVDSVECGQQCIEYLRKNKLGYARF 728
           + G   +L  L    D YD A +    A  RL ++VVD+     Q +E  R  K      
Sbjct: 523 VKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDNERTASQLLEKGRLRK--RVTI 578

Query: 729 ILLDKL-------RNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIRQ 781
           I L+++       +  QL Q   P  V    +LV   + + S A   +  ++L+  D   
Sbjct: 579 IPLNRIAARALNSQTLQLAQKTAPGKVELALNLV-GYEEEVSRAMEFIFGNSLICKDAET 637

Query: 782 ANRVAYGKR-RYRVVTLDGKLIDISGTMTGGG-SHVSKGLMKLKNSN-----MEHLEVYE 834
           A ++ +  + R R +TL G + D  GT++GG  ++ S  L+ ++  N     +E LE+  
Sbjct: 638 AKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRNNTSSLLIDVQKYNKTAKRIEELEL-- 695

Query: 835 AGDVEKIERDLAERENNFKIAHDTLQEMN 863
              ++ I RDL E+E+  +       ++N
Sbjct: 696 --KLKSITRDLEEQESKLQKTRSVRNDLN 722

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  100 bits (250), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/294 (28%), Positives = 142/294 (48%), Gaps = 51/294 (17%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 199
           + +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++DS+ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQ 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKI--IEDRKPLVVMRKAFKNNSSKY 257
            L DLI+K       Q+  ++     V D +D +S     E    + V R+     +SKY
Sbjct: 61  NLQDLIYKRG-----QAGVIKASVTIVFDNSDPSSSPFGFETYPKISVTRQIILGGTSKY 115

Query: 258 YINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDI 317
            ING  +    V  L +   +++++  FLI+QG++  +  MK        D +L  +E+ 
Sbjct: 116 LINGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEA 168

Query: 318 IGTSKY--------KTLI--EDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALE 367
            GT  +        KT+   E K+ EI AL           E +E + N L ++K A LE
Sbjct: 169 AGTRMFEDRREKAEKTMAKKETKLQEIRAL---------LLEEIEPKLNRLRNEKRAFLE 219

Query: 368 FIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSE 421
           F            + TQ  L +T +++  T D    ++  +Q+  S  E++QS+
Sbjct: 220 F------------QQTQTDLEKT-SRIVNTYD----YQTLVQKRSSMQERLQSD 256

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 78/133 (58%), Gaps = 1/133 (0%)

Query: 1255 LEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKK 1314
            +EKL + + D  ++ +  +++    ++  +     A+L  ++  D  + G+   V     
Sbjct: 1018 IEKLNEYKRDALVKTWEKVNVDFGNIFAELLPNSFAKLAAIEGKD-VTAGLEVKVKLGTL 1076

Query: 1315 SWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
               ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMF 1387
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 90/184 (48%), Gaps = 25/184 (13%)

Query: 696 ACSRLDDIVVDSVECGQQCIEY--LRK-------NKLGYARFI---LLDKLRNFQLGQLQ 743
           A  RL +++VD+ +   Q +E   LRK       NK+  AR I    L+K ++   G ++
Sbjct: 548 AGGRLFNVIVDNEKTASQLLERGRLRKRVTIIPLNKIS-ARVINTDALNKAKSLAPGAVE 606

Query: 744 TPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIRQANRVAYGKR-RYRVVTLDGKLI 802
              N++         + + + A   +   +L+  D   A +V +  + R R +TLDG + 
Sbjct: 607 LALNLI-------GYEAEVARAMEFIFGGSLICRDAATAKKVTFHPQVRARSITLDGDIY 659

Query: 803 DISGTMTGGG-SHVSKGLMKLK--NSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTL 859
           D  GT++GG  SH S  L+ ++  N   + + V E  ++ +++ +++E EN  ++     
Sbjct: 660 DPEGTLSGGSRSHTSSLLIDIQKYNEAAKQMMVLEK-ELYQVQANISEHENASRMTKSLQ 718

Query: 860 QEMN 863
            E+N
Sbjct: 719 NELN 722

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score =  100 bits (250), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 83/295 (28%), Positives = 144/295 (48%), Gaps = 34/295 (11%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 199
           + +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++DS+ FV G  +   +R  
Sbjct: 1   MRVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQ 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDEND-GTSKIIEDRKP-LVVMRKAFKNNSSKY 257
            L DLI+K       Q+  ++     V D +D  +S I  +R P + V R+     +SKY
Sbjct: 61  NLQDLIYKRG-----QAGVIKASVTIVFDNSDIKSSPIGFERYPKISVTRQIALGGTSKY 115

Query: 258 YINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDI 317
            ING  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+ 
Sbjct: 116 LINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEA 168

Query: 318 IGTSKY--------KTLI--EDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALE 367
            GT  +        KT+   E K+ EI AL +         E +E + +   S+K A LE
Sbjct: 169 AGTRMFEDRREKAEKTMAKKETKLQEIRALLQ---------EEIEPKLDKFRSEKRAFLE 219

Query: 368 FIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEI 422
           F   +  L +    +  +  +   TK  +  + + N +  +QE  S  +K Q+E+
Sbjct: 220 FQETQTDLEMTLRIVNTHDYHNLVTKQNSIQETVQNSEQRVQELESSIKKYQNEL 274

 Score = 68.6 bits (166), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMF 1387
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score = 99.0 bits (245), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 92/331 (27%), Positives = 160/331 (48%), Gaps = 35/331 (10%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 199
           + +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAS 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII--EDRKPLVVMRKAFKNNSSKY 257
            L DLI+K      +   SV + F    D  D ++  I   +   + V R+     +SKY
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTIVF----DNTDKSNTPIGFSEYPKISVTRQIVLGGTSKY 115

Query: 258 YINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDI 317
            ING  +    V +L +   +++++  FLI+QG++  I  MK          +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEA 168

Query: 318 IGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTL 377
            GT     + ED+    E       +KE +   ++  +  L+ + D  LE +  EK+L  
Sbjct: 169 AGTK----MFEDRK---EKAERTMQKKETK---LQENRTLLKEEIDPQLEKLRNEKRL-F 217

Query: 378 LRSKLTQYKLYQT-NTKLATTLDKISN----FKNALQEERSKYEKIQSEIDQSTRELREA 432
           L  +  Q  L  T    +AT   K+ N     K  L+   SK +++Q +ID   RE+   
Sbjct: 218 LEFQTIQADLETTEKVVIATDYQKMLNSRDSIKTVLETSNSKMDELQKKIDLVNREISNL 277

Query: 433 NEKINASVAQERELVQKKREYDGQCVSMEER 463
           NE +  ++ Q++    K+ E D    +ME +
Sbjct: 278 NEDLQQTMKQKK----KELENDTNIKAMESK 304

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMF 1387
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 74/164 (45%), Gaps = 23/164 (14%)

Query: 673 NGFHGRLGDLGVIAD---KYDIAIS-TACSRLDDIVVDSVECGQQCIEYLRKNKLGYARF 728
           N   G   +L  I +   KY I +   A  RL +++VD+ + G   ++  R  K      
Sbjct: 521 NSVKGVTAELFSIPEQNMKYVIGLQICAGGRLYNVIVDNEKTGSALLQKGRLRK--RVTI 578

Query: 729 ILLDKLRNFQLGQLQTPENVLRLFDLVQP--IDLKFSNAFYS---------VLRDTLVAT 777
           I LDK+ +  L Q     N L+L   + P  ++L  +   YS         +  ++L+  
Sbjct: 579 IPLDKVISRPLNQ-----NKLKLAKQLAPGKVELALNLIGYSDEVVKAMEFIFGNSLICD 633

Query: 778 DIRQANRVAYGKR-RYRVVTLDGKLIDISGTMTGGGSHVSKGLM 820
           D   A ++ +    R R +TL+G + D  GT++GG  + +  L+
Sbjct: 634 DAETAKKITFNPGIRTRSITLEGDIYDPEGTLSGGTRNNTNTLL 677

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 95.5 bits (236), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 160/701 (22%), Positives = 300/701 (42%), Gaps = 69/701 (9%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 199
           + +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQ 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKI-IEDRKPLVVMRKAFKNNSSKYY 258
            L DLI+K      +   SV + F    + +   S I  E    + + R+      SKY 
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTIVFN---NSDTSNSPIGFESHAKISITRQIILGGVSKYL 116

Query: 259 INGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDII 318
           ING  +    V +L +   +++++  FLI+QG++  +  MK +        +L  +E+  
Sbjct: 117 INGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAA 169

Query: 319 GTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLL 378
           GT     + ED+    E       +KE + + + T    L  + +  LE    EK+ T L
Sbjct: 170 GTR----MFEDRR---EKAERTMAKKETKLQEIRT---LLTEEIEPKLERFRNEKR-TYL 218

Query: 379 RSKLTQYKLYQTNTKL-ATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREANEKIN 437
             + TQ  L      + A    ++SN K  ++E     +    E++ +   L+   E + 
Sbjct: 219 EFQETQSDLENVMRVVNAFEFSQLSNKKKHIEESLHSGQSRLEELEDTISRLKNEVENLG 278

Query: 438 ASVAQERELVQKKREYDGQCVSMEER---IKN-LTQKKTKAEKTLHDKRIEIQKNESILK 493
           + +   +E   K+ +  G+   +E +   I N L++ +T     L D   E  +  ++ K
Sbjct: 279 SDLDALKEQRHKEVQLGGRMSELETKESEISNELSRVQTSLNIALEDSGEEKVRISNLKK 338

Query: 494 DLQDYQMN-------YDSEFS--NLQ----KELDKERXXXXXXXXXXXXXXXXXXXQISL 540
           +++ ++         YDS++   N+Q    +EL                         + 
Sbjct: 339 NIERWKQQHQEKKTLYDSKYKEYNIQNKKLEELKAIHKEKQELLSTLTTGISSTGTTANG 398

Query: 541 YEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSI 600
           Y   +     K+Q  +++I+  E E+ +LKE        + + K E +   KEI N    
Sbjct: 399 YNFQLSTIKEKLQNTRIEIREKEMEVEMLKEELNSNTPKISAAKAEKEKYDKEIQNMQHH 458

Query: 601 IENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTVL 660
             NL+K+      +  L        K+ E+ ++   ++H Q + +  S LH     S + 
Sbjct: 459 CNNLEKQLEQYGYDPIL----LKNLKDNERSLK---HTHYQLSQETES-LH--RKVSNLD 508

Query: 661 SALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTA---CS--RLDDIVVDSVECGQQCI 715
                  K+  ++   G +G L  + D+ +I  S A   C+  RL ++VVD+     Q +
Sbjct: 509 FNYVPPSKNFDVSSVKGVVGQLFTL-DEANIDSSAALQVCAGGRLFNVVVDNERTASQLL 567

Query: 716 EYLRKNKLGYARFILLDKLRN-------FQLGQLQTPENVLRLFDLVQPIDLKFSNAFYS 768
           E+ R  K      I L+K+ +         L +   P  V    +L+   + + + A   
Sbjct: 568 EHGRLRK--RVTIIPLNKISSRRINESILHLAKELAPGKVELAINLI-GFEEEVTRAMEF 624

Query: 769 VLRDTLVATDIRQANRVAYGKR-RYRVVTLDGKLIDISGTM 808
           +   + +  D   A ++ +  R R R +TL G + D  GT+
Sbjct: 625 IFGTSFICRDAETAKQITFNPRIRSRSITLQGDVYDPEGTL 665

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 85/140 (60%), Gaps = 1/140 (0%)

Query: 1248 RDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1307
            + ++++ +EKL + + +  ++ +  +S+    ++  +     A+LE  +  D  +EG+  
Sbjct: 1011 KQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLEV 1069

Query: 1308 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1367
             V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1368 IKERTKNAQFIVISLRNNMF 1387
            IK R K +QFIV+SL+  MF
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMF 1149

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
           SMC3Subunit of the multiprotein cohesin complex required
           for sister chromatid cohesion in mitotic cells; also
           required, with Rec8p, for cohesion and recombination
           during meiosis; phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1230

 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 171/725 (23%), Positives = 327/725 (45%), Gaps = 72/725 (9%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFG-FRANKMRQD 199
           +YI +++++ FK+Y    I+  F+   + I+G NGSGKSN   ++ FV     +N  R++
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYI 259
           R G LIH+     ++ S SVE+ F          S ++      V +R+        Y +
Sbjct: 61  RQG-LIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQL 118

Query: 260 NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIG 319
           N +     ++ R+L+  G  +++   ++ QG++  +A   AK     D   L+ LED++G
Sbjct: 119 NDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKI--VALTNAK-----DKERLQLLEDVVG 171

Query: 320 TSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLR 379
              ++  ++  + ++E   +  ++  K    + ++ + +E ++    ++   E+      
Sbjct: 172 AKSFEVKLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERN----- 226

Query: 380 SKLTQYKLYQTN-TKLATTLDKISNFKNALQEERSKY----EKIQSEIDQSTRELR--EA 432
            K+ Q+ LY     ++   ++++    N       +Y    +K +  IDQ +++L   EA
Sbjct: 227 RKIYQFTLYDRELNEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEA 286

Query: 433 NEKI-NASVAQ-----ERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHD-KRIEI 485
           + KI NA+  Q     E E+ QK    + +   ++++I++  +++     TL + K I  
Sbjct: 287 SLKIKNATDLQQAKLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIE 346

Query: 486 QKNESILKDLQDYQ------MNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXXXXXQIS 539
           Q+ + + K L  YQ        Y  + ++LQ+   K+R                     S
Sbjct: 347 QRKQKLSKILPRYQELTKEEAMYKLQLASLQQ---KQRDLILKKGEYARFK--------S 395

Query: 540 LYEKDIEPWV-SKIQEKQVQIQ-LAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNK 597
             E+D   W+ S+I+E +  IQ L E E S L+  +  L++   ++  EI+++   I+  
Sbjct: 396 KDERD--TWIHSEIEELKSSIQNLNELE-SQLQMDRTSLRKQYSAIDEEIEELIDSINGP 452

Query: 598 NSI--IENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNS------HRQRAIDARSA 649
           ++   +E+   E + LK+++S           KE++++ +L +        QR ++   +
Sbjct: 453 DTKGQLEDFDSELIHLKQKLSESLDTRKELWRKEQKLQTVLETLLSDVNQNQRNVNETMS 512

Query: 650 LHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKY-DIAISTACSRLDDIVVDSV 708
             +A     V     +L+ S       G LG+L  + DKY   A     + L  IVVD+ 
Sbjct: 513 RSLANGIINVKEITEKLKISPE--SVFGTLGELIKVNDKYKTCAEVIGGNSLFHIVVDTE 570

Query: 709 ECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENV---LRLFDLVQPI--DLKFS 763
           E     +  L + K G   FI L++L       ++ P N    ++   L++ I  + +F 
Sbjct: 571 ETATLIMNELYRMKGGRVTFIPLNRLS--LDSDVKFPSNTTTQIQFTPLIKKIKYEPRFE 628

Query: 764 NAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGG--GSHVSKGLMK 821
            A   V   T+V  D+ Q  ++A  K +   +TLDG   D  G +TGG    H    L  
Sbjct: 629 KAVKHVFGKTIVVKDLGQGLKLA-KKHKLNAITLDGDRADKRGVLTGGYLDQHKRTRLES 687

Query: 822 LKNSN 826
           LKN N
Sbjct: 688 LKNLN 692

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1304 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1361
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1362 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1396
            + VA  +KE +KNAQFI  + R +M ++A +   +
Sbjct: 1166 TAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV 1200

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 96/186 (51%), Gaps = 15/186 (8%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 199
           + +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAS 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII--EDRKPLVVMRKAFKNNSSKY 257
            L DLI+K      +   SV + F    D +D ++  I  E    + V R+     +SKY
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTIVF----DNSDKSNAPIGFESSPTISVTRQVALGGTSKY 115

Query: 258 YINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDI 317
            ING  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEA 168

Query: 318 IGTSKY 323
            GT  +
Sbjct: 169 AGTKMF 174

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 84/142 (59%), Gaps = 3/142 (2%)

Query: 1248 RDEVR--DELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGV 1305
            RD+V+  + +EKL + + D  ++ ++ ++     ++  +     A+L   +  D  +EG+
Sbjct: 1009 RDKVKIQETIEKLNEYKRDTLIKTWTKVNEDFGNIFADLLPNSFAKLVPSEGKD-VTEGL 1067

Query: 1306 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1365
               V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + 
Sbjct: 1068 EVKVKLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIG 1127

Query: 1366 NYIKERTKNAQFIVISLRNNMF 1387
            + IK R K +QFIV+SL+  MF
Sbjct: 1128 HLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 65/281 (23%), Positives = 127/281 (45%), Gaps = 35/281 (12%)

Query: 569 LKESQAKLKEGLGSLK---VEIDDVRKEIDNKNSIIENLKKE-QVSLKKEVSLGESECSR 624
           L  ++ KL E   S+K   ++I+ +++E+ +    +E+ KK+ ++SLK ++   E +CS+
Sbjct: 403 LNNAKTKLNEANVSIKKSNIKIEALQRELASNEPKMESAKKDLEISLK-QIKQYEEQCSQ 461

Query: 625 AKEKEKEMRV---ILNSHRQRAIDARSALHMAENKSTVLSA------LTRLQKSG----- 670
            + K KE       +   +Q+ I     L+  E ++  L         T  + +G     
Sbjct: 462 IQLKIKEHGYDAETVKELKQKKIAIEQQLNKIERENEYLKRKVANIDFTYTKPTGDFQEQ 521

Query: 671 RINGFHGRLGDLGVIADKYDIAIS---TACSRLDDIVVDSVECGQQCIEYLRKNKLGYAR 727
            + G   RL  L    + Y  A +    A  RL ++VVD+ +   Q ++  R  K     
Sbjct: 522 SVKGVAARLFHLN--ENNYSSATALQVCAGGRLYNVVVDNEKTASQLLQRGRLRK--RVT 577

Query: 728 FILLDKL-------RNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIR 780
            I L+K+       +   + +  +P NV    +L+   +   + A   +   +L+  D  
Sbjct: 578 IIPLNKIMARKLNDKTLNIAKEISPGNVELALNLI-GYEEDVAKAMEFIFGSSLICKDAE 636

Query: 781 QANRVAYGKR-RYRVVTLDGKLIDISGTMTGGGSHVSKGLM 820
            A +V +  + R R +TL G + D  GT++GG  +++  L+
Sbjct: 637 TAKKVTFHPQVRTRSITLQGDVYDPEGTLSGGSRNMNSSLL 677

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 96/183 (52%), Gaps = 13/183 (7%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 201
           +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 202 GDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLV-VMRKAFKNNSSKYYIN 260
            DLI+K      +   SV + F    + +   S I  +  P + V R+     +SKY IN
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFD---NTDKSNSPIGFNTSPRISVTRQIVIGGTSKYLIN 118

Query: 261 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGT 320
           G  +    V +L +   +++++  FLI+QG++  +  MK+         +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEAAGT 171

Query: 321 SKY 323
             +
Sbjct: 172 KMF 174

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1375 AQFIVISLRNNMFELAQQL 1393
            AQFIV+SL+  MF  A ++
Sbjct: 1141 AQFIVVSLKEGMFTNANRV 1159

 Score = 39.7 bits (91), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 71/160 (44%), Gaps = 29/160 (18%)

Query: 683 GVIADKYDI---AISTA-----CS--RLDDIVVDSVECGQQCIEYLRKNKLGYARFILLD 732
           GV A  + I   AI +A     C+  RL ++VVD+     Q +E  R  K      I L+
Sbjct: 529 GVAATLFTINDNAIESASALQVCAGGRLYNVVVDNETTASQLLEKGRLRK--RVTIIPLN 586

Query: 733 KLRNFQLGQLQTPENVLRLFDLVQP--IDLKFSNAFYS---------VLRDTLVATDIRQ 781
           K+ + +L      EN +     + P  +DL  +   YS         +   +L+  D   
Sbjct: 587 KIASRRLN-----ENTVNFAKQLAPGKVDLALNLIGYSDELSRAMEFIFGTSLICKDSET 641

Query: 782 ANRVAYGKR-RYRVVTLDGKLIDISGTMTGGGSHVSKGLM 820
           A +V + +  R R +TL+G + D  GT++GG  +    L+
Sbjct: 642 AKKVTFHQNIRQRSITLEGDVYDPEGTLSGGSRNNKNSLL 681

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 89.4 bits (220), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 96/184 (52%), Gaps = 15/184 (8%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 201
           +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 202 GDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII--EDRKPLVVMRKAFKNNSSKYYI 259
            DLI+K      +   SV +    V D  D ++  I   +   + V R+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTI----VFDNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLI 117

Query: 260 NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIG 319
           NG  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 320 TSKY 323
           T  +
Sbjct: 171 TKMF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMF 1387
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 89.4 bits (220), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 96/184 (52%), Gaps = 15/184 (8%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 201
           +++L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 202 GDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII--EDRKPLVVMRKAFKNNSSKYYI 259
            DLI+K      +   SV +    V D  D ++  I   +   + V R+     +SKY I
Sbjct: 63  QDLIYK-RGQAGVTKASVTI----VFDNTDKSNSPIGFANSPQISVTRQVVLGGTSKYLI 117

Query: 260 NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIG 319
           NG  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 320 TSKY 323
           T  +
Sbjct: 171 TKMF 174

 Score = 82.0 bits (201), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQL 1393
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 88.6 bits (218), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 95/186 (51%), Gaps = 15/186 (8%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 199
           + + +L++  FKSYA   ++  ++  F+AI G NGSGKSN++D++ FV G  + + +R  
Sbjct: 1   MKVAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRAS 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKII--EDRKPLVVMRKAFKNNSSKY 257
            L DLI+K      +   SV + F    D +D +   I  E    + V R+     +SKY
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTIVF----DNSDKSKAPIGFETSLTISVTRQIVLGGTSKY 115

Query: 258 YINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDI 317
            ING  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEA 168

Query: 318 IGTSKY 323
            GT  +
Sbjct: 169 AGTKMF 174

 Score = 85.9 bits (211), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 84/143 (58%), Gaps = 1/143 (0%)

Query: 1251 VRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM 1310
            ++D + KL + + D  ++ +  +++    ++  +     A+L   +  D  +EG+   + 
Sbjct: 1014 IQDTITKLNEYKRDTLIKTWKKVTVDFGNIFADLLPNSFAKLVPSEGKD-ITEGLEVKIK 1072

Query: 1311 PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1370
              K    ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK 
Sbjct: 1073 LGKLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKT 1132

Query: 1371 RTKNAQFIVISLRNNMFELAQQL 1393
            R K +QFIV+SL+  MF  A ++
Sbjct: 1133 RFKGSQFIVVSLKEGMFNNANRV 1155

 Score = 35.0 bits (79), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 103/459 (22%), Positives = 196/459 (42%), Gaps = 85/459 (18%)

Query: 672  INGFHGRLGDLGVIADKYDIAIS---TACSRLDDIVVDSVECGQQCIE--YLRK------ 720
            + G   RL    +    YD A +    A  RL ++VVD+     + +E   LRK      
Sbjct: 523  VKGVAARL--FTIDKQNYDSATALQVCAGGRLYNVVVDNETTASKLLEKGRLRKRVTIIP 580

Query: 721  -NKLGYARFI---LLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVA 776
             NK+  AR I    L+  +    G+++   N++   D V       + A   +   +L+ 
Sbjct: 581  LNKIS-ARTIDNNTLNYAKQLAPGKVELALNLIGYEDEV-------AKALQFIFGSSLIC 632

Query: 777  TDIRQANRVAYG-KRRYRVVTLDGKLIDISGTMTGGG-SHVSKGLMKLK--NSNMEHLEV 832
             D   A ++ +  K R R +TLDG + D  GT++GG  ++ S  L+ ++  N + E +  
Sbjct: 633  NDAETAKKITFNPKIRTRSITLDGDVYDPEGTLSGGSRTNTSSILVDIQKYNESTEKINN 692

Query: 833  YEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSXXX 892
            Y+  +++ I + L+E+E+ +K      +E+ N+L  L  K     LEI+K          
Sbjct: 693  YQ-NELKSIRKKLSEQEDIYK----QTKELQNQLSLLNHK-----LEISKRNFG------ 736

Query: 893  XXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEE 952
                                   +P  +     + ++ E    E ++++  E  N L++E
Sbjct: 737  ----------------------SNPASQVLKRNKDIQEEILICEKENETSYENSNALEKE 774

Query: 953  IMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTA 1012
            I  I     +  N K S L E    + A+ +K    I+  ++ L     LF+  EL+   
Sbjct: 775  IQSITKDLNEFNNDKGSKLKE----LKAEVEKLSKEIETKDRHLDDKTELFQTLELETEQ 830

Query: 1013 CVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLK-------EKIKDMEES 1065
               D+ET    V      L+E + E D +++   +   + E+++       +++ D++E 
Sbjct: 831  HNTDIETNTELVKQAEDTLKELKIEEDSLIDSIKEQKNKLETVRAYLTKERKRLFDIDE- 889

Query: 1066 MNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSY 1104
              E K  E  +K+K    + L +  + +++ L  EL+ +
Sbjct: 890  --ETKDLERLLKSK----HQLKNDNEIELQQLEHELKKF 922

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
           YJL074C (SMC3) - SMC chromosomal ATPase family member
           [contig 224] FULL
          Length = 1247

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 109/222 (49%), Gaps = 9/222 (4%)

Query: 117 LSPIKNNRIELQKLYNSKNQNKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGS 176
           + P + N I  Q   + + +  V +YI  +++Q FK+Y     V  F+  F+ ++G NGS
Sbjct: 1   MKPRRVNSIRNQSRASFRAREIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGS 60

Query: 177 GKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKI 236
           GKSN   ++ FV     + ++++    LIH+     +I S  VE+ F    D+   TS I
Sbjct: 61  GKSNFFAAVRFVLSDDYSSLKREERQGLIHQGTG--SIMSAYVEIVFHDPSDQMMMTSGI 118

Query: 237 IEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIA 296
               + +V +R+       +Y +NGK  + ++++R+ +  G    +   ++ QG +  +A
Sbjct: 119 PVTEEHIVRVRRTIGLKKDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRI--VA 176

Query: 297 QMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALN 338
              AK     D   L  LED++G   ++  + +   ++EA N
Sbjct: 177 VTNAK-----DKERLLLLEDVVGARSFEIKLRESSKKMEATN 213

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 2/122 (1%)

Query: 1295 VDSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1352
             D+LD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173

Query: 1353 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKD 1412
            DAALD +  + VAN IKE + +AQFI  + R +M ++A     +   + +++ AT+  ++
Sbjct: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRVKFENKISEIATVSKQE 1233

Query: 1413 IL 1414
             +
Sbjct: 1234 AI 1235

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
            YFR031C (REAL)
          Length = 1170

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1316 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMF 1387
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 73/162 (45%), Gaps = 12/162 (7%)

Query: 668 KSGRINGFHGRLGDLGVIADKYDIAIST-ACSRLDDIVVDSVECGQQCIEYLRKNKLGYA 726
           K+  + G  G+L +L     +Y  A+ T A  RL ++VV   +   Q +E  R  K    
Sbjct: 519 KANLVYGVVGQLFELDDDKIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RV 576

Query: 727 RFILLDKLRN-------FQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDI 779
             I L+K+          +L +   P  V    +L++  D   + A   +  ++L+  D 
Sbjct: 577 TIIPLNKISTRPISPQVLELAKKIAPGKVELAINLIK-FDKSVTKAMEFIFGNSLICEDP 635

Query: 780 RQANRVAY-GKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLM 820
             A ++ +  K R R +TL G + D  GT++GG  + S  L+
Sbjct: 636 ETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSDSLL 677

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 93/181 (51%), Gaps = 18/181 (9%)

Query: 1234 FKKRKLDLNTTVARRDE----VRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGN 1289
            F ++K++LN   A  D+    +++ +EKLK+ +       F  +S     +++ +   G 
Sbjct: 1001 FNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTAVDSTFKKVSENFSTVFEKLVPRGT 1060

Query: 1290 AELEL------------VDSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALV 1335
            A+L +             +S +    G++ SV     K    ++  LSGG+KT+ ++AL+
Sbjct: 1061 AKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAIALI 1120

Query: 1336 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1395
             A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++A +   
Sbjct: 1121 LAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADKFFR 1180

Query: 1396 I 1396
            +
Sbjct: 1181 V 1181

 Score = 76.3 bits (186), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 120/245 (48%), Gaps = 20/245 (8%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFG-FRANKMRQD 199
           +YI ++V++ FK+Y    ++  F+ +++ ++G NGSGKSN   ++ FV     +N  R++
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYI 259
           R G LIH+     ++ S SVE+ F+         S ++      + +R+        Y +
Sbjct: 61  RQG-LIHQGSG--SVMSASVEIVFRDPGHRMILPSGVVPRENDEIFIRRTVGLKKDDYQV 117

Query: 260 NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIG 319
           N +    ++V R+L+  G  + +   ++ QG +  IA   AK     D   L+ LED++G
Sbjct: 118 NDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRI--IAVTNAK-----DKERLQLLEDVVG 170

Query: 320 TSKYKTLIE---DKMVEIE----ALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKE 372
              +++ +     KM E E     ++E   E  K+   +E E+  LE  K  ALE   K 
Sbjct: 171 AKSFESKLRASLKKMDETEQKRKKISEEMSELNKKLGDMEEERKELE--KFNALEGKRKV 228

Query: 373 KQLTL 377
            Q TL
Sbjct: 229 LQFTL 233

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 64/99 (64%), Gaps = 2/99 (2%)

Query: 1297 SLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1354
            S++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1355 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL 1393
            ALD +  + VA+ IKE ++NAQFI  + R++M E+A + 
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKF 1194

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 88/184 (47%), Gaps = 11/184 (5%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGF-RANKMRQD 199
           +YI ++V++ FK+Y    I+  F+   + ++G NGSGKSN   ++ FV     AN  R++
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYI 259
           R G LIH+     ++ S SVE+ F          S I       V +R+        Y +
Sbjct: 61  RQG-LIHQGSG--SVMSASVEIVFHDPSHRIILPSGIPPRENDEVFVRRTVGLKKDDYQL 117

Query: 260 NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIG 319
           N +    ++V R+L+  G  + +   ++ QG +  +A   AK     D   L  LE+++G
Sbjct: 118 NDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRI--VALTNAK-----DRERLHLLEEVVG 170

Query: 320 TSKY 323
              +
Sbjct: 171 AKSF 174

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 119/288 (41%), Gaps = 49/288 (17%)

Query: 677 GRLGDLGVIADKYD-IAISTACSRLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLR 735
           G LG+L  + DKY   A     + L  IVVD+ E     I+ L + K G   F+ L+++ 
Sbjct: 537 GTLGELIKVNDKYKKCAEVVGGNSLFHIVVDTDETASLIIQELYRMKGGRVTFLPLNRV- 595

Query: 736 NFQLGQLQTPEN-VLRLFDLVQPI--DLKFSNAFYSVLRDTLVATDIRQANRVAYGKRRY 792
            +    +  P N       L++ I  D +F  A   V   T+V  D+    R+A   +R+
Sbjct: 596 -YSDPNITYPPNEQASCTPLIKKIRYDARFEKAVKQVFGKTIVVRDLSTGARLA---KRF 651

Query: 793 RV--VTLDGKLIDISGTMTGGGSHVSKG-----LMKLKNSNMEHLEVYEAGDVEKIERDL 845
           R+  +TLDG   D  G +TGG     K      L KLK+S  ++  +    ++E + + +
Sbjct: 652 RLNAITLDGDRADKKGALTGGYHDQHKKTRLDLLKKLKDSRSQYKSL--VSELELMRQKI 709

Query: 846 AERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSXXXXXXXXXXXXXXXX 905
            + + +    + T + ++N  KR              +L ++DS                
Sbjct: 710 QDIDASIDTVNGTTRSLSN--KR------------ETILTNMDSWRAKLN---------- 745

Query: 906 XXYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEI 953
                  NKK      E  +Q L  +    E   +  +EKI+T  EE+
Sbjct: 746 -------NKKTEKIFLEESMQALIVKAEKTETNIRVSEEKISTYLEEL 786

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 67/114 (58%), Gaps = 2/114 (1%)

Query: 1304 GVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1361
            GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  
Sbjct: 1103 GVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYR 1162

Query: 1362 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415
            + VAN IKE + NAQFI  + R++M  +A     +   + ++  A +  +D +N
Sbjct: 1163 TSVANTIKELSANAQFICTTFRSDMLRVADVFYRVKYENKISTVAEVSQRDAIN 1216

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 99/201 (49%), Gaps = 16/201 (7%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 200
           +YI ++ +Q FK+Y  T ++  F+   + ++G NGSGKSN   ++ FV     N ++++ 
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 201 LGDLIHKSEAFPNIQSCSVEVHFQYVIDENDG---TSKIIEDRKPLVVMRKAFKNNSSKY 257
              LIH+     ++ S  VE+    V D +DG    +         VV+R+       +Y
Sbjct: 61  RQGLIHQGSG--SVMSAYVEI----VFDNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 258 YINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDI 317
            +N K  +  E+  LL+  G    +  +++ QG +  +A   AK     D   L+ L+++
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRI--VALTNAK-----DYERLQLLKEV 167

Query: 318 IGTSKYKTLIEDKMVEIEALN 338
            G + ++  + D + +++A N
Sbjct: 168 TGANSFEKKLRDSLNKMDATN 188

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 61/99 (61%), Gaps = 2/99 (2%)

Query: 1300 PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1357
            P   GV+ SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1358 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1396
             +  + VAN +KE +KNAQFI  + R +M ++A +   +
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRV 1197

 Score = 79.0 bits (193), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 104/201 (51%), Gaps = 18/201 (8%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFG-FRANKMRQD 199
           +YI +++++ FK+Y    I+  F+   + I+G NGSGKSN+  ++ FV     +N  R++
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 200 RLGDLIHK-SEAFPNIQSCSVEVHF-----QYVIDENDGTSKIIEDRKPLVVMRKAFKNN 253
           R G LIH+ +    ++ SCSVE+ F     + ++  N   + I+      V +R+     
Sbjct: 61  RQG-LIHQGTSGGSSVMSCSVEIVFHDPDNRMILASN---ASIVPRPNNEVFIRRTVGLK 116

Query: 254 SSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEY 313
              Y IN +    +++ R+L+  G  + +   ++ QG++  IA   AK     D   L+ 
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKI--IALTNAK-----DKERLQL 169

Query: 314 LEDIIGTSKYKTLIEDKMVEI 334
           LED++G   ++  + D + +I
Sbjct: 170 LEDVVGAKSFEIKLNDSLKKI 190

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1316 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMFELAQQL 1393
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 62/136 (45%), Gaps = 14/136 (10%)

Query: 687 DKYDIAIS---TACSRLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKL-------RN 736
           D +D A +    A  RL ++VVD+ +     +E  R  K      I L+K+       R 
Sbjct: 536 DHFDAASALQVCAGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLNKIAARTLNART 593

Query: 737 FQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDIRQANRVAYGKR-RYRVV 795
            Q+ +   P  V    +L+   D + S A   +   +LV  D   A +V +  + R R +
Sbjct: 594 LQMAKDIAPGKVELALNLI-GYDDEVSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSI 652

Query: 796 TLDGKLIDISGTMTGG 811
           TLDG + D  GT++GG
Sbjct: 653 TLDGDVYDPEGTLSGG 668

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1316 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1374
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1375 AQFIVISLRNNMF 1387
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 60/137 (43%), Gaps = 19/137 (13%)

Query: 696 ACSRLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLV 755
           A  RL ++VVD+     Q +E  R  K   A  I L+K+    L      +N++ +   V
Sbjct: 548 AGGRLFNVVVDNENTAAQLLERGRLRK--RATIIPLNKIAARTLN-----DNIVNMAKSV 600

Query: 756 QPIDLKFS-----------NAFYSVLRDTLVATDIRQANRVAYG-KRRYRVVTLDGKLID 803
            P  ++ +            A   +   +LV  D   A  V +  K R R +TLDG + D
Sbjct: 601 APGRVELALNLIGYEEEVRRAMEFIFGSSLVCKDAEAAKMVTFNPKIRTRSITLDGDVYD 660

Query: 804 ISGTMTGGGSHVSKGLM 820
             GT++GG  + +  L+
Sbjct: 661 PEGTLSGGSRNNTSSLL 677

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 2/97 (2%)

Query: 1296 DSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1353
            DS++    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1354 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1390
            AALD +  + VAN IKE + +AQFI  + R++M ++A
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVA 1188

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 100/199 (50%), Gaps = 11/199 (5%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFG-FRANKMRQD 199
           +YI  +V+Q FK+Y  T  V   +  F+ I+G NGSGKSN   ++ FV     +N  R++
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYI 259
           R G LIH+     ++ S  VE+ F     +   TS I    + +V +R+       +Y +
Sbjct: 61  RQG-LIHQGTG--SVMSAYVEIIFHDPSGQMMITSGIPMTEEHIVRVRRTIGLKKDEYSV 117

Query: 260 NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIG 319
           NGK  + ++++R+ +  G    +   ++ QG +  +A   AK     D   L  LE+++G
Sbjct: 118 NGKTCHKSDISRMFESVGFSAVNPYNIVPQGRI--VAVTNAK-----DRERLALLEEVVG 170

Query: 320 TSKYKTLIEDKMVEIEALN 338
              ++  + +   ++EA N
Sbjct: 171 AKSFEIKLRESAKKMEATN 189

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 79.0 bits (193), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 72/125 (57%), Gaps = 2/125 (1%)

Query: 1293 ELVDSLDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1350
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1351 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKN 1410
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   +   + ++    +  
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYENKISTVIEVDK 1211

Query: 1411 KDILN 1415
            +D +N
Sbjct: 1212 QDAIN 1216

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 79.0 bits (193), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 61/98 (62%), Gaps = 2/98 (2%)

Query: 1298 LDPFSEGVTFSV-MPPKKSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1355
            L+    GV+ SV    KK+ +  +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1356 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL 1393
            LD +  + VAN IK+ +KNAQFI  + R +M  +A + 
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRF 1192

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 131/279 (46%), Gaps = 21/279 (7%)

Query: 548 WVSK--IQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSI--IEN 603
           W+ K  ++++++   L ++  +L+ E Q +L+  L +L +EI+++   ++   ++  +E+
Sbjct: 401 WIEKEILEQQELLHSLQKTSTALIAERQ-QLQSSLSTLDMEIEELSDSVEGPGTVGELED 459

Query: 604 LKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHR------QRAIDARSALHMAENKS 657
           + ++   +K++      E       E+++  +L++        +RA++     ++A   S
Sbjct: 460 VAQQLTVMKEKYVKAIDERKELWRTEQKLLSVLDTLSDDVRLSERALNETMNKNLANGIS 519

Query: 658 TVLSALTRLQKSGRINGFHGRLGDLGVIADKY-DIAISTACSRLDDIVVDSVECGQQCIE 716
           ++     +L+ S   +   G LG+L  +++KY   A     + L  +VVD+ +     + 
Sbjct: 520 SIKEITEKLKLSP--DAVFGTLGELLKVSEKYKTCAEVVGGNSLFHVVVDTDKTASLLMR 577

Query: 717 YLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPI--DLKFSNAFYSVLRDTL 774
            L K K G   F+ L++L           +       L++ I  D KF  A   V   T+
Sbjct: 578 ELYKMKGGRVTFMPLNRLHEDSGVTFPPQDQSAACTPLLKKIKYDAKFEKAVKHVFGKTI 637

Query: 775 VATDIRQANRVAYGKRRYRV--VTLDGKLIDISGTMTGG 811
           V  D+    ++A   + Y++  +TLDG   D  G +TGG
Sbjct: 638 VVRDLTTGVKMA---KSYQLNAITLDGDRADNRGVLTGG 673

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1304 GVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1361
            GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1099 GVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYR 1158

Query: 1362 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1396
            + VA  IK  + NAQFI  + R +M ++A +   +
Sbjct: 1159 TAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV 1193

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 86/178 (48%), Gaps = 15/178 (8%)

Query: 641 QRAIDARSALHMAENKSTVLSALTRLQ-KSGRINGFHGRLGDLGVIADKYDI-AISTACS 698
           +R++    A  +A   ++V     +L+   GR+    G LG+L  + +KY + A     +
Sbjct: 503 ERSVSETMAKSLANGIASVREITEKLRLPEGRV---FGTLGELIKVNEKYKMCAEVVGGN 559

Query: 699 RLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLR-LFDLVQP 757
            L  IVVD+ E     I+ L + + G   F+ L+++ N     +  P N       L++ 
Sbjct: 560 SLFHIVVDTDETASLMIQELYRMRGGRVTFMPLNRIYNDP--NITYPPNAQSSCTPLIKK 617

Query: 758 I--DLKFSNAFYSVLRDTLVATDIRQANRVAYGKRRYRV--VTLDGKLIDISGTMTGG 811
           I  D +F +   +V   T+V  D+   +++A   + Y++  +TLDG   D SG +TGG
Sbjct: 618 IKFDAQFESVVKNVFGKTIVVRDLAAGSKIA---KHYKLDAITLDGDRADKSGLLTGG 672

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 2/95 (2%)

Query: 1298 LDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1355
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1356 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1390
            LD +  + VA  I++ + NAQFI  + R +M E+A
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVA 1193

 Score = 72.4 bits (176), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 91/187 (48%), Gaps = 16/187 (8%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFG-FRANKMRQD 199
           +YI ++V++ FK+Y    I+  F+   + ++G NGSGKSN   ++ FV     +N  R++
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDG---TSKIIEDRKPLVVMRKAFKNNSSK 256
           R G LIH+      + S SVE+ F    D N      S ++      V +R+        
Sbjct: 61  RQG-LIHQGSGGA-VMSASVEIVFH---DPNHKIILPSGVVPRENDEVYIRRTVGLKKDD 115

Query: 257 YYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLED 316
           Y +N +     +V R+L+  G  +++   ++ QG++  IA   AK     D   L  LED
Sbjct: 116 YQLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKI--IALTNAK-----DKERLNLLED 168

Query: 317 IIGTSKY 323
           ++G   +
Sbjct: 169 VVGAKSF 175

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 76.6 bits (187), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 95/195 (48%), Gaps = 32/195 (16%)

Query: 1234 FKKRKLDLNTTVARRDEVRDELE----KLKKTRHDEFMEGFSIISLTLKEMYQMITMGGN 1289
            F +++ DL+   +  DE +D ++    KLK+ + +     F  +S   + +++ +   G 
Sbjct: 1005 FDEKRKDLSERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGI 1064

Query: 1290 AELEL---------VDSLDP-----------------FSEGVTFSVMPPKKS--WRNITN 1321
            A+L +         +DS+D                     GV+ SV    K     ++  
Sbjct: 1065 AKLVIHRRDDTKDQMDSIDDDMDVASSERTSSKDGDIMYTGVSISVSFNSKQNEQLHVEQ 1124

Query: 1322 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1381
            LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE +KNAQFI  +
Sbjct: 1125 LSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSKNAQFICTT 1184

Query: 1382 LRNNMFELAQQLVGI 1396
             R +M ++A +   +
Sbjct: 1185 FRTDMLQVADKFFRV 1199

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 91/184 (49%), Gaps = 10/184 (5%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFG-FRANKMRQD 199
           +YI +++++ FK+Y    I+  F+   + I+G NGSGKSN   ++ FV     +N  R++
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYI 259
           R G LIH+     ++ S SVE+ F          S ++      V +R+        Y +
Sbjct: 61  RQG-LIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQL 118

Query: 260 NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIG 319
           N +     ++ R+L+  G  +++   ++ QG++  +A   AK     D   L+ LED++G
Sbjct: 119 NDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKI--VALTNAK-----DKERLQLLEDVVG 171

Query: 320 TSKY 323
              +
Sbjct: 172 AKSF 175

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 75.9 bits (185), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 94/196 (47%), Gaps = 33/196 (16%)

Query: 1234 FKKRKLDLNTTVARRDEVRDELE----KLKKTRHDEFMEGFSIISLTLKEMYQMITMGGN 1289
            F +++ DL+   +  DE +D ++    KLK+ +       F  +S   K +++ +   G 
Sbjct: 1005 FNEKRKDLSGRASELDESKDSIQDLIVKLKQQKVSAVDSTFQKVSENFKTVFERLVPRGT 1064

Query: 1290 AELELV----DSLDPFSE-----------------------GVTFSVMPPKKS--WRNIT 1320
            A+L +     DS+D  ++                       GV+ SV    K     ++ 
Sbjct: 1065 AKLVIHRRNEDSIDQANDVDVDMDTGNNEDTINKEGETVYTGVSISVSFNSKQNEQLHVE 1124

Query: 1321 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1380
             LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + NAQFI  
Sbjct: 1125 QLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATMIKELSTNAQFICT 1184

Query: 1381 SLRNNMFELAQQLVGI 1396
            + R +M ++A +   +
Sbjct: 1185 TFRTDMLQVADKFFRV 1200

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 91/184 (49%), Gaps = 10/184 (5%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFG-FRANKMRQD 199
           +YI ++V++ FK+Y    I+  F+   + I+G NGSGKSN   ++ FV     +N  R++
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYI 259
           R G LIH+     ++ S SVE+ F          S ++      V +R+        Y +
Sbjct: 61  RQG-LIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQL 118

Query: 260 NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIG 319
           N +     ++ R+L+  G  +++   ++ QG++  +A   AK     D   L+ LED++G
Sbjct: 119 NDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKI--VALTNAK-----DKERLQLLEDVVG 171

Query: 320 TSKY 323
              +
Sbjct: 172 AKSF 175

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1216

 Score = 75.9 bits (185), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 94/189 (49%), Gaps = 21/189 (11%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFG-FRANKMRQD 199
           +YI K++++ FK+Y    I+  F+  ++ I+G NGSGKSN   ++ FV     +N  R++
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPL-----VVMRKAFKNNS 254
           R G LIH+     ++ S SVE+ F      + G S I+     +     V +R+      
Sbjct: 61  RQG-LIHQGSG--SVMSASVEIQFY-----DPGNSMILPSGVAVNPDSTVSIRRTVGLKK 112

Query: 255 SKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYL 314
             Y IN +    +++ R+++  G  + +   ++ QG +  +A   AK     D   L+ L
Sbjct: 113 DDYQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRI--VALTNAK-----DKERLQIL 165

Query: 315 EDIIGTSKY 323
           ED++G   +
Sbjct: 166 EDVVGAKSF 174

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1304 GVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1361
            GV+ SV     +    ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  
Sbjct: 1092 GVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYR 1151

Query: 1362 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1396
            + VA+ IK  + NAQFI  + R +M ++A +   +
Sbjct: 1152 TAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRV 1186

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 75.1 bits (183), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 85/162 (52%), Gaps = 5/162 (3%)

Query: 1255 LEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKK 1314
            ++ LK+ + +     F+ +S    ++++ +   G  EL +      +S GV+  V    K
Sbjct: 952  IDNLKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSK 1010

Query: 1315 S--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1372
            +     I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  +
Sbjct: 1011 NDEQLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLS 1070

Query: 1373 KNA-QFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDI 1413
            +N  QFI+ + R++M E+A  ++ + K  N   S    NK I
Sbjct: 1071 QNGTQFILTTFRSDMIEIA-DMIYMVKYHNKVSSVYETNKTI 1111

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 57/96 (59%), Gaps = 3/96 (3%)

Query: 1300 PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1357
            P+ EGV+ SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150

Query: 1358 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL 1393
             +    VA  I + + NAQFI  + R++M + A + 
Sbjct: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKF 1186

 Score = 72.4 bits (176), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 119/247 (48%), Gaps = 17/247 (6%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFG-FRANKMRQD 199
           +YI +++++ FK+Y    I+G F+   + ++G NGSGKSN   ++ FV     +N  R++
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHF----QYVIDENDGTSKIIEDRKPLVVMRKAFKNNSS 255
           R G LIH+  A  ++ S SVE+ F      +I      S    D    V +R+       
Sbjct: 61  RQG-LIHQG-AGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDE---VRIRRTVGLKKD 115

Query: 256 KYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLE 315
            Y +N +     ++ R+L+  G  + +   ++ QG + ++   K K         L+ LE
Sbjct: 116 DYQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLE 168

Query: 316 DIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQL 375
           +++G   ++  ++  M +++   +   +     E +E++ N +E ++    ++ + E+  
Sbjct: 169 EVVGAKSFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDR 228

Query: 376 TLLRSKL 382
            +LR  L
Sbjct: 229 KVLRYTL 235

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 57/100 (57%), Gaps = 2/100 (2%)

Query: 1296 DSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1353
            D+ D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1354 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL 1393
            AALD +  + VA  IKE +  AQFI  + R++M  +A + 
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKF 1192

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 96/196 (48%), Gaps = 12/196 (6%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 200
           +YI K+++  FK+Y     +  F+   + +VG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 201 LGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYIN 260
              LI++  +  ++ S  VE+ F    D  + T   I D    + +R+       +Y IN
Sbjct: 61  RRSLIYQGTS--SVMSGYVEIVFH---DAENRTLLGIPDSNGAIRIRRTVGLKKDEYMIN 115

Query: 261 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGT 320
            K S+ ++V RLL+  G    +   ++ QG + ++   K       D   L+ LE+++G 
Sbjct: 116 NKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAK-------DRERLQLLEEVVGA 168

Query: 321 SKYKTLIEDKMVEIEA 336
             ++  +++ +  ++A
Sbjct: 169 KSFERKLKESLQRMDA 184

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
           chromosome segregation protein
          Length = 1223

 Score = 72.8 bits (177), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 70/129 (54%), Gaps = 6/129 (4%)

Query: 687 DKYDIAISTACSR-LDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTP 745
           DKY +A+ST   +  D ++VDS+   Q+CI +L+K + G   FI LD + +    ++  P
Sbjct: 540 DKYKLAVSTVLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLDTI-DAATPRMPVP 598

Query: 746 ENVLRLFDLVQPIDLK--FSNAFYSVLRDTLVATDIRQANRVAYGKR-RYRVVTLDGKLI 802
           E+       +  ++ K     A Y V  DT++  ++  A  + + K    ++VTLDG LI
Sbjct: 599 ESETYTL-AINTVEYKDDLVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALI 657

Query: 803 DISGTMTGG 811
           + +G MTGG
Sbjct: 658 NKTGLMTGG 666

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 72.0 bits (175), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (54%), Gaps = 2/102 (1%)

Query: 1297 SLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1354
            S D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1099 SQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1158

Query: 1355 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1396
            ALD +  + VA  +K+ +  AQFI  + R +M  +A +   +
Sbjct: 1159 ALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFYRV 1200

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 98/201 (48%), Gaps = 23/201 (11%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 200
           +YI K++++ FK+Y     +  F+   + +VG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 201 LGDLIHKSEAFPNIQSCSVEVHF-----QYVIDENDGTSKIIEDRKPLVVMRKAFKNNSS 255
              LI++  +  ++ S  VE+ F     + ++   DG          ++ +R+       
Sbjct: 61  RRSLIYQGTS--SVMSGYVEIVFHGAENRTLLGAQDG---------GVIHIRRTVGLKKD 109

Query: 256 KYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLE 315
           +Y IN K ++ ++V RLL+  G    +   ++ QG + ++   + +         L+ LE
Sbjct: 110 EYMINNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLE 162

Query: 316 DIIGTSKYKTLIEDKMVEIEA 336
           ++IG   ++  +++ + ++E 
Sbjct: 163 EVIGAKSFERKLKESLQKMET 183

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 64/139 (46%), Gaps = 7/139 (5%)

Query: 677 GRLGDLGVIADKYD-IAISTACSRLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLR 735
           G LG+L  I++KY   A     + L  +VVD+       ++ L  +K G   FI L+++ 
Sbjct: 533 GPLGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVH 592

Query: 736 NFQLGQLQTPEN-VLRLFDLVQPI--DLKFSNAFYSVLRDTLVATDIRQANRVAYGKRRY 792
                 +  P N       L++ I  D KF  A   V   T+V  D+ Q  ++A  + R 
Sbjct: 593 VD--SNIVYPSNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLA-KQFRL 649

Query: 793 RVVTLDGKLIDISGTMTGG 811
             +TLDG   D  G +TGG
Sbjct: 650 NAITLDGDKADSRGVLTGG 668

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 56/95 (58%), Gaps = 2/95 (2%)

Query: 1304 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1361
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1362 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1396
            + VA  IKE + +AQFI  + R +M ++A +   +
Sbjct: 1166 TAVATLIKELSNDAQFICTTFRTDMLQVADKFFRV 1200

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 97/196 (49%), Gaps = 10/196 (5%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFG-FRANKMRQD 199
           +YI ++V++ FK+Y    I+  F+   + I+G NGSGKSN   ++ FV     +N  R++
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYI 259
           R G LIH+     ++ S SVE+ F          S ++      V +R+        Y +
Sbjct: 61  RQG-LIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQL 118

Query: 260 NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIG 319
           N +     ++ R+L+  G  + +   ++ QG++  +A   AK     D   L+ LED++G
Sbjct: 119 NDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKI--VALTNAK-----DKERLQLLEDVVG 171

Query: 320 TSKYKTLIEDKMVEIE 335
              ++  ++  + ++E
Sbjct: 172 AKSFEVKLKASLKKME 187

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (54%)

Query: 1319 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1378
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1379 VISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415
              + R +M  +A     +   + ++    +  +D +N
Sbjct: 1177 CTTFRTDMINVADTFFRVKFENKVSTVTEVSRQDAVN 1213

 Score = 63.5 bits (153), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 93/197 (47%), Gaps = 14/197 (7%)

Query: 141 LYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFR-ANKMRQD 199
           ++I  +++  FK+Y    +V  F+   + +VG NGSGKSN   ++ FV     +N  R+D
Sbjct: 2   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 61

Query: 200 RLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYI 259
           R G  I++      + S  VE+ F    D  +     + +    V +R+       +Y I
Sbjct: 62  RKG-FIYQGAG--QVMSAFVEIIFD---DPENLMLAPLRNDTGEVRIRRTVGLKKDEYMI 115

Query: 260 NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIG 319
           N K S   +V R+L+  G    +   ++ QG + ++   K       D   L  LED++G
Sbjct: 116 NDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHLLEDVVG 168

Query: 320 TSKYKTLIEDKMVEIEA 336
              ++  +++ + ++EA
Sbjct: 169 AKSFENKLKESLKKMEA 185

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 111/240 (46%), Gaps = 31/240 (12%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 201
           I K+ LQ+F +Y  T+     + S + I+GPNGSGKS  + ++      +   + R  R+
Sbjct: 38  IVKIKLQNFVTYRLTEF--NLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKRV 95

Query: 202 GDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKI-----IEDRKPLVVMRKAFKNNS-- 254
            D I   E      +  +E+  +   D  +  S +     +  +  L V R   ++ +  
Sbjct: 96  DDFIKNGE-----DTSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGNKC 150

Query: 255 -SKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA-----KAEKEGDD 308
            S Y+IN K      +  L+K   I LD+    + Q  VE  A++K+     +  +  D 
Sbjct: 151 KSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETVRSIDA 210

Query: 309 GLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEF 368
            LL+ L+D+  +   +T +E         NE+ + K+KRF  +ET++N LE+   +  EF
Sbjct: 211 QLLQILDDLKSSQNDETTLE---------NEVDI-KQKRFNELETDRNKLEASVRSLKEF 260

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1380 IS 1381
            I+
Sbjct: 1050 IT 1051

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 80/162 (49%), Gaps = 16/162 (9%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 201
           I  L L++F +YA T+     + S + I+GPNGSGKS  + ++      +   + R  ++
Sbjct: 47  IVTLRLENFVTYALTEF--HMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSTKI 104

Query: 202 GDLIHKSEAFPNIQSC---SVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYY 258
            D I   E    I+       E   +YV   +DGT+K+    + L   RKA     S+Y+
Sbjct: 105 EDYIKNGEDRSVIEVTLKRDPEAEDRYVA--SDGTTKVT---RVLHRNRKA-----SEYF 154

Query: 259 INGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA 300
           +NG+    + V RL+ E  I LD+    + Q  VE  A++K+
Sbjct: 155 LNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLKS 196

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1380 IS 1381
            ++
Sbjct: 1049 VT 1050

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 87/354 (24%), Positives = 154/354 (43%), Gaps = 48/354 (13%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 201
           I K+ L++F +YA T+     + S + I+GPNGSGKS  + ++      R   + R  R+
Sbjct: 48  IIKIRLKNFVTYALTEF--HLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSKRV 105

Query: 202 GDLIHKSEAFPNIQSCSVEVHFQYVIDEND---GTSKIIEDRKPLVVMRKAFKNN-SSKY 257
            D I   E       C +E+     +  N    G + ++     + + R   ++   S Y
Sbjct: 106 EDFIKNGE-----DECEIEI----TLKNNSKIQGIANVLSSDDVIKITRVLIRHRKKSDY 156

Query: 258 YINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDI 317
           +IN + ++   V  ++ +  I LD+    + Q  VE  A++K+      D  L E +   
Sbjct: 157 FINDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLKS------DKLLFETIRS- 209

Query: 318 IGTSKYKTLIEDKMVEIEALNE--ICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQL 375
           I T     L E K ++ E L E      K++R + +  EK  LE+      EF  K+ QL
Sbjct: 210 IDTDLITVLEELKELQGEELAEEKEVSFKQQRLQELTAEKERLETSVRVLEEFQRKKDQL 269

Query: 376 TLLRSKLTQYKLYQTNTKLATTL----DKISNFKNALQEERSKYEKIQSEIDQST----- 426
            + +  L   K+     K+  +     D   N K  LQ+++  +   + +++++T     
Sbjct: 270 EIHKKLLPYVKIKDHKEKIRASKKCYEDAKRNLKALLQDKKP-FSHAKRQLERATEDALE 328

Query: 427 ------RELREANEK---INASVAQERELVQKKRE----YDGQCVSMEERIKNL 467
                 RE RE   K   I  S+ + RE +QK       Y G+   +++ I+ L
Sbjct: 329 SKNNKEREYRENQVKFKSIPVSLEKIREEIQKNSAQINYYRGRSAKLKQGIEEL 382

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 11/83 (13%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1380 ISLRNNMFELAQQLVGIYKRSNM 1402
            I+         + L G+Y    M
Sbjct: 1054 IT--------PKLLTGLYYHEKM 1068

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 87/355 (24%), Positives = 162/355 (45%), Gaps = 29/355 (8%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 201
           I K+ L++F +Y  T+     + S + I+GPNGSGKS  + ++      +   + R  R+
Sbjct: 36  IVKMRLENFVTYTLTEF--DLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKRV 93

Query: 202 GDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNS-SKYYIN 260
            D I   E        S+E+  +    + +G   +  +   + + R+  K+ S S+Y IN
Sbjct: 94  EDFIKNGE-----DRGSIEITLKNS-PKVEGMPGVDSEADTIKITRELIKSKSKSRYMIN 147

Query: 261 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMK-----AKAEKEGDDGLLEYLE 315
            +  +  +V  L+ +  I LD+    + Q  VE  A++K     A+  +  D  LL+ LE
Sbjct: 148 DRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLLDVLE 207

Query: 316 DIIGTSKYKTLIEDKMVEI--EALNEICVEKEKRFEIVET--EKNSLESDKDAALEFIAK 371
            ++   + K +   + +++  +  +E+ V+KEK  E V+   E  S +S+ +  L+ +  
Sbjct: 208 -LLKDLQAKEISSQRELDLNKQKYDELLVQKEKLSESVKAFKELESKKSELELHLQLLPY 266

Query: 372 EKQLTLLRSKLTQYK--LYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQSTREL 429
            K L   + KL  YK  L Q    L +       F NA Q    + E + ++ D   ++L
Sbjct: 267 AK-LKDHKEKLADYKRDLDQAKANLKSLRKDKKPFSNAKQNLEERLEILSNKRDLKDKQL 325

Query: 430 RE---ANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLHDK 481
           +E   +  ++   +   RE ++KK +   Q      R K L +   K  + L +K
Sbjct: 326 KEDQASYRRVEQELESIREEIEKKEQ---QIEYYRNRTKKLEETAAKTREELENK 377

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1377
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1378 IVIS 1381
             +I+
Sbjct: 1039 FLIT 1042

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 125/283 (44%), Gaps = 41/283 (14%)

Query: 148 LQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLGDLIH 206
           L +F +Y+  +     + S + I+GPNGSGKS  + ++      +   + R  R+ D I 
Sbjct: 51  LTNFVTYSLAEF--HMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVEDFIK 108

Query: 207 KSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSK--YYINGKES 264
              A       ++E+  +     N     +I      + +R        K  YYING+  
Sbjct: 109 NGTA-----ESTIEIQLRN--SRNVSGLPMISAEDEAINVRTVLMKARRKCAYYINGEPV 161

Query: 265 NYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA-----KAEKEGDDGLLEYLEDIIG 319
           +  ++  L+    I LD+    + Q  VE  A++KA     +  +  D  LL  LE  + 
Sbjct: 162 SENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLLEQTVRSVDASLLGLLEQ-LK 220

Query: 320 TSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLR 379
           TS+ + L  ++ VE+          +K+ E + T K SLE+   A  E+  K++++  + 
Sbjct: 221 TSQQEELSLNREVEL---------GQKKLEKLMTHKESLENQVRALEEYERKKEEID-IH 270

Query: 380 SKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEI 422
            +L  Y              ++ N K  L++ +S+YE+++ E+
Sbjct: 271 KRLLPYV-------------RVKNHKRQLKDLKSEYERVKQEL 300

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR-----NVSIVANYIKERTKNAQF 1377
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + ++V N   E T     
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1378 IVISLRNNM 1386
            I   L  N+
Sbjct: 1052 ITPKLLTNL 1060

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 77/320 (24%), Positives = 141/320 (44%), Gaps = 57/320 (17%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 201
           I KL L++F +Y+ T+     + S + I+GPNGSGKS  + ++      +   + R  R+
Sbjct: 69  IVKLRLENFVTYSLTEF--HLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGKRV 126

Query: 202 GDLIHKSEAF----------PNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFK 251
              I   E            P      V V         DGT+K         V R  + 
Sbjct: 127 DSFIKNGENRGLIEVTLKRDPGRTGSFVAV---------DGTTK---------VSRVLWV 168

Query: 252 NNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA-----KAEKEG 306
              S+YY+N +  +   V  L+ E  I LD+    + Q  VE  A++K+     +  +  
Sbjct: 169 GKKSEYYLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLKSDKLLMETVRSV 228

Query: 307 DDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAAL 366
           +  LLE  +++      KTL E+++ E +   E+ ++  K  ++ ET    + S +  AL
Sbjct: 229 NVNLLESFKNL------KTLQEEQITEAK---ELELKTSKLRDLNETRDKLVSSVQ--AL 277

Query: 367 EFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQSEIDQST 426
           E   ++KQ   +  KL  Y       K+     K + +K   QE R + + + ++ +   
Sbjct: 278 EAFKRKKQELDINEKLLPY------VKIKDHKRKCAQYKKKYQEARDQLKALITDKE--- 328

Query: 427 RELREANEKINASVAQEREL 446
             +R+A + I+A  A+++++
Sbjct: 329 -PMRQAQQAIDAEAAEKQDI 347

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1380 IS 1381
            ++
Sbjct: 1072 VT 1073

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 80/160 (50%), Gaps = 20/160 (12%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLG 202
           + +L L +F +Y+  +    F+ S + +VGPNGSGKS ++ ++      R   + + +  
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRS 114

Query: 203 DLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNN--SSKYYIN 260
           D   K+ A     S  ++V   ++  E+ GT+        L V R   +N+  +S YY++
Sbjct: 115 DSFIKNGA----DSARIDV---WLAGEDPGTT--------LKVSRVLTRNHKKASLYYVD 159

Query: 261 GKESNYTEVTRLLK-EEGIDLDHKRFLILQGEVENIAQMK 299
           G E++   V +L+  +  I LD+    + Q  V+  A+++
Sbjct: 160 GVETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLR 199

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1364
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1003 SGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1300 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1359
            P  + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1360 NVSIVANYIKERTKN---AQFIVIS 1381
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 75/162 (46%), Gaps = 14/162 (8%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 201
           I K+ LQDF +Y  T+     + S + I+GPNGSGKS  + ++      +   + R  ++
Sbjct: 42  ITKIRLQDFVTYTLTEF--NLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKV 99

Query: 202 GDLIHKSEAFPNIQSC---SVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYY 258
            D I   +    I+     S +VH    I+ +D T KI       ++ R   +   S Y 
Sbjct: 100 EDFIKNGQDVSRIEITLKNSPKVHDIENINAHDETIKITR-----IITRSKRR---SDYL 151

Query: 259 INGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA 300
           IN  + +   V  L+ +  I LD+    + Q  VE  A++K+
Sbjct: 152 INDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLKS 193

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 11/96 (11%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1380 ISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415
            I+         + L G+Y    M     +    I N
Sbjct: 1047 IT--------PKLLTGLYYHEKMRVHCVMAGSWIPN 1074

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
           (REAL)
          Length = 1092

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 87/185 (47%), Gaps = 19/185 (10%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 201
           I K+ LQDF +Y  T+     + S + I+GPNGSGKS  + ++      +   + R  ++
Sbjct: 42  IIKIRLQDFVTYTLTEF--NLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKV 99

Query: 202 GDLIHKSEAFPNIQSC---SVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYY 258
            D I   +    I+     S ++H    I+ +D T K+       ++ R   +   S Y 
Sbjct: 100 EDFIKNGQDTSRIEITLKNSPKIHDIEFINTHDETIKVTR-----IITRSKRR---SDYL 151

Query: 259 INGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA-----KAEKEGDDGLLEY 313
           IN ++ +   V  L+ +  I LD+    + Q  VE  A++K+     +  +  D  LL+ 
Sbjct: 152 INDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDASLLDV 211

Query: 314 LEDII 318
           L++++
Sbjct: 212 LDELM 216

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1380 IS 1381
            I+
Sbjct: 1047 IT 1048

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL058W
            (USO1)
          Length = 1292

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 84/338 (24%), Positives = 144/338 (42%), Gaps = 59/338 (17%)

Query: 815  VSKGLMKLKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEP 874
            V+K L +L +S+ME        ++ K+E DL + +  +K      QE + ++  L +K  
Sbjct: 706  VNKELCELSSSSME--------EIHKLELDLRKCQEQYKQLMKAKQESDTQVSDLDEK-- 755

Query: 875  EIELEIAKLLMDVDSXXXXXXXXXXXXXXXXXXYTDVINKKDPLDRAEAFLQTLRNEHRA 934
                 +A+L   +D                     D + K   L   E  + +L+N    
Sbjct: 756  -----LAQLKTQLDEANSKVEDLSTKKTTLEAAKADCLKK---LASHEGQVNSLKNRTTQ 807

Query: 935  LEDQSQSKKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEK 994
            LE Q  +  E+ +T +  I K+  +   +   K  SLT    ++N   K+ +  ++  EK
Sbjct: 808  LEKQLATVSEQKSTAEAGINKMNRELFNLTKEK-DSLT---AVMNKLQKEGEKKLQEAEK 863

Query: 995  ELQKVQRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCES 1054
            E  ++ +L  Q +        D+E L+  +    T+ ++ E E   +L E  DL  QC S
Sbjct: 864  EKVRITQLLSQRD-------RDIENLRNELQDQGTQKKKLEDEHAGLLKEIADLKSQCAS 916

Query: 1055 -------LKEKIKDMEESM----NEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQS 1103
                   LKEK+K + ES+    NE+ + + ++ N       +      +I  LN ELQ 
Sbjct: 917  QDSLIPKLKEKLKTLAESLKDTQNEHATLQKQVGN-------IQATSHAEITQLNAELQK 969

Query: 1104 YHVRDV---------TQSLEKIQNENANNSVGVKQSSN 1132
                +V         TQ LEK+Q   A  + G KQ+S+
Sbjct: 970  LKDENVILISRKDELTQELEKLQ---AQTAAGEKQTSD 1004

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 85/356 (23%), Positives = 160/356 (44%), Gaps = 50/356 (14%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 201
           I K+ L +F +Y+  +     + S + I+GPNGSGKS  + ++      +   + R  +L
Sbjct: 44  IIKIKLWNFVTYSLAEFT--LSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSKL 101

Query: 202 GDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYING 261
            D I   E     QS  VEV  + V + +  T  I      L+           +Y ING
Sbjct: 102 EDYIKNGED----QSV-VEVTLKNVPESDFNTDTI------LIKTTINRGKKKPEYAING 150

Query: 262 KESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTS 321
                T +   +K+  I LD+    + Q  VE  A++K+       D LLE     I +S
Sbjct: 151 STVTETYIRAFVKKLNIQLDNLCQFLSQERVEEFARLKS-------DKLLEETIRSIDSS 203

Query: 322 KYKTLIEDKMVEIEALNEICVEKE-----KRFEIVETEKNSLESDKDAALEF--IAKE-- 372
              +L + K ++     EI ++K+     K+ + +  ++  LE    A  E+  + KE  
Sbjct: 204 MLTSLEKLKTLQT---TEISLQKDVDLKNKKLQELTAQREKLEGAVKALKEYEHLKKEIE 260

Query: 373 -KQLTLLRSKLTQYK---------LYQTNTKLATTLDKISNF---KNALQEERSKYEKIQ 419
             QL L   K+  +K           +   KL + L     F   KN+L+++++KY+ ++
Sbjct: 261 IHQLLLPYVKIKDHKSKVQSYIRDFREAKQKLKSFLQDKKPFIKAKNSLEKKQAKYQALK 320

Query: 420 SEIDQS-TRELREANEKINASVAQERELVQKKRE---YDGQCVSMEERIKNLTQKK 471
            + + S   E ++ N  +N     + E++++K++   Y+ +   ++E I++  ++K
Sbjct: 321 QDTNSSLINERKKLNSILNDLGKGKEEIIKRKKQIEYYENRTKKLQESIRSTEKEK 376

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1380 IS 1381
            I+
Sbjct: 1044 IT 1045

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 84/182 (46%), Gaps = 25/182 (13%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 201
           I KL LQ+  +Y+ T+     + S + +VGPNGSGKS  + ++      +   + R  ++
Sbjct: 37  IVKLRLQNVMTYSITEF--NLSPSLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKI 94

Query: 202 GDLIHKSEAFPNIQSCSVEVHFQ-YVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYIN 260
            + I   E      +  ++   + ++ +E    ++I+   K             S+YYI+
Sbjct: 95  DNFIKNGE-----NTAQIDTFLRGHMPNEVIKITRIMTRNK-----------KKSEYYID 138

Query: 261 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA-----KAEKEGDDGLLEYLE 315
              S  T V +L  E  I LD+    + Q  VE+ A++K+     +  +  +  LLE LE
Sbjct: 139 DSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINPSLLETLE 198

Query: 316 DI 317
           D+
Sbjct: 199 DL 200

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}
           SMC5Component of the SMC5-SMC6 complex; this complex
           plays a key role in the removal of X-shaped DNA
           structures that arise between sister chromatids during
           DNA replication and repair; binds single-stranded DNA
           and has ATPase activity; S. pombe homolog forms a
           heterodimer with S. pombe Rad18p that is involved in DNA
           repair
          Length = 1093

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 73/162 (45%), Gaps = 14/162 (8%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 201
           I K+ LQDF +Y  T+     + S + I+GPNGSGKS  + ++      +   + R  ++
Sbjct: 42  IIKIRLQDFVTYTLTEF--NLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKV 99

Query: 202 GDLIHKSEAFPNIQSC---SVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYY 258
            D I   +    I+     S  V     ID  D T KI       ++ R   +   S Y 
Sbjct: 100 EDFIKNGQDVSKIEITLKNSPNVTDIEYIDARDETIKITR-----IITRSKRR---SDYL 151

Query: 259 INGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA 300
           IN  + + + V  L+ +  I LD+    + Q  VE  A++K+
Sbjct: 152 INDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKS 193

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1380 IS 1381
            I+
Sbjct: 1047 IT 1048

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1307 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1366
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1367 YIKERTKN---AQFIVIS 1381
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

 Score = 39.7 bits (91), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 142 YIDKLVLQDFKSYAGTQI-VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 199
           YI K+VL +F  +   ++ +GP     + IVG NGSGKS ++ ++    G RA +  R +
Sbjct: 74  YIKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGN 130

Query: 200 RLGDLI 205
            L DLI
Sbjct: 131 SLKDLI 136

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 102/411 (24%), Positives = 170/411 (41%), Gaps = 80/411 (19%)

Query: 132 NSKNQNKVRLYID-------------KLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGK 178
           NSKN +  RL I              KL L +F +YA T+     + S + I+GPNGSGK
Sbjct: 36  NSKNLSTKRLRIQHSELNEFQPGAVVKLKLTNFVTYALTEF--HLSPSLNMIIGPNGSGK 93

Query: 179 SNVIDSMLFVFGFRANKM-RQDRLGDLIHKS--EAFPNI--QSCSVEVHFQY-VIDENDG 232
           S  + ++      +   + R  ++ + I     E    I  ++ S  +H  + +I+ +D 
Sbjct: 94  STFVCAICLGLAGKPEYIGRSKKVEEYIKNGTDEGVIEITLKNSSALLHSDFNMINTDDD 153

Query: 233 TSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEV 292
              +    K ++ M K      SKYYIN K      V  +++   I LD+    + Q  V
Sbjct: 154 VVHV----KRVLSMEK----KKSKYYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERV 205

Query: 293 ENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVE---KEKRFE 349
           E  A++K        D LL      I     + L E K ++ E  NE+ ++   KE + +
Sbjct: 206 EEFARLKP-------DTLLNETIRSIEAGLLEKLSELKSLQAEG-NELQIDLGAKENKLK 257

Query: 350 IVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQ 409
            + + + +LES   A   +  K ++L + +  L    L +   K+    DK    +NAL+
Sbjct: 258 ELTSSRAALESQAHALELYEEKARELDIHQKLLNYTYLKEHKEKIRGLKDK----RNALR 313

Query: 410 EERSKYE------------------KIQSEIDQSTRELREANEKINASVAQERELVQKKR 451
            E    E                    +S+ID  +R    A    N+S     E +QK  
Sbjct: 314 NEVKTMENESKPFNLLGVRLTADENNCKSDIDDLSRRRYSAKTSFNSST----ENIQKTS 369

Query: 452 EYDGQCVSMEERIKNLTQK--------KTKAEKTLHDKRIEIQKNESILKD 494
           +Y  +C   E ++  LT +        K   EK    K +E ++N+ +L D
Sbjct: 370 KYLSEC---ESKVNFLTTRNKSLKEDIKVNEEKI---KALEEERNKVVLPD 414

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 66/151 (43%), Gaps = 27/151 (17%)

Query: 1250 EVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1309
            E+R+ LE     R D+ ++    IS     ++  +   G  EL+  DS + +        
Sbjct: 947  EIRNSLE----PRLDDIVKQ---ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------C 992

Query: 1310 MPPKKSWRNITNL--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1361
            +  K  +R+ + L        SGGE+ +S++  + AL ++  +P  V+DEI+  +D  N 
Sbjct: 993  IEIKVKFRDNSELQQLNPHVQSGGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNE 1052

Query: 1362 SIVA-----NYIKERTKNAQFIVISLRNNMF 1387
             IV      N   E T     I   L  N+F
Sbjct: 1053 RIVHRIMVENACAENTSQYFLITPKLLTNLF 1083

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 73/157 (46%), Gaps = 14/157 (8%)

Query: 148 LQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLGDLIH 206
           LQDF +Y  T+     + S + I+GPNGSGKS  + ++      +   + R  R+ D I 
Sbjct: 47  LQDFVTYTLTEF--NLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFIK 104

Query: 207 KSEAFPNIQSC---SVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKE 263
             +    I+     S +V+    ++ +D T KI       ++ R   +   S Y IN  E
Sbjct: 105 NGQDVSRIEITLKNSPKVNDIENVNAHDETIKITR-----IITRSKRR---SDYLINDCE 156

Query: 264 SNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA 300
            + + V  L+ +  I LD+    + Q  VE  A++K+
Sbjct: 157 VSESVVKALVAQLNIQLDNLCQFLSQERVEEFARLKS 193

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1380 IS 1381
            I+
Sbjct: 1047 IT 1048

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 71/142 (50%), Gaps = 25/142 (17%)

Query: 1251 VRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM 1310
            +R ELE     R DE +E    IS   ++++  + +G   E+ LV   D +SE      +
Sbjct: 926  IRSELE----PRLDEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK----I 971

Query: 1311 PPKKSWRNITNL--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1362
              K  +R++  L        SGGE+ +S++  + +L ++   P  V+DEI+  +D RN  
Sbjct: 972  EIKVKFRDVAELKKLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNER 1031

Query: 1363 IVANYIKER--TKN-AQFIVIS 1381
            IV   + E    KN +Q+ +I+
Sbjct: 1032 IVHKAMVENACAKNTSQYFLIT 1053

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 75/162 (46%), Gaps = 14/162 (8%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 201
           I KL L +F +Y+ T+     + S + I+GPNGSGKS+ + ++      +   + R  ++
Sbjct: 46  IIKLRLVNFVTYSLTEF--HLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRAKKV 103

Query: 202 GDLIHKSEAFPNIQSC---SVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYY 258
            D I        I+     S  V    +I    G+ ++I  +    V+ KA K     YY
Sbjct: 104 EDFIKNGTEESVIELTVKNSKAVSGYSMIG---GSDEVINIK---TVIMKAKKK--CIYY 155

Query: 259 INGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA 300
           ING+     +V  L+    I LD+    + Q  VE  A++K+
Sbjct: 156 INGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLKS 197

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 15/98 (15%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1377
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1378 IVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415
             +I+         + L G+Y    M     +    I N
Sbjct: 1056 FLIT--------PKLLTGLYYHEKMMIHCVMAGPWIPN 1085

 Score = 33.9 bits (76), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 145 KLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLGD 203
           KL +++F +Y   +     + S + I+GPNGSGKS  + ++      +   + R  +L D
Sbjct: 48  KLRMENFVTYKVAEF--DLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKLED 105

Query: 204 LIHKSE 209
            I   E
Sbjct: 106 FIKNGE 111

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 142 YIDKLVLQDFKSYAGTQI-VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 199
           YI K+ L++F  +   ++ +GP     + IVG NGSGKS ++ ++    G +A+   R +
Sbjct: 63  YIKKVSLRNFMCHENFELELGP---KLNFIVGSNGSGKSAILTAITIALGAKASDTNRGN 119

Query: 200 RLGDLI 205
            L +LI
Sbjct: 120 SLKELI 125

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 142 YIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 200
           YI K+ L++F  +   ++   F    + IVG NGSGKS V+ ++    G +A+   R + 
Sbjct: 84  YIKKIKLRNFMCHENFEM--EFGPRLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNS 141

Query: 201 LGDLI 205
           L DLI
Sbjct: 142 LKDLI 146

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1309 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1368
            + P    +R ++  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1369 KERTK---NAQFIVIS 1381
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 39.7 bits (91), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 142 YIDKLVLQDFKSYAGTQI-VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 199
           YI KL L +F  +    + +GP     + IVG NGSGKS ++ ++    G +A++  R  
Sbjct: 79  YIKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGS 135

Query: 200 RLGDLI 205
            L DLI
Sbjct: 136 SLKDLI 141

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 37.0 bits (84), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 142 YIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 200
           YI K++L++F  +   ++     +  + IVG NGSGKS ++ ++    G +A++  R   
Sbjct: 87  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 144

Query: 201 LGDLIH 206
           L DLI 
Sbjct: 145 LKDLIR 150

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 100/234 (42%), Gaps = 43/234 (18%)

Query: 143 IDKLVLQDFKSYAGTQI-VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 200
           I K+ L++F +Y  T+  + P   S + I+GPNGSGKS  + +       +   + R  R
Sbjct: 52  IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKR 108

Query: 201 LGDLIHKSEAFPNIQSCSVEVHFQYV----------------------IDENDGTSKIIE 238
           + D I   E         +E+  + V                      +D   G   +I+
Sbjct: 109 VDDYIKNGE-----DRSKIEIFLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCGQLDLIK 163

Query: 239 DRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQM 298
             +  ++ R   K   S YYIN K  +   V  L+K   I LD+    + Q  VE  A++
Sbjct: 164 FTR--IIHRDKKK---SDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARL 218

Query: 299 KA-----KAEKEGDDGLLEYLEDIIGTSKYKTLIEDKM-VEIEALNEICVEKEK 346
           K+     +  +  D  LL+ LE++      +  +ED++ ++ +   E+C E+ K
Sbjct: 219 KSDKLLVETVRSIDPNLLDILEELKVLQNEEQTVEDELEIKQKRYTELCNERTK 272

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1380 IS 1381
            I+
Sbjct: 1074 IT 1075

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 37.0 bits (84), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 142 YIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 200
           YI K++L++F  +   ++     +  + IVG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 201 LGDLI 205
           L DLI
Sbjct: 139 LKDLI 143

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 36.6 bits (83), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 142 YIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 200
           YI K++L++F  +   ++     +  + IVG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 201 LGDLI 205
           L DLI
Sbjct: 139 LKDLI 143

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 36.6 bits (83), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 142 YIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 200
           YI K++L++F  +   ++     +  + IVG NGSGKS ++ ++    G +A++  R   
Sbjct: 82  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 139

Query: 201 LGDLI 205
           L DLI
Sbjct: 140 LKDLI 144

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 1008 RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLL 1067

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1068 RTQTIIIT 1075

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 39/66 (59%), Gaps = 5/66 (7%)

Query: 142 YIDKLVLQDFKSYAGTQI-VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 199
           YI K++L++F  +   ++ +GP     + IVG NGSGKS V+ ++    G +A+   R +
Sbjct: 75  YIKKVILRNFMCHEHFELDLGP---RLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGN 131

Query: 200 RLGDLI 205
            + DLI
Sbjct: 132 AMKDLI 137

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 47/92 (51%), Gaps = 12/92 (13%)

Query: 142 YIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 200
           YI K++L++F  +    +    N +F  IVG NGSGKS ++ +++   G +A++  R   
Sbjct: 72  YIRKVILRNFMCHENFSVELTPNLNF--IVGNNGSGKSAILTAIIVALGVKASETSRGSS 129

Query: 201 LGDLIHKSEAFPNIQSCSVEVHFQYVIDENDG 232
           L +LI K        S  V +H    +D N G
Sbjct: 130 LKELIRKG-----CNSSKVTLH----LDNNKG 152

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1363
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 5/66 (7%)

Query: 142 YIDKLVLQDFKSYAGTQI-VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 199
           YI K+VL++F  +   ++ +GP     + IVG NGSGKS ++ ++    G +A +  R +
Sbjct: 81  YIKKVVLKNFMCHEHFEMDLGP---KLNFIVGNNGSGKSAILTAITVGLGAKAAETNRGN 137

Query: 200 RLGDLI 205
            L DLI
Sbjct: 138 SLKDLI 143

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1380 IS 1381
            ++
Sbjct: 1055 VT 1056

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 78/160 (48%), Gaps = 10/160 (6%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLG 202
           I K+ +++F +Y   +       SF+ I+GPNGSGKS V+ ++       A+K+     G
Sbjct: 51  IIKIKMKNFMTYGLVEY--QLCPSFNMIIGPNGSGKSTVVCALGLGL---ASKLDITGRG 105

Query: 203 DLIHKSEAFPNIQ-SCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRK-AFKNNSSKYYIN 260
           D++  ++   N + S  +E+  +Y  D       +  +R+ + + R+ +     S Y IN
Sbjct: 106 DIV--TQYIQNGKTSGKIEITLKYS-DRIKNVKGVNPNRETVTIKREISIDAKKSNYKIN 162

Query: 261 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA 300
               N  +V  ++ +  I LD+    + Q  +++ A++K 
Sbjct: 163 NTVVNEKDVRDIVSKLNIQLDNLCQYLPQERLKDFARLKG 202

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034w SMC5
          Length = 1105

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 136/318 (42%), Gaps = 38/318 (11%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 201
           I K+ L++F +Y  T+     + S + I+GPNGSGKS  + ++      +   + R  ++
Sbjct: 38  IVKIRLENFVTYNYTEF--NLSPSLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQV 95

Query: 202 GDLIHKSEAF----------PNIQSCSVEVHFQYVIDENDGTSKIIED-----RKPLVVM 246
            D I   +            PNI    +   F  +   N+G  K +        K   + 
Sbjct: 96  EDFIKNGQDTSKIEIVLKDDPNIDIEFLGSSFHRI--RNNGNYKGLLTITRNLEKRTKIG 153

Query: 247 RKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKAKAEKEG 306
           R   K  + +Y ING  +  + V  L+ +  I LD+    + Q  VE  A  K + EK  
Sbjct: 154 RNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFA--KLRPEKLL 211

Query: 307 DDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKN-----SLESD 361
           D+ +     +++  S ++ L + ++ EIE  NEI    +   ++   E+N      L ++
Sbjct: 212 DETIRAIDSELL--SMFEVLKKLQLQEIEMSNEIQTNTDSLKKLKTDEENFQQEVQLLNE 269

Query: 362 KDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQE---ERSKYEKI 418
               L+ + K K+L      L   K+     KL T   ++   K  LQE   ER  Y ++
Sbjct: 270 YQETLDTLDKHKKL------LPYLKIQDHREKLLTYKRQVEGAKKQLQEFQKEREPYMQV 323

Query: 419 QSEIDQSTRELREANEKI 436
            + +++S  +L    E I
Sbjct: 324 LASLNESDAQLNIEKENI 341

 Score = 39.3 bits (90), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 79/185 (42%), Gaps = 15/185 (8%)

Query: 1207 INQLQDYVENSNADXXXXXXXXXXXXXFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEF 1266
            +N+L+  ++ SN D                 +  L T V + + +R E+   +K      
Sbjct: 882  VNKLESKIQLSNHDRSAVALLEQTKAKIADLEDKLPTQVRKCNTIRKEMSDKQKVLEPRL 941

Query: 1267 MEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL---- 1322
                S I     E+++ +   G   L     L  FS+     +M   +    ++ L    
Sbjct: 942  ESIVSGIGRKFSELFKDVGTAGGVTLNRKSKL--FSDW-KLEIMVQFRDEGKLSGLDSHT 998

Query: 1323 -SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD--FRNV---SIVANYIKERTKNAQ 1376
             SGGE+ +S++  + AL K+   P  V+DEI+  +D  F  +   ++V N  +E T  +Q
Sbjct: 999  QSGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEGT--SQ 1056

Query: 1377 FIVIS 1381
            + +I+
Sbjct: 1057 YFLIT 1061

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1323 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1379
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1380 IS 1381
            I+
Sbjct: 1072 IT 1073

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 71/160 (44%), Gaps = 10/160 (6%)

Query: 143 IDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR-L 201
           I K+ L +F +Y  T+     + S + I+GPNGSGKS  + ++      +   + + R +
Sbjct: 66  IIKIKLHNFVTYEFTEF--DLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRNV 123

Query: 202 GDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKN-NSSKYYIN 260
            D I   E    I+   + +     I + +G   ++E    + + R   ++   S+Y IN
Sbjct: 124 DDYIKNDEEHGEIE---ITLKNSEAIHDVEG---VLEGSDTITITRILTRSKKKSEYKIN 177

Query: 261 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMKA 300
                   V  L+    I LD+    + Q  VE  A++K+
Sbjct: 178 DSLVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLKS 217

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 40.4 bits (93), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 142 YIDKLVLQDFKSYAGTQI-VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRAN 194
           YI ++ L++F  +   ++  GP     + IVG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YIKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKAS 111

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I ++  +  
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMIMKKLSSNI 1060

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1061 RTQTIIIT 1068

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 40.0 bits (92), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1320 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1379
            T LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1380 ISL 1382
            IS+
Sbjct: 655  ISI 657

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 40.0 bits (92), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 57/126 (45%), Gaps = 15/126 (11%)

Query: 1271 SIISLTLKEMYQMITMGGNAELELVDSLD--PFSEGVTFS--------VMPPK--KSWRN 1318
            SI S T+   YQ  +   +A+ +  +SL    F   + F            P+  K  RN
Sbjct: 940  SIKSRTVNFGYQKTSTFADADFDFRNSLRIRKFKGKLDFGKTKETLNVYTGPQTDKEPRN 999

Query: 1319 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN---A 1375
            +  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K+    
Sbjct: 1000 VDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLKDDSRT 1059

Query: 1376 QFIVIS 1381
            Q I+I+
Sbjct: 1060 QTIIIT 1065

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 142 YIDKLVLQDFKSYAGTQI-VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 199
           YI K+ L +F  +   ++ +GP     + IVG NGSGKS ++ ++    G +AN   R +
Sbjct: 70  YIKKIKLVNFMCHEHFELTLGP---RLNFIVGNNGSGKSAILTAITIGLGAKANSTNRGN 126

Query: 200 RLGDLI 205
            L DLI
Sbjct: 127 SLKDLI 132

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 39.7 bits (91), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1371
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1372 TKNAQFIVIS 1381
              + Q I+I+
Sbjct: 1057 KSDTQTIIIT 1066

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 39.3 bits (90), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 142 YIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRAN 194
           Y+ ++ L++F  +   ++   F    + IVG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YMKRITLKNFMCHEHFEL--EFGPRLNFIVGSNGSGKSAILTAITVVFGAKAS 111

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1368
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12749 Saccharomyces cerevisiae
           YLR383W RHC18 Protein involved in structural maintenance
           of chromosomes required for interchromosomal and sister
           chromatid recombination
          Length = 1111

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 142 YIDKLVLQDFKSYAGTQI-VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 199
           YI K++L++F  +   ++ +GP     + IVG NGSGKS V+ ++    G +A    R  
Sbjct: 74  YIKKVILKNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGS 130

Query: 200 RLGDLI 205
            L DLI
Sbjct: 131 SLKDLI 136

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1368
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I    I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTIGTKLI 1061

>KLTH0D14102g Chr4 complement(1153018..1158156) [5139 bp, 1712 aa]
            {ON} similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 1712

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 61/104 (58%), Gaps = 9/104 (8%)

Query: 1018 ETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIK 1077
            E+ QT ++++++ + E   ++D + ++KD++  + + LK+ ++D E S +E  ++EI   
Sbjct: 960  ESNQTKILSLQSEIVELRQQYDSMKHDKDNMLTETKKLKKSLEDAERSRSEA-AYEI--- 1015

Query: 1078 NKLEKLNSLLDYCKKDIRSLN--QELQSYHVRDVTQSLEKIQNE 1119
               ++L S LD+  K+I  LN   E +S ++ D   +  K +NE
Sbjct: 1016 ---KQLKSELDHSSKEIEQLNSSSEEKSKNLADAVNTFNKARNE 1056

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 37.4 bits (85), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1301 FSEG-VTFSVMPPKKSW-RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1358
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1359 RN----VSIVANYIKERTKNAQFIV 1379
             N      ++ N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

>SAKL0E12716g Chr5 (1049450..1052215) [2766 bp, 921 aa] {ON} some
           similarities with uniprot|P38845 Saccharomyces
           cerevisiae YHR146W CRP1 Protein that binds to cruciform
           DNA structures
          Length = 921

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 55/97 (56%), Gaps = 11/97 (11%)

Query: 558 QIQLAESEISLLKESQAKLKEGLGSLKVEI-------DDVRKEIDNKNSIIENLKKEQVS 610
           Q Q+A++E   +KE QA   E L S K              KE+++KN+I+ NL+++QV+
Sbjct: 543 QKQVADAE--KIKEQQAAATEELESKKAATLALEQKQAAAAKELEDKNTILLNLEQKQVA 600

Query: 611 LKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDAR 647
             KE+   E + + AKE E +  ++LN  +++A  A+
Sbjct: 601 AAKEIE--EQQAAAAKELESKKAIVLNLEQKQAATAK 635

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 54/97 (55%), Gaps = 11/97 (11%)

Query: 558 QIQLAESEISLLKESQAKLKEGLGSLKVEI-------DDVRKEIDNKNSIIENLKKEQVS 610
           Q Q+A++E   +KE QA   E L S K              KE+++KN+I+ NL+++QV+
Sbjct: 361 QKQVADAE--KIKEQQAAATEELESKKAATLALEQKQAAAAKELEDKNTILLNLEQKQVA 418

Query: 611 LKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDAR 647
             KE+   E + + AKE E +  + LN  +++A  A+
Sbjct: 419 AAKEIE--EQQAAAAKELESKKAIALNLEQKQAATAK 453

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 37/72 (51%), Gaps = 10/72 (13%)

Query: 1301 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1360
            F EGV   V P     R  T LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGP-----RG-TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1361 VSIVANYIKERT 1372
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 10/78 (12%)

Query: 1301 FSEGVTFSV----------MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1350
            FS G+ F+            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +D
Sbjct: 976  FSGGLNFNFSKETLNMLVKTPNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALD 1035

Query: 1351 EIDAALDFRNVSIVANYI 1368
            E D  +D  N  I    I
Sbjct: 1036 EFDVFMDQVNRQIGTKLI 1053

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 36.6 bits (83), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 1345 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1395
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1396 IYKRSNMTQSA 1406
              K+ +  +S 
Sbjct: 999  FIKKVDSCKSC 1009

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 36.6 bits (83), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1317 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1374
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1375 -AQFIVIS 1381
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

 Score = 34.3 bits (77), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 5/68 (7%)

Query: 143 IDKLVLQDFKSYAGTQI-VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 200
           + K++L++F  +   ++ +GP     + IVG NGSGKS ++ ++    G +A++  R   
Sbjct: 72  LKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 201 LGDLIHKS 208
           L DLI + 
Sbjct: 129 LKDLIREG 136

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 36.6 bits (83), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 97/201 (48%), Gaps = 19/201 (9%)

Query: 944  EKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLF 1003
            E++NT KE++ +   K+L     K++ + +++  ++   +K++  I +  ++L  +QR  
Sbjct: 784  EQLNTQKEKLTEELKKQLADTKEKLTQMEKQVKELSEHKEKNEQGINKMNRDLFSLQREK 843

Query: 1004 KQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEK----DDLTGQCESLKEKI 1059
            ++ E DN     DLE  + +     T+L++     +I++ E     ++ T Q +   +KI
Sbjct: 844  QKLEEDNKQSKKDLEKTKNDFTKQETKLKDQIKAKEILIKETTEKLNEATTQSKEYHDKI 903

Query: 1060 KDMEESMNE----YKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQS-LE 1114
            +++   MNE    YKS +  +    EKL +L    K        ELQ+   RD  +S LE
Sbjct: 904  QNITSEMNEWQAKYKSHDTFVAKLTEKLKALATSFK--------ELQAE--RDTIKSELE 953

Query: 1115 KIQNENANNSVGVKQSSNNLD 1135
            KI  E   N   +     +L+
Sbjct: 954  KITQERDTNIAAITSEKKSLE 974

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 36.2 bits (82), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 89/188 (47%), Gaps = 35/188 (18%)

Query: 951  EEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAE--- 1007
            EE++++    L    S+VS+L  +I  ++ ++K  K  +++ E E+ +++   K A+   
Sbjct: 1073 EELVEVTKNNLNDSESQVSNLIAKISELDEENKSVKLEVEKLENEITEIKNSHKSAQKET 1132

Query: 1008 ------LDNT-------------------ACVNDLETLQTNVIAIRTRLQETEA------ 1036
                  LD T                   + ++D E L+ +      +++E E       
Sbjct: 1133 DTLQTKLDETELLLQSSKEEILSLKNEYSSTLSDKENLENSEKKSSEKIEELEKNFSNLQ 1192

Query: 1037 -EFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIR 1095
             +F+ I  E   L  +C   +EK KD+ E +++Y      + ++ +KLN ++D  +K I 
Sbjct: 1193 EQFENITAENKSLKEECSGTEEKFKDVNEKLDQYGETISSLSDEKDKLNGIIDDKEKIIS 1252

Query: 1096 SLNQELQS 1103
            +LN++L+S
Sbjct: 1253 NLNEKLES 1260

>Kwal_33.14948 s33 (883559..886216) [2658 bp, 885 aa] {ON} YKL073W
           (LHS1) - novel member of the Hsp70 family of molecular
           chaperones that localizes to the lumen of the
           endoplasmic reticulum: [contig 396] FULL
          Length = 885

 Score = 35.8 bits (81), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 82/184 (44%), Gaps = 15/184 (8%)

Query: 333 EIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNT 392
           ++E+LN I  E  +  +         ESD  +  + I +  ++T LR K+   +LY  + 
Sbjct: 644 DVESLNTIVSETLEWLD--------YESDGASITDLIERIDRITSLRDKI---ELYLKSA 692

Query: 393 KLATTLDKISNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKRE 452
             A  LD+         +  S+ EK +    ++ + L E+  ++   V +E + ++  R 
Sbjct: 693 DQALDLDQFKELFTNGSQLLSRVEKNKEYELETLKALNESFTEMGLDVKKEHKKLKPPRH 752

Query: 453 YDGQCVSMEERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKE 512
                   +E IK + Q  + A K L D+  + +  E    +L + ++N DS F  L K 
Sbjct: 753 LALPKYKFKESIKAVEQALSNANKVLADQEFDSRPRE----ELFELKLNLDSSFEELAKY 808

Query: 513 LDKE 516
           LD E
Sbjct: 809 LDLE 812

>Skud_10.357 Chr10 complement(632324..634441) [2118 bp, 705 aa] {ON}
            YJR134C (REAL)
          Length = 705

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 52/86 (60%), Gaps = 3/86 (3%)

Query: 1022 TNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDME-ESMNEYKSFEIEIKNKL 1080
            TN ++ + +++ T++ F  ++ EKDDL  Q +   EK+ + E    N+ K+ + ++KN  
Sbjct: 140  TNEVSKKPQIETTDSSFFKLIKEKDDLIDQLKKEGEKLAETELRQSNQIKALKTKVKNLE 199

Query: 1081 EKLNSLLDYCKKDIRSLNQELQS-YH 1105
             +++SL D   +++ + N ELQS YH
Sbjct: 200  YEVSSLNDDSTQNVENYN-ELQSLYH 224

>KLLA0F00770g Chr6 (65967..67853) [1887 bp, 628 aa] {ON} some
            similarities with uniprot|Q08581 Saccharomyces cerevisiae
            YOR195W SLK19 Kinetochore-associated protein required for
            normal segregation of chromosomes in meiosis and mitosis
          Length = 628

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 90/191 (47%), Gaps = 25/191 (13%)

Query: 960  ELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKV-----------QRLFKQAEL 1008
            EL ++  ++ S+T+ +  +  ++++++  +   E E+Q++           Q   K  +L
Sbjct: 311  ELNVKTKELKSITDELRSLKEQYERNENKLSEVESEIQELRKKMEEETIVFQDTIKPRDL 370

Query: 1009 DNTACVNDLETLQTN----VIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEE 1064
              T     L+  + N    V +++++LQ TEAE D   NE        ESL  K+   E 
Sbjct: 371  SITELNKKLQQFEANGSDEVSSLKSKLQITEAELDSKKNE-------IESLNLKLSTKET 423

Query: 1065 SMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSL---NQELQSYHVRDVTQSLEKIQNENA 1121
            ++ E +S   ++    EK  S L+  K+D+ SL   N  ++S H+ ++ +  E + +   
Sbjct: 424  ALEELRSHITQVTEDKEKSLSELEQTKRDLDSLTSRNGNIESEHLAELERLHENMSHMET 483

Query: 1122 NNSVGVKQSSN 1132
            N    VK  +N
Sbjct: 484  NLKQNVKTIAN 494

>CAGL0L05610g Chr12 (609615..611210) [1596 bp, 531 aa] {ON} similar to
            uniprot|P35208 Saccharomyces cerevisiae YJL127c SPT10
            transcription regulatory protein
          Length = 531

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 10/83 (12%)

Query: 1099 QELQSYHVRDVTQSLEKIQNENANNSVGVKQSSNNLDVSSSHTPNVDKHDD------EIS 1152
            Q+L++ H+ D T     + N  AN       ++  LD SS+  PN+D HDD      E+S
Sbjct: 424  QKLENKHLPDPTPPDNNVFNLTANTWAEKLAANIGLD-SSTAVPNIDMHDDHDHKGREMS 482

Query: 1153 MEDADNDSQNEIEEKEQDADIMD 1175
            +   D D       K+ D++IMD
Sbjct: 483  LHRQDIDMA---AHKDDDSNIMD 502

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 43/84 (51%), Gaps = 16/84 (19%)

Query: 413 SKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSME-ERIKNLTQKK 471
           +K E  Q+EI Q          K  +SV   +EL + K++YD  CV+ME  R KN     
Sbjct: 131 TKIEAFQNEITQ----------KKTSSV---QELEKGKKDYDASCVAMENARNKNTKSPG 177

Query: 472 TKAEKTLHDKRIE--IQKNESILK 493
           TK +  L++K  E  I KN  ++K
Sbjct: 178 TKNQNKLNEKEAEMNISKNSYLIK 201

>ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} similar
           to uniprot|Q756L3 Ashbya gossypii AER241W AER241Wp and
           weakly similar to uniprot|P32380 Saccharomyces
           cerevisiae YDR356W SPC110 Inner plaque spindle pole body
           (SPB) component
          Length = 835

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 95/205 (46%), Gaps = 24/205 (11%)

Query: 417 KIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEK 476
           KIQSE+++    LR+  +  N+S  +  EL   K   D +  ++ E   NL Q+ +   K
Sbjct: 357 KIQSELER----LRDNVKNNNSSNFEIGELKHAKASLDDKVRNLTEERHNLNQRISALRK 412

Query: 477 TLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERXXXXXXXXXXXXXXXXXXX 536
              + + + Q+NES+         N+   F +L++EL   +                   
Sbjct: 413 ECDEWKSKYQRNESL-------DSNHRKAFDSLRQELQTTKTQLEETRKTAQQLQTQVIE 465

Query: 537 QISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDN 596
             +   K+ E    +I++K+ QIQ  ESE+   K+   +LK+G   L+ E +  R+  + 
Sbjct: 466 NTT---KNSERTSQRIKDKETQIQKLESELQFCKQ---QLKDGSRRLQAEEERCRETFE- 518

Query: 597 KNSIIENLKK----EQVSLKKEVSL 617
             S ++NL+     E+  L++E++L
Sbjct: 519 --SELQNLEMKNGFERTKLEREITL 541

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR188W
            (MDL1)
          Length = 677

 Score = 33.1 bits (74), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 57/108 (52%), Gaps = 11/108 (10%)

Query: 1301 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1360
            F EG+  +V P        T LSGG+K   +LA  F     +   + ++DE  +ALD ++
Sbjct: 555  FPEGLQTAVGP------RGTQLSGGQKQRVALARAF----LQDPAILILDEATSALDSKS 604

Query: 1361 VSIVANYIKERTKNAQF-IVISLRNNMFELAQQLVGIYKRSNMTQSAT 1407
              IVA+ + +R + A+  I I+ R +  + + +++ + K  ++ ++ T
Sbjct: 605  EDIVASTLLQRCQEAKITISIAHRKSTIQHSTRVIVLDKLGHVLETGT 652

>NDAI0J00830 Chr10 (185771..185801,185919..188014) [2127 bp, 708 aa]
           {ON} Anc_8.351 YDR164C
          Length = 708

 Score = 32.7 bits (73), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 88/193 (45%), Gaps = 33/193 (17%)

Query: 188 VFGFRANKMRQDRLGDLIHKSEAFPNIQSCS-VEVHFQYVIDENDGTSKIIED---RKPL 243
           V+ ++A    ++ LG+   KS    +IQ    VE+ +Q+++D ND  S  I++   + PL
Sbjct: 275 VYHYKA----ENELGEFEEKSSKLIDIQDPDWVELKYQHIVDANDYLSGKIKEMIAKNPL 330

Query: 244 VVMRKAFKNNSSKYYINGKESNYTE------VTRLLKEEGIDLDHKRFLILQGEVE-NIA 296
           +V R+  KN +    +     ++ E      + R L +  + ++  R L    EVE N+A
Sbjct: 331 LVDRQNVKNTTDLLSVVAHLKDFDEERRRLILHRTLIDSCLTINKDRRLAELAEVEQNLA 390

Query: 297 ----QMKAKAEKEGDDGLLEYL-----------EDIIGTSKYK-TLIEDKMVEIEALNEI 340
                M  +  K   D LLE L             I+  + Y+  +IED  V++ A   +
Sbjct: 391 GFGMDMDGEKCKHIIDTLLEVLMTKEANITDKVRYIMAYALYRGGIIEDDFVKLLAFIGV 450

Query: 341 CVEKE--KRFEIV 351
            VE E  K F I+
Sbjct: 451 EVEHEYFKHFMIL 463

>Kpol_505.36 s505 (83512..84702) [1191 bp, 396 aa] {ON}
           (83512..84702) [1191 nt, 397 aa]
          Length = 396

 Score = 32.3 bits (72), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 310 LLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLESDKDAALEFI 369
           +L   ED +  + Y  L++D M+ +  LN IC+ +E   + +ET   S + D   +   +
Sbjct: 66  ILCLFEDELSETVYNVLVDDLMLSV--LNAICIYREVAIKTMETSYRSEDKDSHWSTSGV 123

Query: 370 AKEKQLTLLR 379
             +K L LL+
Sbjct: 124 YIKKALGLLQ 133

>NCAS0J02200 Chr10 complement(425055..427178) [2124 bp, 707 aa] {ON}
            Anc_4.364 YJR134C
          Length = 707

 Score = 32.7 bits (73), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 53/98 (54%), Gaps = 19/98 (19%)

Query: 1007 ELDNTACVNDLETLQTNVIA--IRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEE 1064
            EL+N   VND E   TN++   IRT  Q+T        + +D    Q E L+ + K  +E
Sbjct: 297  ELEN---VND-EITSTNILGNPIRTNTQDTTG------HPRD----QYEILQNQFKSSKE 342

Query: 1065 SMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQ 1102
            +   ++S E  + +K+  LNS L+  KKDI  LN++L+
Sbjct: 343  N---WESIEFSLNSKITNLNSTLNDSKKDIVKLNKDLE 377

>Ecym_3173 Chr3 complement(327173..329692) [2520 bp, 839 aa] {ON}
           similar to Ashbya gossypii AAL085C
          Length = 839

 Score = 32.7 bits (73), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 15/110 (13%)

Query: 546 EPWVSKIQEKQVQIQ---LAESEI-SLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNSII 601
           E +  ++ E Q QI    L +SE+ SL+K           S   EI+D+  +I  KN ++
Sbjct: 472 EKYEERLSELQTQIHNVVLQKSEVVSLMK-----------SKDTEIEDLNNQIFKKNEML 520

Query: 602 ENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALH 651
           E+LK   V L++EV+  + E S+  E+   +   L SHR  +    +A H
Sbjct: 521 ESLKDNSVLLEREVAERKQETSKKVEEYLRLSEELKSHRSTSEQKFAAQH 570

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 140,957,096
Number of extensions: 6453737
Number of successful extensions: 56778
Number of sequences better than 10.0: 2124
Number of HSP's gapped: 52707
Number of HSP's successfully gapped: 4525
Length of query: 1416
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1294
Effective length of database: 39,492,147
Effective search space: 51102838218
Effective search space used: 51102838218
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 72 (32.3 bits)