Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B027008.258ON42042021910.0
TDEL0F038508.258ON41942215640.0
Suva_10.1698.258ON43843815660.0
NCAS0B049908.258ON42042315560.0
Smik_12.1448.258ON43843815450.0
ZYRO0C01738g8.258ON41442015420.0
YLR085C (ARP6)8.258ON43843815420.0
Skud_12.1538.258ON43843815390.0
NDAI0B019608.258ON43944115290.0
KNAG0G020108.258ON42442314930.0
TBLA0H014608.258ON44244414930.0
KLTH0G13772g8.258ON42042314870.0
Kpol_543.368.258ON42742914780.0
SAKL0H17138g8.258ON41942314710.0
Kwal_56.238328.258ON41942214530.0
Ecym_43128.258ON41141714390.0
CAGL0L12166g8.258ON42142414240.0
AGR091W8.258ON41041714080.0
TPHA0A018308.258ON42142213790.0
KLLA0F19063g8.258ON41542413480.0
NCAS0C037008.23ON3754172402e-21
TDEL0C004708.23ON3754172383e-21
CAGL0K12694g8.23ON3754172383e-21
Suva_6.188.23ON3754172383e-21
Smik_6.398.23ON3754172383e-21
YFL039C (ACT1)8.23ON3754172383e-21
TPHA0D002508.23ON3754172374e-21
KNAG0L002508.23ON3754172374e-21
KAFR0D009408.23ON3754172374e-21
ZYRO0F02772g8.23ON3754172375e-21
TBLA0C004408.23ON3754172366e-21
NDAI0G030408.23ON3754172366e-21
SAKL0B00968g8.23ON3754172341e-20
Kpol_1058.158.23ON3754172331e-20
ABR222W8.23ON3764172331e-20
KLLA0D05357g8.23ON3754172294e-20
KLTH0G18832g8.23ON3754172286e-20
Ecym_15208.23ON3764142261e-19
Skud_6.318.23ON3602422232e-19
Kwal_14.11098.23ON3602422144e-18
AFR051W2.117ON4054242102e-17
TBLA0F008703.161ON3913902058e-17
TPHA0I013002.117ON3794202048e-17
NDAI0G029003.161ON3913152031e-16
Ecym_63852.117ON3774241994e-16
KLLA0E22925g2.117ON3804241986e-16
NCAS0C035503.161ON3923721977e-16
SAKL0E11814g2.117ON3794241968e-16
KLTH0F06490g3.161ON3913731942e-15
Kwal_33.141773.161ON3373051932e-15
NCAS0B071302.117ON3814301942e-15
ZYRO0B04928g3.161ON3913821932e-15
Suva_4.2203.161ON3913051932e-15
SAKL0C07370g3.161ON3913721933e-15
YDL029W (ARP2)3.161ON3913051923e-15
Smik_4.2063.161ON3913051923e-15
KLLA0C03850g3.161ON3913721914e-15
ADR316W3.161ON3913731914e-15
KAFR0C01040na 1ON3373051888e-15
Skud_4.2223.161ON3913051898e-15
KNAG0K01130na 1ON3933741881e-14
CAGL0K01595g3.161ON3913051862e-14
TDEL0D046103.161ON3913051862e-14
Kpol_479.253.161ON3913961853e-14
TDEL0B048102.117ON3734141791e-13
ADL253C2.248ON7511541811e-13
KNAG0I018602.248ON7531521793e-13
Kwal_33.146422.117ON3834231764e-13
NDAI0B044602.117ON3814161754e-13
TPHA0C031602.248ON7551291766e-13
Ecym_52373.161ON3913721738e-13
KLTH0B05940g2.117ON3834251702e-12
Kwal_23.48482.248ON7451531713e-12
TPHA0A009203.161ON3913121693e-12
SAKL0E08602g2.248ON7471541703e-12
ZYRO0G05676g2.117ON3814141674e-12
Skud_14.2722.248ON7551521695e-12
TDEL0C041402.248ON7491561686e-12
CAGL0J10054g2.248ON7541511686e-12
TBLA0E038602.248ON7591591686e-12
Ecym_32852.248ON7461581678e-12
KNAG0H036502.117ON3874151613e-11
KLLA0F03421g2.248ON7471921633e-11
YNL059C (ARP5)2.248ON7551521624e-11
YHR129C (ARP1)2.117ON3844201595e-11
Kpol_1003.162.248ON7491511615e-11
Smik_14.2672.248ON7551521605e-11
Kpol_1023.188.23ON3193321576e-11
Suva_14.2812.248ON7551521597e-11
NDAI0D010602.248ON7531521581e-10
KLTH0G09482g2.248ON7451531572e-10
ZYRO0A01584g2.248ON7481541525e-10
KAFR0F005902.117ON3864181506e-10
CAGL0H09042g2.117ON3874091499e-10
Skud_8.1902.117ON3843861462e-09
KAFR0J011602.248ON7511521482e-09
Smik_8.2102.117ON3844161453e-09
TBLA0B010702.117ON3834141443e-09
KLLA0B13904g1.514ON4562651427e-09
SAKL0D12804g1.514ON4562581411e-08
CAGL0F00517g1.514ON4542571392e-08
Suva_15.3262.117ON3843681382e-08
Suva_12.1541.514ON4492501355e-08
AFR419C1.514ON4552501356e-08
TPHA0O010401.514ON4582621347e-08
NDAI0A039701.514ON4622571347e-08
KNAG0B001701.514ON4532501339e-08
YJR065C (ARP3)1.514ON4492501321e-07
TBLA0D036801.514ON4583451321e-07
Smik_10.3551.514ON4492501321e-07
ZYRO0G01936g1.514ON4612541321e-07
Skud_10.2891.514ON4492541311e-07
Ecym_31531.514ON4582521311e-07
NCAS0A122701.514ON4542581292e-07
Kwal_27.99581.514ON4452181283e-07
Kpol_1056.161.514ON4602551274e-07
TDEL0F004701.514ON4612131275e-07
KLTH0C02508g1.514ON4512131257e-07
TPHA0I010301.287ON5033261241e-06
KAFR0D037001.514ON4492561222e-06
AFR105C1.287ON4791061187e-06
Kpol_282.41.287ON5011451187e-06
TBLA0D053601.287ON5961441152e-05
KLLA0D02288g1.287ON5201071142e-05
Ecym_63301.287ON4801061071e-04
KAFR0A015601.287ON4851711062e-04
NCAS0G030502.248ON7431381062e-04
KLTH0H09702g1.287ON4811061000.001
NDAI0G055801.287ON515224980.002
Suva_6.1541.287ON489106970.002
KNAG0B019201.287ON505105970.003
SAKL0D05874g1.287ON497106960.003
SAKL0F13772g7.448ON422298950.004
CAGL0M03201g1.287ON493140940.005
ZYRO0G21428g1.287ON483144940.006
TDEL0D015501.287ON48091940.006
NCAS0B060601.287ON497107920.009
Kwal_14.23771.287ON48190900.015
YJL081C (ARP4)1.287ON489107900.016
Skud_10.1321.287ON488107870.033
KNAG0G027508.713ON407156850.068
Smik_10.1611.287ON489107850.070
Kwal_27.105527.448ON351212810.19
KLTH0C05324g7.448ON399214790.33
ACR184C7.448ON40185731.6
NDAI0A002001.11ON33033722.1
Kpol_520.117.448ON488192712.9
Kpol_1036.153.124ON3030129705.2
Suva_16.4033.372ON680123696.0
KLLA0E03213g5.477ON788149696.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B02700
         (420 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   848   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   607   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   607   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   603   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   599   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   598   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   598   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   597   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   593   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   579   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   579   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   577   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   573   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   571   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   564   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   558   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   553   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   546   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   535   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   523   0.0  
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...    97   2e-21
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...    96   3e-21
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...    96   3e-21
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...    96   3e-21
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...    96   3e-21
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...    96   3e-21
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...    96   4e-21
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...    96   4e-21
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...    96   4e-21
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    96   5e-21
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...    96   6e-21
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...    96   6e-21
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    95   1e-20
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    94   1e-20
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...    94   1e-20
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    93   4e-20
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    92   6e-20
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    92   1e-19
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    91   2e-19
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    87   4e-18
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    86   2e-17
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    84   8e-17
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    83   8e-17
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    83   1e-16
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    81   4e-16
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    81   6e-16
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    80   7e-16
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    80   8e-16
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    79   2e-15
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    79   2e-15
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    79   2e-15
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    79   2e-15
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    79   2e-15
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    79   3e-15
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    79   3e-15
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    79   3e-15
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    78   4e-15
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    78   4e-15
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    77   8e-15
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    77   8e-15
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    77   1e-14
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    76   2e-14
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    76   2e-14
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    76   3e-14
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    74   1e-13
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    74   1e-13
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    74   3e-13
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    72   4e-13
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    72   4e-13
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    72   6e-13
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    71   8e-13
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    70   2e-12
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    70   3e-12
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    70   3e-12
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    70   3e-12
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    69   4e-12
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    70   5e-12
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    69   6e-12
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    69   6e-12
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    69   6e-12
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    69   8e-12
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    67   3e-11
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    67   3e-11
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    67   4e-11
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    66   5e-11
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    67   5e-11
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    66   5e-11
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    65   6e-11
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    66   7e-11
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    65   1e-10
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    65   2e-10
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    63   5e-10
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    62   6e-10
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    62   9e-10
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    61   2e-09
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    62   2e-09
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    60   3e-09
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    60   3e-09
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    59   7e-09
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    59   1e-08
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    58   2e-08
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    58   2e-08
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    57   5e-08
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    57   6e-08
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    56   7e-08
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     56   7e-08
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    56   9e-08
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    55   1e-07
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    55   1e-07
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    55   1e-07
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    55   1e-07
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    55   1e-07
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    55   1e-07
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    54   2e-07
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    54   3e-07
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    54   4e-07
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    54   5e-07
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    53   7e-07
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    52   1e-06
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    52   2e-06
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    50   7e-06
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    50   7e-06
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    49   2e-05
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    49   2e-05
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    46   1e-04
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    45   2e-04
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    45   2e-04
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    43   0.001
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    42   0.002
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    42   0.002
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    42   0.003
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    42   0.003
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    41   0.004
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    41   0.005
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    41   0.006
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    41   0.006
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    40   0.009
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    39   0.015
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    39   0.016
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    38   0.033
KNAG0G02750 Chr7 (611571..612794) [1224 bp, 407 aa] {ON} Anc_8.7...    37   0.068
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    37   0.070
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    36   0.19 
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    35   0.33 
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    33   1.6  
NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11         32   2.1  
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    32   2.9  
Kpol_1036.15 s1036 complement(31585..40677) [9093 bp, 3030 aa] {...    32   5.2  
Suva_16.403 Chr16 complement(700071..702113) [2043 bp, 680 aa] {...    31   6.0  
KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {...    31   6.5  

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/420 (96%), Positives = 407/420 (96%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQ             RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNCT 180
           EEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNCT
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNCT 180

Query: 181 WIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSPA 240
           WIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSPA
Sbjct: 181 WIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSPA 240

Query: 241 SYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFF 300
           SYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFF
Sbjct: 241 SYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFF 300

Query: 301 HPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLP 360
           HPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLP
Sbjct: 301 HPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLP 360

Query: 361 TDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQNWV 420
           TDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQNWV
Sbjct: 361 TDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQNWV 420

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/422 (64%), Positives = 350/422 (82%), Gaps = 5/422 (1%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           ME  P+V+DNGSY VKFG ++   P+ ALNA+A DK+ A+YLSNQ             RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H  GQLTSWE+Q+ +WDYC +NP+EF+GF++ D+K +HLI SETCMTLPEL KNMDQV+F
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKD-QIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNC 179
           EEYEF SL+K+P++G+MPF ++T++ ++I G+ D+E    T  T++Y  FQ+V+DSGFNC
Sbjct: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMVIDSGFNC 180

Query: 180 TWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSP 239
           TW++P+IKG+P+YKAVKKLD+GGRF+NGLLKETLSFRHYNVMDETILVNNIKEKCLF+SP
Sbjct: 181 TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240

Query: 240 ASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETF 299
            SYFDSF  KD T+ EYVLPDFQT+FLGYV    ++  P  +D+Q++TL+DELF+VPETF
Sbjct: 241 VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVA---DRKNPPSKDAQTVTLRDELFSVPETF 297

Query: 300 FHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQL 359
           FHPEI+Q+LKPG++ETILESLS++PE +RPLMVSNI+C GGNFNLPHF  R+A ELQRQL
Sbjct: 298 FHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQL 357

Query: 360 PTDWKCRITISKGNS-ELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQN 418
           PTDW  +I + +  S EL+GW +MS+FASTD+YKA RV+R+EYYEHG++W TK+RFGYQN
Sbjct: 358 PTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQN 417

Query: 419 WV 420
           W+
Sbjct: 418 WI 419

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/438 (64%), Positives = 340/438 (77%), Gaps = 18/438 (4%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           ME  P+VIDNGSY +KFGP++ + P+ ALNA+A DK+  SYLSN              RP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H LGQLT WE+++ IWDYCL+NP EF+GF++ + K  HL+ SE+CMTLPEL K+ DQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQ------------IIIGERD------TEPFVETPS 162
           EEYEF SL KSPVA ++PF ++ K +            + I + D       EP  ET S
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180

Query: 163 TEEYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 222
             +Y DFQLV+DSGF+CTWIIPV+KGIPYYKAVKKLDIGGRFL GLLKETLSFRHYN+MD
Sbjct: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 223 ETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPED 282
           ETILVNNIKEKCLFVSP SYFDSFK+K+    EYVLPDFQTSF+GYVR  NE+  PLP D
Sbjct: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300

Query: 283 SQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNF 342
           +QSITL DELF +PETFFHPEISQI+KPG+VE ILESLSM+PE++RPLM+ NI+C GGNF
Sbjct: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360

Query: 343 NLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYY 402
           NLP+FA R+A+ELQRQLPTDW C +++ +G+  L GW+ MS FA T+ Y+  RVTREEYY
Sbjct: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420

Query: 403 EHGIDWCTKHRFGYQNWV 420
           EHG DWCTKHRFGYQNW+
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/423 (66%), Positives = 341/423 (80%), Gaps = 6/423 (1%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           ME +P+ IDNGSY +KFG   L +PY A+NA A DKY  +YLSNQ             RP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H LGQLTSWE+++ IWDY L+NPDEF GF++ D K KHLI SETCMTLPEL KNMDQV+F
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPST---EEYRDFQLVVDSGF 177
           EEYEF S  KS +AG++ F  +   +II G+ + +  +++ +    +EY D+QLV+DSGF
Sbjct: 121 EEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGF 180

Query: 178 NCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFV 237
           NCTWIIPVIKG+PYYKAVKKLDIGGRFL+GLLKETLSFRHY+VMDETILVNNIKE CLFV
Sbjct: 181 NCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFV 240

Query: 238 SPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPE 297
           SP SYFDSFKNK+ T+ EYVLP+FQT+FLG+VR   ++ KPLPE++Q+I L DELF+VPE
Sbjct: 241 SPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVR---DKTKPLPENTQTIKLYDELFSVPE 297

Query: 298 TFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQR 357
           TFFHPEI++ILKPGLVETILESLSM+PE++RPL+V N++C GGNFNLPHFA+R+  ELQR
Sbjct: 298 TFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQR 357

Query: 358 QLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQ 417
           QLPTDW CR ++     EL GWKAM+ FAST+ Y+ TRVTREEYYEHG DW TK+RFGYQ
Sbjct: 358 QLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQ 417

Query: 418 NWV 420
           NW+
Sbjct: 418 NWI 420

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/438 (63%), Positives = 335/438 (76%), Gaps = 18/438 (4%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           ME  P+VIDNGSY +KFGP++ E P+ ALNA+A DK+  SYLSN              RP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H LGQLT WE+++ IWDYC +NP EF+GF++ + K  HL+ SE+CMTLPEL K+ DQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQI--IIGERDTEPFVETPSTE-------------- 164
           EEYEF SL KSPVA ++PF ++ K ++  I G+ +    V + S E              
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 165 --EYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 222
             +Y DFQLV+DSGFNCTWIIPV+KGIPYYKAVKKLD+GGRFL GLLKETLSFRHYN+MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 223 ETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPED 282
           ETILVNNIKEKCLFVSP SYFDSFK KD  + EYVLPDFQTSFLGYVR   ++  PL ED
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 283 SQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNF 342
           +Q+ITL DELF +PETFFHPEI+QI KPG+VE ILESLSM+PE++RPLMV NI+C GGNF
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 343 NLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYY 402
           NLP+FA R+A ELQRQLPTDW C +++ + +  L GW+ MS F+ST  Y+  RVTREEYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420

Query: 403 EHGIDWCTKHRFGYQNWV 420
           EHG DWCTKHRFGYQNW+
Sbjct: 421 EHGSDWCTKHRFGYQNWI 438

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/420 (65%), Positives = 336/420 (80%), Gaps = 6/420 (1%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           ME  P+V+DNGSY +KFG   LE P+ A NA+A DK+ + YLSNQ             RP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H  GQLTSWE+++ IWDYC +NPDEFNGF++ D+K +HL+ SETCMT+PEL KNMDQV+F
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNCT 180
           EEYEF S+ KSP+AG+ PF R +    I G+ D +P  +    + Y  FQLV+D GFNCT
Sbjct: 121 EEYEFASMFKSPIAGFAPFGRPSI--AISGKGDDQPNRKA-EPDAYEPFQLVIDVGFNCT 177

Query: 181 WIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSPA 240
           W++PVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKE CLFVSP 
Sbjct: 178 WVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSPV 237

Query: 241 SYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFF 300
           SYF+SFK+K+ T+ EYVLPDFQTSFLGYV+   +  KPLP+DSQ++ LKDELF+VPETFF
Sbjct: 238 SYFESFKHKEQTAVEYVLPDFQTSFLGYVK---DPKKPLPQDSQTVELKDELFSVPETFF 294

Query: 301 HPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLP 360
           HPEI Q+LKPG++ETILESLS++PE +RPLM+ NI+C GGNFNLP+FA+R+A ELQRQLP
Sbjct: 295 HPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLP 354

Query: 361 TDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQNWV 420
           TDW C + +  G  EL GW +M+SF ++ +Y   RVTREEY+EHG+DWCT+HRFGYQNW+
Sbjct: 355 TDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/438 (64%), Positives = 335/438 (76%), Gaps = 18/438 (4%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           ME  P+VIDNGSY +KFGP++ + P+ ALNA+A DK+  SYLSN              RP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H LGQLT WE+++ IWDYCL+NP EF+GF++ + K  HL+ SE+CMTLPEL K+ DQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQI--IIGERDTEPFVE----------------TPS 162
           EEYEF SL KSPVA ++PF ++ K ++  I G+ +    V                   S
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDS 180

Query: 163 TEEYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 222
             +Y DFQLV+DSGFNCTWIIPV+KGIPYYKAVKKLDIGGRFL GLLKETLSFRHYN+MD
Sbjct: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 223 ETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPED 282
           ETILVNNIKE+CLFVSP SYFDSFK KD  + EYVLPDFQTSFLGYVR   ++  PLPED
Sbjct: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300

Query: 283 SQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNF 342
           +Q ITL DELF +PETFFHPEISQI KPG+VE ILESLSM+PE++RPLMV NI+C GGNF
Sbjct: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 343 NLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYY 402
           NLP+FA R+A ELQRQLPTDW C +++ +G+  L GW+ MS FA TD Y+  RVTREEYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420

Query: 403 EHGIDWCTKHRFGYQNWV 420
           EHG DWCTKHRFGYQNW+
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/438 (63%), Positives = 332/438 (75%), Gaps = 18/438 (4%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           ME +P+VIDNGSY +KF P++ E P+ ALNA+A DK+  SYLSN              RP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H LGQLT WE+++ IWDYC +NP EF GF++ + K  HL+ SE+CMTLPEL K+ DQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQI-IIGERDTEPFVETP-----------------S 162
           EEYEF SL KSPVA ++PF ++ K ++  I  +D E  V T                  S
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180

Query: 163 TEEYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 222
             +Y DFQLV+DSGFNCTWIIPV+KGIPYYKAVKKLDIGGRFL GLLKETLSFRHYN+MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 223 ETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPED 282
           ETILVNN+KEKCLFVSP SYFDSFK KD  + EYVLPDFQTSF+GYVR   E+  PLPED
Sbjct: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300

Query: 283 SQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNF 342
           +Q+I L DELF +PETFFHPEISQI KPG+VE ILESLSM+PE++RPLMV NI+C GGNF
Sbjct: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 343 NLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYY 402
           NLP+FA R+A ELQRQLPTDW C +++  G+  L GW+ MS FA T+ Y+  RVTR+EYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420

Query: 403 EHGIDWCTKHRFGYQNWV 420
           EHG DWCTK RFGYQNW+
Sbjct: 421 EHGPDWCTKQRFGYQNWI 438

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/441 (63%), Positives = 343/441 (77%), Gaps = 23/441 (5%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           M+ TP+V+DNGSY +KFG ++ E PY ALN  A DKY ++YLSNQ             RP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H LGQLTSWE+++ IWDYCLYNPDEF+GF +G +  KHLI SE CMTLPEL KNMDQVIF
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQIII-----GERDTEPFVE-----TPSTE------ 164
           EEYEF SL K+P AGY+PF     D+ ++     G+++ +  +      T ST+      
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 165 -----EYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN 219
                +Y+D++LV+DSGFNCTWIIP+IKG+PYYKA+KKLDIGGRFL GLLKETLSFRHY+
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 220 VMDETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPL 279
           +MDET+LVNNIKEKCLFVSP SYFDSFK K+ TS EY+LPD  +S+LGY R +  + KPL
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTREN--KSKPL 298

Query: 280 PEDSQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIG 339
           PE SQ + L DELF+VPETFFHPEIS+ILKPG+VETILESLSMIPE++RPL+V+NI+C G
Sbjct: 299 PEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTG 358

Query: 340 GNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTRE 399
           GNFNLPHFA+R+A ELQRQLPTDW CRI++ K   EL  WK+M  FA+TD YK TR+++E
Sbjct: 359 GNFNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKE 418

Query: 400 EYYEHGIDWCTKHRFGYQNWV 420
           EYYEHG DW TKH+FGYQNW+
Sbjct: 419 EYYEHGPDWLTKHKFGYQNWL 439

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/423 (65%), Positives = 331/423 (78%), Gaps = 8/423 (1%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRPHTLG 64
           P VIDNGSY +KFG A+L  P+ A N IA DKY ASYLSN              RPH LG
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELG 62

Query: 65  QLTSWEMQTLIWDYCLYNPDEFNGFNIGD-TKSKHLITSETCMTLPELGKNMDQVIFEEY 123
           QL SWE++  IWDYCLYNPDEF+GF++GD T+ + LI +ETC TLPEL KN DQV+FEEY
Sbjct: 63  QLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEEY 122

Query: 124 EFGSLMKSPVAGYMPF--LRNTKDQIIIGERDTEPFVE--TPSTEEYRDFQLVVDSGFNC 179
           EF ++ KSP +G+MPF  L   K+   +  +DT    +  T +T+EYRDFQLV+DSGFNC
Sbjct: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRDFQLVIDSGFNC 182

Query: 180 TWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSP 239
           TW++P+IKG+P+YKA+KK+DIGGRFLNGLLKETLSFRHYN+MDETIL+NNIKEKCLFVSP
Sbjct: 183 TWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVSP 242

Query: 240 ASYFDSFKNKDITSREYVLPDFQTSFLGY-VRPSNEQGKPLPEDSQSITLKDELFAVPET 298
            SYFDSFK K   + EYVLPDFQTSFLGY V  SN +G       Q+ITL DE FAVPET
Sbjct: 243 VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGS-VQTITLTDERFAVPET 301

Query: 299 FFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQ 358
           FFHPE++ ILKPGLVETILE++SM+PE +RP++VSNI+C+GGNF LPH +SR+  ELQRQ
Sbjct: 302 FFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQ 361

Query: 359 LPTDWKCRITI-SKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQ 417
           LPTDW CR+T+ S  + EL+ W AM+ F+STD+YK TRVTREEY EHG DWC+KHRF YQ
Sbjct: 362 LPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQ 421

Query: 418 NWV 420
           NW+
Sbjct: 422 NWI 424

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/444 (61%), Positives = 340/444 (76%), Gaps = 26/444 (5%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           M++ P+VIDNGSY +KFG ++   P+ A+NAIA DKY+  YLSNQ             RP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           + LGQLTSWE+++ IWDYC YNP+EF+GF + DT  KHL+ SETC++LPE  +N+D +IF
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKD---------------------QIIIGERDTEPFVE 159
           EEY +GS+ KSPVAG++PF   TKD                     Q++  + +T    E
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSE 180

Query: 160 TPS---TEEYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFR 216
            PS   T EY+DFQL++DSGFNCTWIIPVIKGIPYYKA+KK+DIGGRFL GLLKETLSFR
Sbjct: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240

Query: 217 HYNVMDETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQG 276
           HYNV DETILVNNIKEKCLFV+P SY +SFK K+ T+ EYVLPDF T+F+GY++  N + 
Sbjct: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIK-DNSKT 299

Query: 277 KPLPEDSQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIM 336
           K LP+++Q ITLKDELF+V ET FHPEIS+ILKPG++ETI+ESLSM+PEVIRPLMV+NI+
Sbjct: 300 K-LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIV 358

Query: 337 CIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRV 396
           CIGGNFNLP+F+ R+  ELQRQLPTDW   + I K ++EL GWKAM+ F+ TD Y+  R+
Sbjct: 359 CIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARI 418

Query: 397 TREEYYEHGIDWCTKHRFGYQNWV 420
           TREEY EHG++WCTKHRFGYQNW+
Sbjct: 419 TREEYMEHGVEWCTKHRFGYQNWI 442

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/423 (62%), Positives = 333/423 (78%), Gaps = 6/423 (1%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           MEE P+VIDNGSY +KFG AS   P+ ALN+IA DKY   +LSNQ             RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H LGQL SWE+++ IWDYCL+NPDEF+G+++  TK+KHLI SE+CMTLPEL KNMDQV+F
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYEFGSLMKSPVAGYMPF-LRNTKDQIIIGERDTEPFV-ETPS-TEEYRDFQLVVDSGF 177
           EEYE+ SL K+PV  ++PF        I++ + D +    + PS  ++YRD++LV+DSGF
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180

Query: 178 NCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFV 237
           NCTW++PVIKG+PYYKAVKKLDIGGRFLNG L+E LSFRHYNVMDETILVN+IKEKCLF+
Sbjct: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240

Query: 238 SPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPE 297
           SP SYFDSF+++  T++EYVLPDF TSF GY+R   + G+ LPEDSQ+I L+DELFAVPE
Sbjct: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLR---KPGQTLPEDSQTIILQDELFAVPE 297

Query: 298 TFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQR 357
           TFFHPEI+ +L PG++E ILES+SM+PE +RPL+V N++  GGNFN+P+FASR+A ELQR
Sbjct: 298 TFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQR 357

Query: 358 QLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQ 417
           Q PTDW CR+++  G++ L GWK M  F+ T  Y+ +RV+REEYYEHG+DWCT  RFGYQ
Sbjct: 358 QCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEYYEHGVDWCTSKRFGYQ 417

Query: 418 NWV 420
            W+
Sbjct: 418 AWL 420

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/429 (63%), Positives = 333/429 (77%), Gaps = 11/429 (2%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           ME+ P+VIDNGSY VKFG +  + P  ALNA+A DKY A YLSNQ             RP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H LGQL SWE++  +WDYC +NPDEF  FN+ +TK  HL+ SETCMTLPEL  NMDQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKD--QIIIGERD--TEPFVETPSTEE----YRDFQLV 172
           EEYEF SL KSPVAG++PFL N +D  ++I G+ D      +    ++     Y DF LV
Sbjct: 121 EEYEFESLFKSPVAGFVPFL-NLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLV 179

Query: 173 VDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKE 232
           +DSGFNCTWIIP+IKG+PYYKAVKK+++GGRFLNGL KET+S+RHY+V DETILVNNIKE
Sbjct: 180 IDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKE 239

Query: 233 KCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDEL 292
           KCLF+SP SY DSFKNKD  S +YVLPDFQTSF+GYV+      + LPE+SQ ITL DEL
Sbjct: 240 KCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQ-LPENSQVITLTDEL 298

Query: 293 FAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVA 352
           F+VPET FHPE++++LKPG+VETILESLS++PE IRPL+V+NI+C+GGNFN+P+F SR+A
Sbjct: 299 FSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLA 358

Query: 353 KELQRQLPTDWKCRITISKGNSELSGWKAMSSFA-STDIYKATRVTREEYYEHGIDWCTK 411
            ELQRQLPTDW C I I + + EL GWK+MS FA +TDIYK  R++REEYYEHG DW TK
Sbjct: 359 TELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTK 418

Query: 412 HRFGYQNWV 420
            RFGYQNW+
Sbjct: 419 KRFGYQNWI 427

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/423 (63%), Positives = 330/423 (78%), Gaps = 7/423 (1%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           M++TP++IDNGSY VKFGPA+   P+ ALNA+A DKY   +LSNQ             RP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H LGQLTSWE+Q+ IWDYCLYNPDEFN + IG+TK KHL+ SE CM++PEL K  DQV+F
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTE--EYRDFQLVVDSGFN 178
           EEYEFGS  K PVAG++PF     +  +I  ++   + +  + E  EY DFQLV+DSGFN
Sbjct: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179

Query: 179 CTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVS 238
           CTW++P++KGIPYYKA+KKLDIGGRFLNG LKETLSFRHYNVMDETILVNNIKEKCLF+S
Sbjct: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMS 239

Query: 239 PASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPET 298
           P SYF+SF+ K+ T+ EYVLPDFQTSF GYV+   +Q + +PEDSQ+I L DELF++PET
Sbjct: 240 PVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVK---QQKQKIPEDSQTIKLYDELFSIPET 296

Query: 299 FFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQ 358
           FFHPEI+ +LKPG+VETILES+SM+PE IRPLMVSN +  GGNFN+ +FA R+A ELQRQ
Sbjct: 297 FFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQ 356

Query: 359 LPTDWKCRITI-SKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQ 417
            PTDW   +++ +  ++ L GW +M  F+ T  Y+ TRVTREEYYEHG+DWCTK RFGYQ
Sbjct: 357 CPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQ 416

Query: 418 NWV 420
            W+
Sbjct: 417 KWL 419

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/422 (62%), Positives = 327/422 (77%), Gaps = 5/422 (1%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           MEE+P++IDNGSY +KFG  S + P+ ALN+IA DKY   +LSNQ             RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H LGQL SWE++T IWDYCL+NPD+FNG++I  TK KHLITSE+CMT+PEL KNMDQV+F
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKD--QIIIGERDTEPFVETPSTEEYRDFQLVVDSGFN 178
           EEYEF ++ K+PV  ++PF    K    ++  E       E    + Y DFQLV+DSGFN
Sbjct: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFN 180

Query: 179 CTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVS 238
           C+WI+PVIKG+PYYKAVKKLDIGGRFLNG L+E LSFRHYNVMDETILVN+IKE CLF+S
Sbjct: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240

Query: 239 PASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPET 298
           P +YF+SF+++  T++EYVLPDF TSF GY+R   + G+ LP +SQ+I L+DELFAVPET
Sbjct: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLR---KPGQVLPAESQTIVLQDELFAVPET 297

Query: 299 FFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQ 358
           FFHPEI+ +L  G+VETILES+SM+PE IRPLMV NI+  GGNFN+P+FASR+A ELQRQ
Sbjct: 298 FFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQ 357

Query: 359 LPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQN 418
            PTDW CR+++ KG++ L GWK M  F+ T+ Y  +RVTR+EYYEHG+DWCT  RFGYQ 
Sbjct: 358 CPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQA 417

Query: 419 WV 420
           W+
Sbjct: 418 WL 419

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/417 (63%), Positives = 325/417 (77%), Gaps = 8/417 (1%)

Query: 4   TPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRPHTL 63
            P++IDNGSY +KFGP+SL++PY ALN +A DKY   +LSNQ             RP  L
Sbjct: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62

Query: 64  GQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIFEEY 123
           GQL SWE++  IWDYCL+N DEF+ +++ D+K   LI SETCM++PE+ K+MDQV+FEEY
Sbjct: 63  GQLVSWELEEHIWDYCLFNSDEFS-WDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEY 121

Query: 124 EFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNCTWII 183
           EFGSLMK PVA Y+PF  N  D  + G  D  P V     ++Y DFQLVVDSGFNCTW+I
Sbjct: 122 EFGSLMKCPVAQYIPF-DNMADYKVYGS-DGLPVVR--KKDDYNDFQLVVDSGFNCTWVI 177

Query: 184 PVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSPASYF 243
           PVIKG+PYYKAVKKLDIGGRFL GLLKET+SFRHYN+MDETIL NNIKE+C F+ P SYF
Sbjct: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYF 237

Query: 244 DSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFFHPE 303
           DSF+ K  T  +YVLPDFQTS +GYVR   +  + +PEDSQ++ L+DELF +PETFFHPE
Sbjct: 238 DSFQKKAETRIDYVLPDFQTSLIGYVR---QPKQAIPEDSQTLNLEDELFTIPETFFHPE 294

Query: 304 ISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDW 363
           I+ ILKPGL+ET+LES+SM+PE+IRPLMVSNI  IGGNFN+ +FASR+A ELQRQ PTDW
Sbjct: 295 IANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDW 354

Query: 364 KCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQNWV 420
             R+ + KG++EL GWKAM  F++TD YK  RVTR EY EHG+DWCTK+RFGY+ W+
Sbjct: 355 SVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/424 (61%), Positives = 320/424 (75%), Gaps = 12/424 (2%)

Query: 3   ETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRPHT 62
           +  +VIDNGSY+VKFG AS   P  ALNA+A DKY  ++LSNQ             RPH 
Sbjct: 4   DQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHE 63

Query: 63  LGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIFEE 122
           LGQLTSWE+++ IWDYCLYNPDEF G +    +++H++ SETCMTLPEL KN DQV+FEE
Sbjct: 64  LGQLTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEE 122

Query: 123 YEFGSLMKSPVAGYMPFLRNTKDQIII------GERDTEPFVETPSTEEYRDFQLVVDSG 176
           YE  SL K+P A Y+PF    ++   I      GE D E  +E  + +EY DF LV+DSG
Sbjct: 123 YEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIE--AGKEYNDFSLVIDSG 180

Query: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLF 236
           FNCTW+IP++KG+PYYKAVKKLD+GGRFLNGLLKET+SFRHYNVMDE+ILVNNIKE+CL+
Sbjct: 181 FNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLY 240

Query: 237 VSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVP 296
           V P SYF++FK K     ++VLPDFQTSF GYVR   +    LP+++Q +TL DE F+VP
Sbjct: 241 VDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVR---DPKTALPDNAQILTLTDERFSVP 297

Query: 297 ETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQ 356
           E FFHPEISQ LKPG++ET+LES+ M+PE++RPLM SNI+C+GGNFNLP F  R+  ELQ
Sbjct: 298 EAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQ 357

Query: 357 RQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGY 416
           RQLPTDW CR  IS G+  L+GW AM+ FA TD YK  RVT+E+Y+EHG+DW TK RFGY
Sbjct: 358 RQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGY 417

Query: 417 QNWV 420
           QNWV
Sbjct: 418 QNWV 421

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/417 (62%), Positives = 318/417 (76%), Gaps = 9/417 (2%)

Query: 4   TPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRPHTL 63
            P++++NGSY +KFGPA+LE PY A N +  D+Y   +LSNQ             RP  L
Sbjct: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62

Query: 64  GQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIFEEY 123
           GQL SWE++  IWDYCL+NPDEF G+ + D+K   LI SETCMT+PE+ KNMDQV+FEEY
Sbjct: 63  GQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEY 121

Query: 124 EFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNCTWII 183
           EFGS+MK PVA ++PF R     I+ G  +    VE  S   Y +FQLVVDSGFNCTW++
Sbjct: 122 EFGSMMKCPVAQFVPFDRARDYDIVGGAGEV---VEAKSG--YNNFQLVVDSGFNCTWVM 176

Query: 184 PVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSPASYF 243
           PVIKG+PYYKA KKLDIGGRFLNGLLKET+SFRHYNVMDETIL+NNIKE+C F+ P SYF
Sbjct: 177 PVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYF 236

Query: 244 DSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFFHPE 303
           DSF+ K+ T  EY+LPDFQTS +GYVR   +  + +P+ SQ + L+DELF VPETFFHPE
Sbjct: 237 DSFQRKEETRVEYILPDFQTSLIGYVR---QPKQAIPKTSQILRLEDELFTVPETFFHPE 293

Query: 304 ISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDW 363
           IS ILKPGLVETILE +SM+PEV+RPL+VSNI+ +GGNFN+ +FA+R+A ELQRQ PTDW
Sbjct: 294 ISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDW 353

Query: 364 KCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQNWV 420
           K R+   K ++ L GWK+M  F+ TD YK +RVTR EY EHG DWCTKHRFGY+ W+
Sbjct: 354 KVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/422 (57%), Positives = 316/422 (74%), Gaps = 3/422 (0%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           M E P++IDNGSY +KFG ++ E P+ ALNA+A DKY+  YLSNQ             RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120
           H LGQL SWE++  IWDYC YN D+F GF + +    HL+ +ET MTLPEL +N DQV+F
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNCT 180
           EEY F SL K+P A ++PF++N  +  I     ++ +++      Y+DF LV+DSG+NC+
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNCS 180

Query: 181 WIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSPA 240
           WIIP+IKG+PYYKAVKK+D+GGRFLNGLLKET+S+RHY+V DE++LVNNIKE C+F+SP 
Sbjct: 181 WIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFISPV 240

Query: 241 SYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFF 300
           SY +SFK K +T  EYVLPDFQTSF+GYVR   +    LPE SQSI L+DELF+VPE FF
Sbjct: 241 SYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHST-LPEHSQSIILEDELFSVPEGFF 299

Query: 301 HPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLP 360
           HPE++ +LKPG++ETILESL ++PE +R LMV+NI+C GGNFN+P+F SR+  ELQ+Q+ 
Sbjct: 300 HPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQ 359

Query: 361 TDWKCRITISKGNSELSGWKAMSSFAST--DIYKATRVTREEYYEHGIDWCTKHRFGYQN 418
           T+W C ++I K N+EL  WKAM SF     ++YK TRVT++EY EHG +W TK RFGYQN
Sbjct: 360 TEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQN 419

Query: 419 WV 420
           W+
Sbjct: 420 WL 421

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/424 (58%), Positives = 311/424 (73%), Gaps = 13/424 (3%)

Query: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRP 60
           M E  +VIDNGSY +KFG +  + P  ALN +  DKY   +LSNQ             RP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HTLGQLTSWEMQTLIWDYCLYNPDEF--NGFNIGDTKSKHLITSETCMTLPELGKNMDQV 118
           H LGQL SWE+++ +WDYC YN D+F  N  +  DTK  HL+ SET MT+PEL KNMDQV
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120

Query: 119 IFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFN 178
           IFEEY+F S+ K PVA Y+PF +         + D     E   T  Y+DFQLV+DSGFN
Sbjct: 121 IFEEYDFKSMFKGPVAQYIPFYQGQY------QDDAMTAAEDKKTSSYKDFQLVIDSGFN 174

Query: 179 CTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVS 238
           CTW +P+IKG+PYYKA+KKLDIGGRFL GLL+ET+SFRHYNVM+ETILVNNIKE+C FV 
Sbjct: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVP 234

Query: 239 PASYFDSFKNKDITSREYVLPDFQTSFLGYV-RPSNEQGKPLPEDSQSITLKDELFAVPE 297
           P SYF SF NK  T  EYVLPDFQTSFLGYV +P  E+   L +D+Q++ L DE+F+VPE
Sbjct: 235 PESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEK---LTDDAQTLLLTDEVFSVPE 291

Query: 298 TFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQR 357
           TFFHPEI+QILKPG+VETILE ++M PEV+RPL+V+NI+C GGNFN+P+F  R+  ELQR
Sbjct: 292 TFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQR 351

Query: 358 QLPTDWKCRI-TISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGY 416
           Q P DW C++ +  + +  L GW++M  FA++D +++ RVTREEY EHG+DWCTK+RFGY
Sbjct: 352 QCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGY 411

Query: 417 QNWV 420
           Q W+
Sbjct: 412 QQWL 415

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 97.1 bits (240), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 103/417 (24%), Positives = 160/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP I  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 160/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 160/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 160/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 160/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 160/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 95.9 bits (237), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 160/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 95.9 bits (237), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 160/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 95.9 bits (237), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 160/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 95.9 bits (237), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 160/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSVEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 95.5 bits (236), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 101/417 (24%), Positives = 160/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  + +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMEVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 95.5 bits (236), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 161/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTASQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG+   P  A
Sbjct: 251 GNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 101/417 (24%), Positives = 159/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQILFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR +   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S  E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSAIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 101/417 (24%), Positives = 159/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G      + ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 101/417 (24%), Positives = 159/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 64

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 65  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 116

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 117 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 152

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR +   L + LS R Y+     E  +V +
Sbjct: 153 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRD 212

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S  E+   LP D Q IT+
Sbjct: 213 IKEKLC--------------------YVALDFEQEMQTAAQSSAIEKSYELP-DGQVITI 251

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 252 GNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 311

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 312 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 367

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 92.8 bits (229), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 100/417 (23%), Positives = 159/417 (38%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKNN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQILFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G     A+ ++D+ GR +   L + L+ R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S  E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTASQSSAVEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 92.4 bits (228), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 100/417 (23%), Positives = 158/417 (37%), Gaps = 67/417 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQILFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G      + ++D+ GR +   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S  E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSAIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A
Sbjct: 251 GNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 310

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 311 ERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 96/414 (23%), Positives = 157/414 (37%), Gaps = 61/414 (14%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXR-- 59
           E   +VIDNGS   K G A  +AP     +I         +                +  
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDCYVGDEAQSKRG 64

Query: 60  ------PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGK 113
                 P   G +T+W+    IW +  YN        +   +   L+T E  M      +
Sbjct: 65  ILTLRYPIEHGIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSNRE 118

Query: 114 NMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVV 173
            M Q++FE +   +   S  A    +                           R   +V+
Sbjct: 119 KMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGIVL 154

Query: 174 DSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNNIK 231
           DSG   T ++P+  G     A+ ++D+ GR +   L + LS R Y+     E  +V +IK
Sbjct: 155 DSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIK 214

Query: 232 EKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDE 291
           EK  +V+     D  +     ++   +               E+   LP D Q IT+ +E
Sbjct: 215 EKLCYVA----LDYDQEMQTAAQSSAI---------------EKSYELP-DGQVITIGNE 254

Query: 292 LFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRV 351
            F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG    P  A R+
Sbjct: 255 RFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERM 314

Query: 352 AKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHG 405
            KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E G
Sbjct: 315 QKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESG 367

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 108/242 (44%), Gaps = 25/242 (10%)

Query: 167 RDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDET 224
           R   +V+DSG   T ++P+  G     A+ ++D+ GR L   L + LS R Y+     E 
Sbjct: 132 RTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAER 191

Query: 225 ILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDS 283
            +V +IKEK                      YV  DF+       + S+ E+   LP D 
Sbjct: 192 EIVRDIKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DG 230

Query: 284 QSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFN 343
           Q IT+ +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG   
Sbjct: 231 QVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTM 290

Query: 344 LPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYE 403
            P  A R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E
Sbjct: 291 FPGIAERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDE 349

Query: 404 HG 405
            G
Sbjct: 350 SG 351

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 87.0 bits (214), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 106/242 (43%), Gaps = 25/242 (10%)

Query: 167 RDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDET 224
           R   +V+DSG   T ++P+  G      + ++D+ GR +   L + LS R Y+     E 
Sbjct: 132 RTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAER 191

Query: 225 ILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDS 283
            +V +IKEK                      YV  DF+       + S  E+   LP D 
Sbjct: 192 EIVRDIKEKLC--------------------YVALDFEQEMQTAAQSSAIEKSYELP-DG 230

Query: 284 QSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFN 343
           Q IT+ +E F  PE  FHP +  +   G+ +T   S+      +R  +  NI+  GG   
Sbjct: 231 QVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTM 290

Query: 344 LPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYE 403
            P  A R+ KE+    P+  K +I I+    + S W   S  AS   ++   ++++EY E
Sbjct: 291 FPGIAERMQKEITALAPSSMKVKI-IAPPERKYSVWIGGSILASLTTFQQMWISKQEYDE 349

Query: 404 HG 405
            G
Sbjct: 350 SG 351

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 103/424 (24%), Positives = 161/424 (37%), Gaps = 70/424 (16%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKYDA---------SYLSNQXXXXXXXXX 54
           PVV+DNGS  +K G +  E P C   + I   KY+          +++ NQ         
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGLLK 96

Query: 55  XXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKN 114
                 H  G +T+W     +W Y      +    N+ D  +   + +E  +   +  + 
Sbjct: 97  LRYPLQH--GIVTNWADMEQVWGYVFNKSLQLQ--NVEDHPN---LVTEAPLNPHKNREK 149

Query: 115 MDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVD 174
           M +++FE +   +L  S  A    +                           R    VVD
Sbjct: 150 MCELLFESFNVPALYVSVQAVLSLYASG------------------------RTTGCVVD 185

Query: 175 SGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNNI 230
            G  C   +PV  G     +++++DI GR    FL  LL++T      +  +  I V  I
Sbjct: 186 CGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREI-VRTI 244

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           KEK  FV+          KD    E   P    SF  +  P          D ++I L  
Sbjct: 245 KEKACFVT----------KDPKLEEQNFP-MNPSFSKFKLP----------DGKTIELGQ 283

Query: 291 ELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASR 350
           E +  PE  F PE+       L +   +S+  +   +R L+ SNI+  GG   LP F  R
Sbjct: 284 ERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLPGFGDR 343

Query: 351 VAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCT 410
           + KEL+    +  K +I  +    + S W   S  +    +K   VT+ E+ E     C 
Sbjct: 344 LLKELKSLSGSRTKIKI-FAPPERKYSTWIGGSILSGLSTFKKLWVTKSEWEE--FPDCI 400

Query: 411 KHRF 414
             RF
Sbjct: 401 HSRF 404

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 94/390 (24%), Positives = 153/390 (39%), Gaps = 78/390 (20%)

Query: 4   TPVVIDNGSYRVKFGPASLEAPYCALNAIAND----KYDASYLSNQXXXXXXXXXXXXXR 59
           +P+V+D G+  VK G A    P     +I         +   +S               R
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEASEVR 64

Query: 60  -------PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112
                  P   G + +W    L+WDY       FN   +  T    ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAF-----FNQMKLPTTSGGKVLLTEPPMNPVKNR 119

Query: 113 KNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDF 169
           + M +V+FE Y+FG +   +++ +A Y   L +                           
Sbjct: 120 ERMCEVMFERYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILV 227
            +VVDSG   T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 154 -VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTADFETV 212

Query: 228 NNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285
             IKEK  +VS     D+   ++ T+  +EY LP                      D + 
Sbjct: 213 RQIKEKVCYVSYDLNLDTKLARETTTLVQEYELP----------------------DGRI 250

Query: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345
           I +  E F  PE  F P++  +  PG+ E +  ++      +R  +   I+  GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYP 310

Query: 346 HFASRVAKELQRQLPTDWKCRITISKGNSE 375
              SR+ +EL +QL   W  RI   KG++E
Sbjct: 311 GLPSRLEREL-KQL---WFTRIL--KGDAE 334

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 83.2 bits (204), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 90/420 (21%), Positives = 163/420 (38%), Gaps = 80/420 (19%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKYDASYLSNQXXXXXXXXXXXXXR---- 59
           PVVIDNG+  +K G    + P C   N +   K+D   +                R    
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENRGLLR 69

Query: 60  ---PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMD 116
              P   G++  W+    +W + L      +  NI   +   ++ +E  +   +  ++M 
Sbjct: 70  LRHPMEHGEVKHWDEMEAVWKHTL-----LHDLNIQHIEEHPILITEAPLNSSKNREHMC 124

Query: 117 QVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEY----RDFQLV 172
           +++FE +   ++                             VE P+        R    V
Sbjct: 125 EILFESFNIPAI----------------------------HVENPAVLALYSGGRTTGCV 156

Query: 173 VDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVM-------DETI 225
           +D G      +P+ +G     +++++DIGGR +     E L F+    +       +E  
Sbjct: 157 IDCGEGYCSAVPIYEGFALTPSIRRIDIGGREIT----EQLQFQIRKSVGMSLFSSNEKE 212

Query: 226 LVNNIKEKCLFVSPASYFDSFKNKDITSRE--YVLPDFQTSFLGYVRPSNEQGKPLPEDS 283
           +V  IKE+  +V+           DI+  E  Y+L             SN     LP D 
Sbjct: 213 IVRTIKERACYVA----------DDISKEEHKYILDS----------ESNSSKFKLP-DG 251

Query: 284 QSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFN 343
           +S+++ +  F   E  F+P +       + E + ++LS +   +RP++  +++  GG   
Sbjct: 252 KSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTV 311

Query: 344 LPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYE 403
           LP F +R+ KELQ     D K RI I+    + + W   S  A    ++   VT+  + E
Sbjct: 312 LPGFGNRILKELQILTKQDTKLRI-IASPERKYTTWIGGSILAGLSTFQKILVTKSNWNE 370

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 130/315 (41%), Gaps = 65/315 (20%)

Query: 60  PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVI 119
           P   G + +W    L+WDY       FN   + +T    ++ +E  M   +  + M +V+
Sbjct: 72  PMENGIIKNWTDMELLWDYAF-----FNQMKLNNTSGGKILLTEPPMNPLKNREKMCEVM 126

Query: 120 FEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSG 176
           FE+Y+FG +   +++ +A Y   L +                            +VVDSG
Sbjct: 127 FEKYDFGGVYVAIQAVLALYAQGLSSG---------------------------VVVDSG 159

Query: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKEKC 234
              T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKEK 
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 235 LFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDEL 292
            +VS     D+   ++ T+    Y LPD +T                      I +  E 
Sbjct: 220 CYVSYDLDLDTKLARETTTLVESYELPDGRT----------------------IKVGQER 257

Query: 293 FAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVA 352
           F  PE  F P +  + +PG+ E +  ++      +R  +   I+  GG+   P   SR+ 
Sbjct: 258 FEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMYPGLPSRLE 317

Query: 353 KELQRQLPTDWKCRI 367
           KEL +QL   W  R+
Sbjct: 318 KEL-KQL---WYTRV 328

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 99/424 (23%), Positives = 163/424 (38%), Gaps = 70/424 (16%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKYDA---------SYLSNQXXXXXXXXX 54
           P+V+DNGS  +K G +  E P C   + I   KY+          +++ NQ         
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGLLK 68

Query: 55  XXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKN 114
                 H  G + +W     IW Y ++N        + + +   ++ +E  +      + 
Sbjct: 69  LRHPVEH--GIVKNWSDMEHIWSY-VFN----KSLQLQNVEDHPILITEAPLNPRNNRER 121

Query: 115 MDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVD 174
           M +++FE +   +L  S  A    +                           R    VVD
Sbjct: 122 MCELLFESFNVPALYVSIQAVLSLYASG------------------------RTTGCVVD 157

Query: 175 SGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNNI 230
            G  C   +PV  G     +++++DI GR    FL  LL++T      +  +  + V  I
Sbjct: 158 CGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREV-VRII 216

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           KEK  +V+        K+  I  + + +    T F             LP D ++I L  
Sbjct: 217 KEKACYVA--------KDPHIEEQNFSINPNYTKF------------KLP-DGKTIDLGQ 255

Query: 291 ELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASR 350
           E F  PE  F PE+       L +   +S+  +   +R L+ SN++  GG   LP F  R
Sbjct: 256 EKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSILPGFGDR 315

Query: 351 VAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCT 410
           +  EL+    +  K +I  +    + S W   S  +    +K   VTR E +E   D C 
Sbjct: 316 LLSELKSLSDSQTKIKI-FAPPERKYSTWIGGSILSGLSTFKKLWVTRAE-WEEAAD-CI 372

Query: 411 KHRF 414
             RF
Sbjct: 373 HSRF 376

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 95/424 (22%), Positives = 166/424 (39%), Gaps = 70/424 (16%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYCALNAIAN---------DKYDA-SYLSNQXXXXXXXXX 54
           P+V+DNGS  +K G    + P C  +++            ++D  +++ NQ         
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGLLK 71

Query: 55  XXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKN 114
                 H  G +T W     +W +         G  +   +   ++ +E  +   +  + 
Sbjct: 72  LRHPLEH--GVVTDWNALEQLWGHVFEK-----GLQLSSLQDHPVLVTEAPLNPKKNREQ 124

Query: 115 MDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVD 174
           M +++FE +   ++  S  A    +                           R    V+D
Sbjct: 125 MCELLFETFSVPAVYVSIQAVLSLYASG------------------------RTTGCVLD 160

Query: 175 SGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVM----DETILVNNI 230
           SG  C+  +PV  G     A++++DI GR ++ LL + L  +   V      E  +V  I
Sbjct: 161 SGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELL-QVLIRKSTGVSLLSSSEREIVRII 219

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           KEK  +++     D  + +    + Y +   QT F             LP D + I L +
Sbjct: 220 KEKACYIA----LDPKEEE----KNYTMHGKQTMFR------------LP-DGKQIELDN 258

Query: 291 ELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASR 350
           E F  PE  F+P++       L E + ES+  +   +R  + SNI+  GG   +P F  R
Sbjct: 259 EKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGFGDR 318

Query: 351 VAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCT 410
           V KEL+       K +I  +    + S W   S  +    +K   VT++E+ E+    C 
Sbjct: 319 VLKELKLSCEPQTKIKI-FAPPERKYSTWIGGSILSGLSTFKKIWVTKKEWEEN--PRCV 375

Query: 411 KHRF 414
             RF
Sbjct: 376 HARF 379

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 80.5 bits (197), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 85/372 (22%), Positives = 144/372 (38%), Gaps = 72/372 (19%)

Query: 4   TPVVIDNGSYRVKFG-----------PASLEAPYCALNAIANDKYDASYLSNQXXXXXXX 52
           +P+V+D G+  VK G           P+ +  P       AN       +          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64

Query: 53  XXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112
                  P   G + +W    L+WDY       F    +  T +  ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPTTSNGKILLTEPPMNPTKNR 119

Query: 113 KNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDF 169
           + M +V+FE+Y+FG +   +++ +A Y   L +                           
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILV 227
            +VVDSG   T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 154 -VVVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETV 212

Query: 228 NNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285
             IKEK  +VS     D+   ++ T+    Y LPD +T                      
Sbjct: 213 RQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRT---------------------- 250

Query: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345
           I +  E F  PE  F P +  + +PG+ E + +++      +R  +   I+  GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYP 310

Query: 346 HFASRVAKELQR 357
              SR+ KEL++
Sbjct: 311 GLPSRLEKELKQ 322

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 80.1 bits (196), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 95/424 (22%), Positives = 164/424 (38%), Gaps = 70/424 (16%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKYDA---------SYLSNQXXXXXXXXX 54
           P+V+DNGS  +K G +  E P C   + I   KY+           ++ NQ         
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGLLK 70

Query: 55  XXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKN 114
                 H  G + +W    LIW++  +   + N     + +   ++ +E  +   +  + 
Sbjct: 71  LRYPLEH--GIVKNWSDMELIWNHVFHKSLQLN-----NIEEHPVLATEAPLNPLKNREA 123

Query: 115 MDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVD 174
           M +++FE +   ++  S  A    +                           R    V+D
Sbjct: 124 MCEMLFETFNVPAVYVSIQAVLSLYASG------------------------RTTGCVLD 159

Query: 175 SGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNNI 230
            G  C   +PV  G     +++++D+ GR    FL  LL++T      +  +  I V  I
Sbjct: 160 CGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSEREI-VRII 218

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           KEK  +V+        ++     + Y L    T F             LP D + + LK+
Sbjct: 219 KEKACYVA--------RDPLTEEQTYHLTPTSTIF------------KLP-DGKVLDLKN 257

Query: 291 ELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASR 350
           E F  PE  F P++       + E   +S+S +   +RP ++SNI+  GG    P F  R
Sbjct: 258 EKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTMFPGFGDR 317

Query: 351 VAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCT 410
           +  EL+       K +I  +    + S W   S  +    +K   VT+ E+ E+    C 
Sbjct: 318 LLTELRNLSEPQTKIKI-FAPPERKYSTWIGGSILSGLSTFKKIWVTKSEWQEN--PDCV 374

Query: 411 KHRF 414
             RF
Sbjct: 375 HSRF 378

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 85/373 (22%), Positives = 141/373 (37%), Gaps = 72/373 (19%)

Query: 3   ETPVVIDNGSYRVKFG-----------PASLEAPYCALNAIANDKYDASYLSNQXXXXXX 51
            TP+V+D G+  VK G           P+ +  P       AN       +         
Sbjct: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                   P   G + +W    L+WDY  Y+        +  T    ++ +E  M     
Sbjct: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQ-----MKLPSTSGGKVMLTEPPMNPLRN 118

Query: 112 GKNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRD 168
            + M +V+FE+Y+FG +   +++ +A Y   L +                          
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------------- 153

Query: 169 FQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETIL 226
             +VVDSG   T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFET 211

Query: 227 VNNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQ 284
           V  IKEK  +VS     D+   ++ T+    Y LP                      D +
Sbjct: 212 VRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP----------------------DGR 249

Query: 285 SITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNL 344
            I +  E F  PE  F P +  + +PG+ E +  ++      +R  +   I+  GG+   
Sbjct: 250 VIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMY 309

Query: 345 PHFASRVAKELQR 357
           P   SR+ KEL++
Sbjct: 310 PGLPSRLEKELKQ 322

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 124/305 (40%), Gaps = 61/305 (20%)

Query: 60  PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVI 119
           P   G + +W    L+WDY  Y+        +  T    ++ +E  M   +  + M +V+
Sbjct: 18  PMENGVIKNWSDMELLWDYAFYDQ-----MQLPSTSGGKVMLTEPPMNPVKNREQMCEVM 72

Query: 120 FEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSG 176
           FE+Y+FG +   +++ +A Y   L +                            +VVDSG
Sbjct: 73  FEKYDFGGVYVAIQAVLALYAQGLSSG---------------------------VVVDSG 105

Query: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKEKC 234
              T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKEK 
Sbjct: 106 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 165

Query: 235 LFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDEL 292
            +VS     D+   ++ T+    Y LP                      D + I +  E 
Sbjct: 166 SYVSYDLDLDTKLARETTTLVENYELP----------------------DGRVIKVGSER 203

Query: 293 FAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVA 352
           F  PE  F P +  + +PG+ E +  ++      +R  +   I+  GG+   P   SR+ 
Sbjct: 204 FEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLE 263

Query: 353 KELQR 357
           KEL++
Sbjct: 264 KELKQ 268

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 91/430 (21%), Positives = 165/430 (38%), Gaps = 78/430 (18%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKYDASYLSNQXX----------XXXXXX 53
           PVV+DNGS  +K G +    P C   N I   KY+   L+N                   
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 54  XXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGK 113
                 P   G + +W+    +W +   +  + N F+        L+ +E  +   +   
Sbjct: 70  LLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFD-----EHPLLITEAPLNPEKNRD 124

Query: 114 NMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPST----EEYRDF 169
            M +V FE+++F ++                            ++  PST       R  
Sbjct: 125 KMCEVFFEKFDFAAV----------------------------YIANPSTLSLYASGRTT 156

Query: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD-----ET 224
             V+D G      +P+ +G     +++++D+GGR +   L+     R Y  +      E 
Sbjct: 157 GCVLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQ--FQIRKYTGISLYSSSEH 214

Query: 225 ILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQ 284
            +V N+KEK  +VS     D   ++D+++               + P   + +    D +
Sbjct: 215 EIVKNVKEKACYVST----DFAHDEDMSN---------------LNPEKIRCQFKLPDGK 255

Query: 285 SITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNL 344
            + L    F  PE  F P+I  +    + +   ES+S +   +RP + S+I+  GG+   
Sbjct: 256 DLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNGGSTMF 315

Query: 345 PHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEH 404
             F  R+ KELQ +       +I I+    + + W   S       +K   +T+ E+ E 
Sbjct: 316 RGFGDRLLKELQIRTGNKNLIKI-IAPPERKYTSWIGGSILTGLSTFKQLWMTKAEWQE- 373

Query: 405 GIDWCTKHRF 414
             D   ++RF
Sbjct: 374 --DNNLRYRF 381

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 92/382 (24%), Positives = 148/382 (38%), Gaps = 76/382 (19%)

Query: 4   TPVVIDNGSYRVKFGPASLEAPYCALNAIANDKY----DASYLSNQXXXXXXXXXXXXXR 59
           +P+V+D G+  VK G A    P     +I         +   +S               R
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEASDVR 64

Query: 60  -------PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112
                  P   G + +W+    +WDY  YN  +F       T    ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFP-----STSGGKILLTEPPMNPLKNR 119

Query: 113 KNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDF 169
           + M +V+FE+Y+FG +   +++ +A Y   L +                           
Sbjct: 120 ELMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILV 227
            +VVDSG   T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 154 -VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 212

Query: 228 NNIKEKCLFVSPASYFDSFKNKDIT--SREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285
             IKEK  +VS     D+   ++ T     Y LP                      D + 
Sbjct: 213 RQIKEKLSYVSYDLNLDTKLARETTVLVENYELP----------------------DGRV 250

Query: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345
           I +  E F  PE  F P++  + +PG+ E +  ++      IR  +   I+  GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSMYP 310

Query: 346 HFASRVAKELQRQLPTDWKCRI 367
              SR+ KEL +QL   W  RI
Sbjct: 311 GLPSRLEKEL-KQL---WYTRI 328

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 125/305 (40%), Gaps = 61/305 (20%)

Query: 60  PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVI 119
           P   G + +W    L+WDY       F    +  T +  ++ +E  M   +  + M +V+
Sbjct: 72  PMENGIIKNWTDMELLWDYAF-----FEQMKLQSTSNGKILLTEPPMNPLKNREKMCEVM 126

Query: 120 FEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSG 176
           FE+Y+FG +   +++ +A Y   L +                            +VVDSG
Sbjct: 127 FEKYDFGGVYVAIQAVLALYAQGLSSG---------------------------VVVDSG 159

Query: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKEKC 234
              T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKEK 
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 235 LFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDEL 292
            +VS     D+   ++ T+    Y LPD +T                      I +  E 
Sbjct: 220 CYVSYDLDLDTKLARETTTLVESYELPDGRT----------------------IKVGQER 257

Query: 293 FAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVA 352
           F  PE  F P +  + +PG+ E +  ++      IR  +   I+  GG+   P   SR+ 
Sbjct: 258 FEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLE 317

Query: 353 KELQR 357
           KEL++
Sbjct: 318 KELKQ 322

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 85/372 (22%), Positives = 142/372 (38%), Gaps = 72/372 (19%)

Query: 4   TPVVIDNGSYRVKFGPASLEAPYCALNAIANDKY----DASYLSNQXXXXXXXXXXXXXR 59
           TP+V+D G+  VK G A    P     +I         + + ++               R
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVR 64

Query: 60  -------PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112
                  P   G + +W    L+WDY  Y         +  T    ++ +E  M      
Sbjct: 65  SYLQISYPMENGIIKNWADMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNPLRNR 119

Query: 113 KNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDF 169
           + M +V+FE+Y+FG +   +++ +A Y   L +                           
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILV 227
            +VVDSG   T I+PV + +      K+LD+ GR +   L + LS R Y  N   +   V
Sbjct: 154 -VVVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 212

Query: 228 NNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285
             IKEK  +VS     D+   ++ T+    Y LP                      D + 
Sbjct: 213 RQIKEKLCYVSYDLDLDTKLARETTTLVENYELP----------------------DGRV 250

Query: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345
           I +  E F  PE  F P +  + +PG+ E +  ++      +R  +   ++  GG+   P
Sbjct: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYP 310

Query: 346 HFASRVAKELQR 357
              SR+ KEL++
Sbjct: 311 GLPSRLEKELKQ 322

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 125/305 (40%), Gaps = 61/305 (20%)

Query: 60  PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVI 119
           P   G + +W    L+WDY       F    +  T +  ++ +E  M   +  + M +V+
Sbjct: 72  PMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126

Query: 120 FEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSG 176
           FE+Y+FG +   +++ +A Y   L +                            +VVDSG
Sbjct: 127 FEKYDFGGVYVAIQAVLALYAQGLSSG---------------------------VVVDSG 159

Query: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKEKC 234
              T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKEK 
Sbjct: 160 DGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 235 LFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDEL 292
            +VS     D+   ++ T+    Y LPD +T                      I +  E 
Sbjct: 220 CYVSYDLDLDTKLARETTALVESYELPDGRT----------------------IKVGQER 257

Query: 293 FAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVA 352
           F  PE  F P +  + +PG+ E +  ++      IR  +   I+  GG+   P   SR+ 
Sbjct: 258 FEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLE 317

Query: 353 KELQR 357
           KEL++
Sbjct: 318 KELKQ 322

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 125/305 (40%), Gaps = 61/305 (20%)

Query: 60  PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVI 119
           P   G + +W    L+WDY       F    +  T +  ++ +E  M   +  + M +V+
Sbjct: 72  PMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126

Query: 120 FEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSG 176
           FE+Y+FG +   +++ +A Y   L +                            +VVDSG
Sbjct: 127 FEKYDFGGVYVAIQAVLALYAQGLSSG---------------------------VVVDSG 159

Query: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKEKC 234
              T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKEK 
Sbjct: 160 DGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 235 LFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDEL 292
            +VS     D+   ++ T+    Y LPD +T                      I +  E 
Sbjct: 220 CYVSYDLDLDTKLARETTALVESYELPDGRT----------------------IKVGQER 257

Query: 293 FAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVA 352
           F  PE  F P +  + +PG+ E +  ++      IR  +   I+  GG+   P   SR+ 
Sbjct: 258 FEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLE 317

Query: 353 KELQR 357
           KEL++
Sbjct: 318 KELKQ 322

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 87/372 (23%), Positives = 141/372 (37%), Gaps = 72/372 (19%)

Query: 4   TPVVIDNGSYRVKFGPASLEAPYCALNAIANDKY----DASYLSNQXXXXXXXXXXXXXR 59
           TP+V+D G+  VK G A    P     +I         +  + S               R
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR 64

Query: 60  -------PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112
                  P   G + +W    L+WDY       F    +  T    ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIRNWADMELLWDYAF-----FEQMKLPTTSGGKVLLTEPPMNPIKNR 119

Query: 113 KNMDQVIFEEYEFGS---LMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDF 169
           + M +V+FE+Y+FG     +++ +A Y   L +                           
Sbjct: 120 EQMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILV 227
            +VVDSG   T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 154 -VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETV 212

Query: 228 NNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285
             IKEK  +VS     D+   ++ T+    Y LP                      D + 
Sbjct: 213 RQIKEKLCYVSYDLDLDTKLARETTTLVESYELP----------------------DGRV 250

Query: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345
           I +  E F  PE  F P +  + +PG+ E +  ++      IR  +   I+  GG+   P
Sbjct: 251 IKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYP 310

Query: 346 HFASRVAKELQR 357
              SR+ KEL++
Sbjct: 311 GLPSRLEKELKQ 322

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 84/373 (22%), Positives = 140/373 (37%), Gaps = 72/373 (19%)

Query: 3   ETPVVIDNGSYRVKFG-----------PASLEAPYCALNAIANDKYDASYLSNQXXXXXX 51
           + P+V+D G+  VK G           P+ +  P    +  AN       +         
Sbjct: 4   QKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQV 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                   P   G +  W    L+WDY  Y         +  T    ++ +E  M     
Sbjct: 64  RSYLQISYPMENGIIRDWADMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNPLRN 118

Query: 112 GKNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRD 168
            + M +V+FE+Y+FG +   +++ +A Y   L +                          
Sbjct: 119 REQMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSG------------------------- 153

Query: 169 FQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETIL 226
             +VVDSG   T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   
Sbjct: 154 --VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTADFET 211

Query: 227 VNNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQ 284
           V  IKEK  +VS     D+   ++ T+   +Y LP                      D +
Sbjct: 212 VRQIKEKLCYVSYDLDLDTRLAQETTTLVEQYELP----------------------DGR 249

Query: 285 SITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNL 344
            I +  E F  PE  F P +  + +PG+ E +  ++      I   +   I+  GG+   
Sbjct: 250 VIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSMY 309

Query: 345 PHFASRVAKELQR 357
           P   SR+ KEL++
Sbjct: 310 PGLPSRLEKELKQ 322

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 123/305 (40%), Gaps = 61/305 (20%)

Query: 60  PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVI 119
           P   G + +W    L+WDY  Y         + DT +  ++ +E  M   +  + M +V+
Sbjct: 18  PMENGIIKNWTDMELLWDYAFYEQ-----MKLPDTSNGKILLTEPPMNPIKNREKMCEVM 72

Query: 120 FEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSG 176
           FE+Y FG +   +++ +A Y   L +                            +VVDSG
Sbjct: 73  FEKYNFGGVYVAIQAVLALYAQGLSSG---------------------------VVVDSG 105

Query: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKEKC 234
              T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKEK 
Sbjct: 106 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQIKEKL 165

Query: 235 LFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDEL 292
            +VS     D+   ++ T+    Y LP                      D + I +  E 
Sbjct: 166 CYVSYDLDLDTKLARETTTLVESYELP----------------------DGRVIKVGSER 203

Query: 293 FAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVA 352
           F  PE  F P +  + + G+ E +  ++      IR  +   I+  GG+   P   SR+ 
Sbjct: 204 FEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSGGSSMYPGLPSRLE 263

Query: 353 KELQR 357
           KEL++
Sbjct: 264 KELKQ 268

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 124/305 (40%), Gaps = 61/305 (20%)

Query: 60  PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVI 119
           P   G + +W    L+WDY       F    +  T +  ++ +E  M   +  + M +V+
Sbjct: 72  PMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126

Query: 120 FEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSG 176
           FE+Y+FG +   +++ +A Y   L +                            +VVDSG
Sbjct: 127 FEKYDFGGVYVAIQAVLALYAQGLSSG---------------------------VVVDSG 159

Query: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKEKC 234
              T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKEK 
Sbjct: 160 DGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 235 LFVSPASYFDSFKNKDIT--SREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDEL 292
            +VS     D+   ++ T     Y LPD +T                      I +  E 
Sbjct: 220 CYVSYDLDLDTKLARETTVLVESYELPDGRT----------------------IKVGQER 257

Query: 293 FAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVA 352
           F  PE  F P +  + +PG+ E +  ++      IR  +   I+  GG+   P   SR+ 
Sbjct: 258 FEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMYPGLPSRLE 317

Query: 353 KELQR 357
           KEL++
Sbjct: 318 KELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/374 (22%), Positives = 144/374 (38%), Gaps = 74/374 (19%)

Query: 4   TPVVIDNGSYRVKFGPASLEAPYCALNAIANDKY----DASYLSNQX---------XXXX 50
           +P+V+D G+  VK G A    P     +I         + S++ ++              
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASD 64

Query: 51  XXXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPE 110
                    P   G +  W    L+WD+       F    +  T    ++ +E  M   +
Sbjct: 65  VRSYLQISYPMENGIIKHWTDMELLWDHAF-----FEKMKLPSTSGGKILLTEPPMNPLK 119

Query: 111 LGKNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYR 167
             + M QV+FE+Y+FG +   +++ +A Y   L +                         
Sbjct: 120 NREMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------------ 155

Query: 168 DFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETI 225
              +VVDSG   T I+PV + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 156 ---VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFE 212

Query: 226 LVNNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDS 283
            V  IKEK  +VS    FD+   ++ T+    Y LP                      D 
Sbjct: 213 TVRQIKEKLSYVSYDLDFDTKLARETTTLVENYELP----------------------DG 250

Query: 284 QSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFN 343
           + I +  E F  PE  F P +  + +PG+ E +  ++      IR  +   I+  GG+  
Sbjct: 251 RIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSSM 310

Query: 344 LPHFASRVAKELQR 357
            P   SR+ KEL++
Sbjct: 311 YPGLPSRLEKELKQ 324

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 123/305 (40%), Gaps = 61/305 (20%)

Query: 60  PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVI 119
           P   G + +W    L+WDY       FN   +  T    ++ +E  M   +  + M +V+
Sbjct: 72  PMENGIIKNWTDMELLWDYAF-----FNQMQLPTTSGGKILLTEPPMNPVKNREQMCEVM 126

Query: 120 FEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSG 176
           FE+Y+FG +   +++ +A Y   L +                            +VVDSG
Sbjct: 127 FEKYDFGGVYVAIQAVLALYAQGLSSG---------------------------VVVDSG 159

Query: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKEKC 234
              T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKEK 
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 219

Query: 235 LFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDEL 292
            +VS     D+   ++ T+    Y LP                      D + I +  E 
Sbjct: 220 CYVSYDLDLDTKLARETTTLVENYELP----------------------DGRIIKVGQER 257

Query: 293 FAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVA 352
           F  PE  F P +  + + G+ E +  ++      +R  +   I+  GG+   P   SR+ 
Sbjct: 258 FEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSRLE 317

Query: 353 KELQR 357
           KEL++
Sbjct: 318 KELKQ 322

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 124/305 (40%), Gaps = 61/305 (20%)

Query: 60  PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVI 119
           P   G + +W    L+WDY       F+   +  T +  ++ +E  M   +  + M +V+
Sbjct: 72  PMENGIIKNWTDMELLWDYAF-----FDQMKLPTTSNGKILLTEPPMNPVKNREQMCEVM 126

Query: 120 FEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSG 176
           FE+Y+FG +   +++ +A Y   L +                            +VVDSG
Sbjct: 127 FEKYDFGGVYVAIQAVLALYAQGLSSG---------------------------VVVDSG 159

Query: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKEKC 234
              T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKEK 
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKV 219

Query: 235 LFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDEL 292
            +VS     D+   ++ T+    Y LP                      D + I +  E 
Sbjct: 220 CYVSYDLDLDTKLARETTTLVENYELP----------------------DGRVIKVGQER 257

Query: 293 FAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVA 352
           F  PE  F P +  + + G+ E +  ++      IR  +   I+  GG+   P   SR+ 
Sbjct: 258 FEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPGLPSRLE 317

Query: 353 KELQR 357
           KEL++
Sbjct: 318 KELKQ 322

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 92/396 (23%), Positives = 153/396 (38%), Gaps = 77/396 (19%)

Query: 4   TPVVIDNGSYRVKFGPASLEAPYCALNAIANDKY----DASYLSNQXXXXXXXXXXXXXR 59
           +P+V+D G+  VK G A    P     +I         + + +S               R
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEASEVR 64

Query: 60  -------PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112
                  P   G + +W    L+WDY  Y         +  T    ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPMNPLKNR 119

Query: 113 KNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDF 169
           + M +V+FE+Y+FG +   +++ +A Y   L +                           
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILV 227
            +VVDSG   T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 154 -VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETV 212

Query: 228 NNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285
             IKEK  +VS     D+   ++ T+   +Y LP                      D + 
Sbjct: 213 RQIKEKLCYVSYDLDLDTRLARETTTLVEKYELP----------------------DGRI 250

Query: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345
           I +  E F  PE  F P +  +   G+ E +  ++      +R  +   I+  GG+   P
Sbjct: 251 IKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYP 310

Query: 346 HFASRVAKELQRQLPTDWKCRITISKGNSELSGWKA 381
              SR+ KEL +QL   W  R+ ++K  S L  +K 
Sbjct: 311 GLPSRLEKEL-KQL---WFTRV-LNKDPSRLDKFKV 341

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 94/414 (22%), Positives = 156/414 (37%), Gaps = 66/414 (15%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYCA-LNAIANDKYDA---------SYLSNQXXXXXXXXX 54
           PVVIDNGS  VK G    E P C   + I +  Y+          S++ N+         
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGLLK 70

Query: 55  XXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKN 114
                P   G ++ W+   L+W + L     F+   +       L+ +E  +      + 
Sbjct: 71  LK--HPMERGVVSDWDDMELLWSHIL-----FDSLQLTSGMEHPLLITEAPLNPESNKEK 123

Query: 115 MDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVD 174
           M +V FE +   ++  S + G +    +                        R    VVD
Sbjct: 124 MLEVFFETFNIPAICVS-IPGVLSLYASG-----------------------RTTGCVVD 159

Query: 175 SGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNV----MDETILVNNI 230
            G      +PV +G     ++K++++GG  +   L+  L  +   V      E  LV  +
Sbjct: 160 CGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLR-KESGVWLFSSGERELVRTM 218

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           KEK  +VS     +  K+++  + E       T+F             LP D   +TL  
Sbjct: 219 KEKSCYVS----LNQLKDEEKFTFEP--GKMNTNF------------KLP-DGNMLTLSK 259

Query: 291 ELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASR 350
             F  PE  F P+I    +P L E  L+S+  +   +RP ++S I   GG      F  R
Sbjct: 260 SRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTTMFRGFGDR 319

Query: 351 VAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEH 404
             +ELQ         RI ++    + + W   S  A    ++    T+ ++ EH
Sbjct: 320 FLQELQISTCKKSNIRI-LAPPERKYTAWIGGSMLAGLTTFRKMLTTKSDWREH 372

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 76/154 (49%), Gaps = 19/154 (12%)

Query: 278 PLPEDSQSITLKDEL------FAVPETFFHPEISQILKPGLVE---TILESLSMIPEVIR 328
           P P DS++I  + ++        VPE  F P I  + + G+VE   T+L  L       R
Sbjct: 595 PRPHDSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVELCETVL--LKKFDSSRR 652

Query: 329 PL------MVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAM 382
            L      M  N+   GGN  LP    R+ +E    LP   + ++T++K  S LS WK M
Sbjct: 653 ALSATCEKMAKNVFITGGNTKLPGIRERIVREFTGFLPVGTELKVTLAKDPS-LSAWKGM 711

Query: 383 SSFASTDI-YKATRVTREEYYEHGIDWCTKHRFG 415
           + FAS    YK++ +T+ EY E+G ++  +H  G
Sbjct: 712 AKFASDPTSYKSSILTKREYEEYGPEYIKEHNLG 745

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 71/152 (46%), Gaps = 15/152 (9%)

Query: 278 PLPEDSQSIT------LKDELFAVPETFFHPEISQILKPGLVE----TILESLSMIP--- 324
           P P DS+ +       L  E   VPE  F P I+   + G+ E     +L+     P   
Sbjct: 594 PRPHDSEDVHQQHQLHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNL 653

Query: 325 EVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSS 384
                 MV+N+   GGN  +P   +R+ KE    LP      + +S+  S L  WK M+ 
Sbjct: 654 SAASSRMVNNVWITGGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSEDPS-LDAWKGMAK 712

Query: 385 FASTDI-YKATRVTREEYYEHGIDWCTKHRFG 415
            A+ +  YK T VTR+EY E+G D+  +H+ G
Sbjct: 713 LANNETDYKNTAVTRKEYEEYGPDYIKEHKLG 744

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 101/423 (23%), Positives = 170/423 (40%), Gaps = 64/423 (15%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKYD---ASYLSN--QXXXXXXXXXXXXX 58
           PVV+DNGS  +K G +  E P C   + I   KYD   A  LS+  Q             
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 59  R---PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNM 115
           R   P   G +  W     +W +  Y+  + N  NIGD     ++ +E  +   E    M
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLN--NIGD---HPMLVTEAPLNPLENRDKM 125

Query: 116 DQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDS 175
            ++++E +   ++  S  A    +          G R T                 V+D 
Sbjct: 126 CEMLYETFNVPAVYVSIQAVLALY---------AGGRTT---------------GCVIDC 161

Query: 176 GFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNNIK 231
           G  C   +PV  G     A++++D+ GR    FL  LL++++     +  +  I V  IK
Sbjct: 162 GDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREI-VRMIK 220

Query: 232 EKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDE 291
           EK  +V+P          ++ + E     + +S     R S E  K    D + ++L  E
Sbjct: 221 EKACYVAP----------EVAAEEQ---KYASS-----RGSEELTKFKLPDGKILSLGAE 262

Query: 292 LFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRV 351
            F  PE  F P++       + +   +S+S +   +R  + S+++  GG+     F  R+
Sbjct: 263 KFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLFAGFGDRL 322

Query: 352 AKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTK 411
             EL+ +   + K +I  +    + S W   S  A    ++   VTR E+ E+    C  
Sbjct: 323 LNELRSRCEPNVKIKI-FAPPERKYSVWIGGSILAGLSTFEKIWVTRSEWQEN--PQCVH 379

Query: 412 HRF 414
            RF
Sbjct: 380 SRF 382

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 91/416 (21%), Positives = 161/416 (38%), Gaps = 70/416 (16%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKYDASYLSNQ---------XXXXXXXXX 54
           P+VIDNGS  +K G +  + P     N     KYD   ++ Q                  
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 55  XXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKN 114
                P   G + +W+   L+W + ++N    +  N+ + +   L+ +E  +T+ +    
Sbjct: 71  LRLQHPMNRGVVDNWDDMELLW-WHIFN----DTLNVQNIEEHPLLITEAPLTIEKQRHI 125

Query: 115 MDQVIFEEYEFGSL-MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVV 173
           M + +FE +   SL + +P    +    NT                            VV
Sbjct: 126 MCERLFETFNIPSLYVANPSVLSLYASGNTTG-------------------------CVV 160

Query: 174 DSGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNN 229
           D G       P+ +G     +++K+++GGR     L   ++++     Y+  +E  +V  
Sbjct: 161 DCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYSS-NEKEIVRT 219

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKP--LPEDSQSIT 287
           IKEK  ++S                     DF  S   Y    +E      LP D + +T
Sbjct: 220 IKEKVCYISE--------------------DFNKSEESYYLRQDEMSCKFKLP-DGKELT 258

Query: 288 LKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHF 347
           L  E F  PE  F+P++  +    +     ES+S +   +RP + SNI+  GG+     F
Sbjct: 259 LNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTLFKGF 318

Query: 348 ASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYE 403
            SR+  +LQ       K +I ++    + + W   S       +K   VT+ ++ E
Sbjct: 319 GSRLLGDLQELTNNRAKIKI-LAPPERKYTSWIGGSILTGLSTFKNLWVTKSDWEE 373

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 66/129 (51%), Gaps = 9/129 (6%)

Query: 295 VPETFFHPEISQILKPGLVE----TILESLSMIPEVIR---PLMVSNIMCIGGNFNLPHF 347
           VPE  F P +    + G++E     +L+     P  +      M  N+   GG+  LP  
Sbjct: 622 VPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGL 681

Query: 348 ASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDI-YKATRVTREEYYEHGI 406
            +R+ KE    LP D K  + ISK  S L  WK M+ F+S D  +K++ ++++EY E+G 
Sbjct: 682 KTRIVKEFTSFLPNDAKFSVNISKHPS-LDAWKGMAKFSSDDADFKSSLISKKEYEEYGP 740

Query: 407 DWCTKHRFG 415
           ++  +HR G
Sbjct: 741 EYIKEHRLG 749

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 85/372 (22%), Positives = 139/372 (37%), Gaps = 72/372 (19%)

Query: 4   TPVVIDNGSYRVKFGPASLEAPYCALNAIANDKY----DASYLSNQXXXXXXXXXXXXXR 59
            P+V+D G+  VK G A    P     +I         + S +S               R
Sbjct: 5   VPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVR 64

Query: 60  -------PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112
                  P   G + +W     +WDY  Y+        I  T    ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWADMEQLWDYAFYDQ-----MKIPSTAGHKVLLTEPPMNPLKNR 119

Query: 113 KNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDF 169
           + M +V+FE+Y+FG +   +++ +A Y   L +                           
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILV 227
            +VVDSG   T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 154 -VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFETV 212

Query: 228 NNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285
             IKEK  +VS     D+    + T+    Y LP                      D + 
Sbjct: 213 RQIKEKLCYVSYDLDLDTKLAHETTTLVETYELP----------------------DGRV 250

Query: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345
           I +  E F  PE  F P +  + + G+ E +  ++      I   +   I+  GG+   P
Sbjct: 251 IKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYP 310

Query: 346 HFASRVAKELQR 357
              SR+ KEL++
Sbjct: 311 GLPSRLEKELKQ 322

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 98/425 (23%), Positives = 162/425 (38%), Gaps = 68/425 (16%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKY----------DASYLSNQXXXXXXXX 53
           PVV+DNGS  +K G +  E P C   + I   KY          D+  + N+        
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQLIGNEAQKMRGLL 70

Query: 54  XXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGK 113
                  H  G +  W     +W +  YN        + + +   ++ +E  +   +   
Sbjct: 71  KLHYPLEH--GVVQDWPGLEQLWTHVFYN-----SLKLANIEEHPMLITEAPLNPMKNRN 123

Query: 114 NMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVV 173
            M +++FE   FGS      A Y+         +  G R T                 V+
Sbjct: 124 KMCEMLFET--FGS-----PAVYVSI--QAVLALYAGGRTT---------------GCVI 159

Query: 174 DSGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNN 229
           D G  C   +PV  G     A++++D+ GR    FL  LL+++      +  +  I V  
Sbjct: 160 DCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREI-VRM 218

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLK 289
           IKEK  FV+           D+ + E        ++ G      E    LP D + +TL 
Sbjct: 219 IKEKACFVA----------TDVGNEE-------QNYEGANSAELETRFKLP-DGKILTLG 260

Query: 290 DELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFAS 349
            E F  PE  F P +       + E   +S+S +   +R  + S+I+  GG+     F  
Sbjct: 261 AEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSGFGD 320

Query: 350 RVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWC 409
           R+  E+++    + K +I  +    + S W   S  A    ++   VTR E+ E+    C
Sbjct: 321 RLLSEIRKTSEPNTKIKI-FAPPERKYSTWIGGSILAGLSTFEKLWVTRAEWQEN--PQC 377

Query: 410 TKHRF 414
              RF
Sbjct: 378 IHSRF 382

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 72/153 (47%), Gaps = 17/153 (11%)

Query: 278 PLPEDSQSIT------LKDELFAVPETFFHPEISQILKPGLVETILES--------LSMI 323
           P P DS+ I       L  E   VPE  F P +  + + G++E I E+            
Sbjct: 590 PRPHDSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGSSRSE 648

Query: 324 PEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMS 383
              I   + SN+   GGN  LP    RV +E +  LP   +  + ++  +  L  W+ M+
Sbjct: 649 LSSISRSLASNVFLTGGNMRLPGMRERVVREFRGLLPIGTELNVRMA-NDCALDAWRGMA 707

Query: 384 SFASTD-IYKATRVTREEYYEHGIDWCTKHRFG 415
             + TD +++ T VTR+EY+E+G D+  +H  G
Sbjct: 708 KLSRTDSLFRDTYVTRQEYHEYGPDYIKEHNLG 740

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETIL 226
           LV+ SG   T IIPV+ G       K+++ GGR    +L+ LL   L + ++ +   T  
Sbjct: 183 LVISSGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL--ALKYPYFPIKPSTHQ 240

Query: 227 VNNIKEKCLFVSP 239
              + ++  +VSP
Sbjct: 241 FKALYDEFCYVSP 253

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 71/312 (22%), Positives = 120/312 (38%), Gaps = 59/312 (18%)

Query: 60  PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVI 119
           P   G + +W    L+WDY  Y         +  T    ++ +E  +   +  + M +V+
Sbjct: 72  PMENGIIKNWTDMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPLNPLKNREKMCEVM 126

Query: 120 FEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNC 179
           FE+Y+FG +  +  A    + +     ++I                        DSG   
Sbjct: 127 FEKYDFGGVYVAIQAVLALYAQGLSSGVVI------------------------DSGDGV 162

Query: 180 TWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKEKCLFV 237
           T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKEK  +V
Sbjct: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222

Query: 238 SPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAV 295
           S     D+   ++ T+    Y LP                      D + I +  E F  
Sbjct: 223 SYDLELDTKLARETTTLVENYELP----------------------DGRVIKVGQERFEA 260

Query: 296 PETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKEL 355
            E  F P +  +   G+ E +  ++      +R  +   I+  GG+   P   SR+ KEL
Sbjct: 261 AECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKEL 320

Query: 356 QRQLPTDWKCRI 367
            +QL   W  R+
Sbjct: 321 -KQL---WYTRV 328

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 75/154 (48%), Gaps = 19/154 (12%)

Query: 278 PLPEDSQ------SITLKDELFAVPETFFHPEISQILKPGLVE---TIL-----ESLSMI 323
           P P DS+       + L  E   VPE  F P +  + + G++E   TI+      S   +
Sbjct: 591 PRPHDSEDAHEQHQMHLNVERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQL 650

Query: 324 PEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMS 383
             V +  M +N+   GGN  +P    R+ +E    LP   K  I ++  +  +  WK M+
Sbjct: 651 SSVSQE-MANNVFLTGGNVRVPGLRDRIVREFTEFLPVGTKYNIKVA-SDPAIDAWKGMA 708

Query: 384 SFA--STDIYKATRVTREEYYEHGIDWCTKHRFG 415
            FA  STD YK + VT++EY E+G D+  +H+ G
Sbjct: 709 KFAQSSTD-YKGSYVTKKEYEEYGPDYIKEHKLG 741

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 88/414 (21%), Positives = 154/414 (37%), Gaps = 69/414 (16%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYCALNAIA---------NDKYDASYLSNQXXXXXXXXXX 55
           PVV+DNGS  +K G +  + P    ++I          +   D +++ N           
Sbjct: 12  PVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGN--LAQERRSIL 69

Query: 56  XXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNM 115
               P   G + +W    LIWDY   +        + D     ++ +E  +        M
Sbjct: 70  QLRHPVDHGVVKNWNDMELIWDYMFKDK-----LKLKDVDEHPVLITEAPLNPVSNRDEM 124

Query: 116 DQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDS 175
             ++FE +   +L  +  A    +        ++   D                      
Sbjct: 125 CDLLFESFGVQALYVANPAVLSLYASGKISGCVLDCGD---------------------- 162

Query: 176 GFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETL---SFRHYNVMDETILVNNIKE 232
           G++C+  +PV +G     A+K++D+GGR L   L+  L   +        E  LV  IKE
Sbjct: 163 GYSCS--VPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIKE 220

Query: 233 KCLFVSPASYFDSFK---NKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLK 289
           K  +V+     +  K     D    ++ LP                      D + ITL 
Sbjct: 221 KSCYVAVDLDIEEEKCNYEGDQVGLKFKLP----------------------DGKFITLS 258

Query: 290 DELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFAS 349
            + F VPE  F P +       + E I +S+S +   +RP M S+I+  GG   L  F +
Sbjct: 259 KDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFGN 318

Query: 350 RVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYE 403
           R+ +EL +      + +I  +    + + W   S  A    ++   VT+ ++ E
Sbjct: 319 RLVQELDKLNQAQSRVKIW-APPERKYTSWIGGSILAELSTFQKIIVTKSQWQE 371

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 69/152 (45%), Gaps = 15/152 (9%)

Query: 278 PLPEDSQSIT------LKDELFAVPETFFHPEISQILKPG---LVETIL----ESLSMIP 324
           P P DS++I       L  E   VPE  F P +    + G   L ETIL     S     
Sbjct: 598 PRPHDSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRGKL 657

Query: 325 EVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSS 384
                 MV+NI+  GGN  +P    R+ KE    LP      + IS  N  L  W+ M++
Sbjct: 658 SSTSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNIS-SNPSLDAWRGMAA 716

Query: 385 FASTDI-YKATRVTREEYYEHGIDWCTKHRFG 415
            A     YK T +++EEY E+G D+  +H+ G
Sbjct: 717 LARNKAEYKKTVISKEEYEEYGPDYIKEHKLG 748

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 72/156 (46%), Gaps = 15/156 (9%)

Query: 278 PLPEDSQS------ITLKDELFAVPETFFHPEISQILKPGLVE----TILESLSMIPEVI 327
           P P DS++      + L  E   VPE FF P +    + G+ E     +L      P  +
Sbjct: 593 PRPHDSENSHEQHQMHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQM 652

Query: 328 RPL---MVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSS 384
             +   M  N+   GGN  +P    R+ KE    LP +    + IS   S L  W+ M+ 
Sbjct: 653 SSITSEMAKNVWVTGGNAKIPGLRERIVKEFTGFLPVNTSFNVNISSDPS-LDAWRGMAK 711

Query: 385 FASTDI-YKATRVTREEYYEHGIDWCTKHRFGYQNW 419
           +A  +  YK + ++++EY E+G D+  +H+ G  N+
Sbjct: 712 YAQNETDYKKSFISKKEYEEYGPDYIKEHKLGNMNY 747

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 15/151 (9%)

Query: 278 PLPEDSQSITLKDEL------FAVPETFFHPEISQILKPGLVET----ILESLSMIPEVI 327
           P P DS++I  + ++        VPE  F P +    + G+ E     I +     P  +
Sbjct: 598 PRPHDSENIHEQHQMHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNL 657

Query: 328 RPL---MVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSS 384
                 M  N+  +GGN  +P   SRV KE    LP+D K  + IS+  + L  W  M  
Sbjct: 658 SQQSLDMAKNVWLVGGNAQVPGLKSRVVKEFTEFLPSDTKINVNISEAPT-LDVWNGMYR 716

Query: 385 FAST-DIYKATRVTREEYYEHGIDWCTKHRF 414
            A+T + Y+ T VT EEY E G+D+  +H+ 
Sbjct: 717 LANTEEDYQRTIVTSEEYDECGVDYLKEHKL 747

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 71/159 (44%), Gaps = 12/159 (7%)

Query: 265 FLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFFHPEISQILKPGLVET----ILESL 320
           FL   RP + +    P     I +  E   VPE  F P I    + G+ E      L   
Sbjct: 599 FLRGPRPHDSED---PHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKF 655

Query: 321 SMIPEVIRPL---MVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELS 377
           +  P  +  +   M++N+   GG+  LP    R+ KE    LP   K  I IS   S L 
Sbjct: 656 NSSPRKLSSISERMLNNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINISNDPS-LD 714

Query: 378 GWKAMSSFAS-TDIYKATRVTREEYYEHGIDWCTKHRFG 415
            WK M+  AS TD  K  +VT+++Y E+G ++  +H  G
Sbjct: 715 TWKGMAKLASNTDYLKKIQVTKKDYEEYGPEYMMEHNLG 753

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 99/255 (38%), Gaps = 35/255 (13%)

Query: 3   ETPVVIDNGSYRVKFGPASLEAP-YCALNAIAN--DKYDASYLS--NQXXXXXXXXXXXX 57
           + P+ ID GSY VK G  +   P +   N +    D+  A  ++                
Sbjct: 36  DIPIAIDFGSYNVKAGYTNQSLPTHVFTNKLTRYRDRKLAKTMTFIGNDTNLDQPLRIQA 95

Query: 58  XRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQ 117
            RP+    + +WE    I+DY L++           + S  +I +E    L     N  Q
Sbjct: 96  KRPYDGLFIANWEYAEEIFDYTLHH---LGVQTTNGSISNPIILTEKMACLQSQRANWYQ 152

Query: 118 VIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGF 177
           ++FE ++  S      + Y  F  N  +          PF             LV++ G 
Sbjct: 153 LLFETFDVPSATFGLDSLYA-FYNNCAN----------PFESDG---------LVINCGH 192

Query: 178 NCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNNIKEK 233
             T I+P+++G       K+++ GGR    +L+ LL  TL + ++           + E 
Sbjct: 193 EDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLL--TLKYPYFPTKLSEFQYQTMYED 250

Query: 234 CLFVSPASYFDSFKN 248
             +VSP +Y +  KN
Sbjct: 251 FCYVSP-NYNEDIKN 264

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 75/158 (47%), Gaps = 17/158 (10%)

Query: 278 PLPEDSQSIT------LKDELFAVPETFFHPEISQILKPGLVETILESLSMIP------- 324
           P   DS+SI       L  E   VPE  F P I  + + G+VE + E+L +         
Sbjct: 590 PRSHDSESIHEQHQMHLNVERIRVPEVIFQPSIGGLDQAGIVE-LCETLLLKKFGSNRRE 648

Query: 325 -EVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMS 383
              I  +M  NI   GGN  LP    RV +E    LP      + +++  S +S W+ M+
Sbjct: 649 LSEISKMMAKNIFITGGNAKLPGIRERVVREFTGFLPVGTNLNVKLAEDPS-MSAWRGMA 707

Query: 384 SFA-STDIYKATRVTREEYYEHGIDWCTKHRFGYQNWV 420
            FA +T +Y+ + +T++EY E G ++  +H  G   +V
Sbjct: 708 KFANNTSLYETSIMTKKEYEELGPEYIKEHNLGNAKFV 745

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 90/415 (21%), Positives = 162/415 (39%), Gaps = 66/415 (15%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYCALNAIAND-KY---------DASYLSNQXXXXXXXXX 54
           PVV+DNGS  +K G +  E P      +A   +Y         D +++ N+         
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLRGLLA 72

Query: 55  XXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFN--IGDTKSKHLITSETCMTLPELG 112
                P + G++T+W+   L+W +  Y+  +    N  IGD     L+ +E  +   +  
Sbjct: 73  LRR--PISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGD---HPLLITEAPLNSTKNR 127

Query: 113 KNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLV 172
           + M ++++E + F                   D + +          T  T        V
Sbjct: 128 ETMCEILYETFNF-------------------DALYVAHPAVLSLYATGQTT-----GCV 163

Query: 173 VDSGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVN 228
           ++ G   +   PV +G     +++++DIGGR     L   ++++     ++  ++ I V 
Sbjct: 164 LECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEI-VR 222

Query: 229 NIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITL 288
            IKEK  +V+    F+  K                 F  + R +    K LP D Q +T 
Sbjct: 223 TIKEKANYVALDYKFEEEK-----------------FFIHERENTSTVK-LP-DGQELTF 263

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
               +   E  F P++       + E +LES++ +   +R  ++ NI+  GG   L  F 
Sbjct: 264 GKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLENIVLSGGTTMLKGFD 323

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYE 403
            R   E ++ LP   K +I  S        W   S  +    ++   +TRE Y E
Sbjct: 324 QRTMSETKKMLPKHTKVKIR-SLAERSYIAWIGGSILSGLYGFRNLWLTREMYEE 377

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 88/192 (45%), Gaps = 23/192 (11%)

Query: 243 FD-SFKNKDITSREYVLPDFQTS----FLGYVRPSNEQGKPLPEDSQSITLKDELFAVPE 297
           FD SF  +D    +Y   D++ S    FL   RP N  G+ + +  Q + L  E    PE
Sbjct: 564 FDPSFTEEDTLDAQY---DWRNSVLHLFLRGPRPHN--GEDVHQQHQ-LHLNIERIRAPE 617

Query: 298 TFFHPEISQILKPGLVET---ILE------SLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
             F P +  + + G+ E    IL       S  +  + +   M SNI   GGN  +P+  
Sbjct: 618 VIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLD--MASNIFITGGNTKIPNLR 675

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDW 408
            R+  E    LP +    +  ++ N  L  WK M+ FA +D Y +T VT+ EY E G ++
Sbjct: 676 ERIVNEFTGFLPVNTPLNVNYAQ-NVSLDAWKGMAKFARSDTYSSTCVTKVEYEEFGPNY 734

Query: 409 CTKHRFGYQNWV 420
             +H+ G   +V
Sbjct: 735 IKEHKLGNVRFV 746

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 99/278 (35%), Gaps = 71/278 (25%)

Query: 4   TPVVIDNGSYRVKFGPASLEAP----------------YCALNAIAND-KYDASYLSNQX 46
           TP+ +D GSY V+ G  S + P                  AL  I ND   D +  S+  
Sbjct: 40  TPIALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGNDCSLDNAVRSHSR 99

Query: 47  XXXXXXXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCM 106
                        P+    +T+WE    +  Y  ++     G    D  S  +I +E   
Sbjct: 100 S------------PYDGSLITNWEYMEDMLSYTFHHL----GVQPNDGISNPMILTEKMA 143

Query: 107 TLPELGKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEY 166
           T+     N  Q++FE Y    +    + G   F  N                 +P +   
Sbjct: 144 TVQAQRSNWYQLLFECYGIPQVTFG-IDGLFSFYANN----------------SPDST-- 184

Query: 167 RDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFR---------- 216
               L+++SG   T IIPVIKG       K++D GG      LK  LS +          
Sbjct: 185 ---GLIINSGHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKYPYFPSKLTD 241

Query: 217 -HYNVM--DETILVNNIKEKCLFVSPASYFDSFKNKDI 251
            H+  M  +      N +E+   VS     D  +NKDI
Sbjct: 242 YHFQSMYQNHCYFAKNYEEE---VSDMFKLDVLENKDI 276

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 73/152 (48%), Gaps = 15/152 (9%)

Query: 278 PLPEDSQSIT------LKDELFAVPETFFHPEISQILKPGLVE----TILESLSMIPEVI 327
           P P DS++I       L  E   VPE  F P +    + G+ E     +L+     P  +
Sbjct: 598 PRPHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKL 657

Query: 328 RPL---MVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSS 384
                 MV+N++  GGN  +P    R+ KE    LPT     + +S   S L  WK M++
Sbjct: 658 SQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNMSSDPS-LDAWKGMAA 716

Query: 385 FA-STDIYKATRVTREEYYEHGIDWCTKHRFG 415
            A + + Y+ T ++++EY E+G ++  +H+ G
Sbjct: 717 LARNEEQYRKTVISKKEYEEYGPEYIKEHKLG 748

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 92/420 (21%), Positives = 158/420 (37%), Gaps = 80/420 (19%)

Query: 5   PVVIDNGSYRVKFGPASLEAP----YCALNAIANDKYDASYLSNQXXXXXXXXXXXXXR- 59
           PVVIDNGS  +K G +  E P    YC    + N KYD   L                R 
Sbjct: 14  PVVIDNGSGIIKAGFSGEERPKALEYC---LVGNTKYDKVMLEGLQGDTFIGNNAQKLRG 70

Query: 60  ------PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGK 113
                 P   G +  W+   LIW Y L    +    NIG+     L+ +E  M   +  +
Sbjct: 71  LLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQ--NIGE---HPLLITEAPMNPLKNRE 125

Query: 114 NMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPST----EEYRDF 169
            M QV+FE ++  +L                            +V  P+        R  
Sbjct: 126 QMAQVLFETFDVSAL----------------------------YVSNPAVLSLYASGRTT 157

Query: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGG----RFLNGLLKETLSFRHYNVMDETI 225
             VVD G      +P+  G     ++ ++DIGG      L   L+++     ++  +  I
Sbjct: 158 GCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREI 217

Query: 226 LVNNIKEKCLFVSPASYFDSFKNKDITSREYV--LPDFQTSFLGYVRPSNEQGKPLPEDS 283
            V  +KEK  +++        KN      +Y+    D  ++F             LP D 
Sbjct: 218 -VRTMKEKVCYLA--------KNIKKEEEKYLQGTQDLISTF------------KLP-DG 255

Query: 284 QSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFN 343
           + I + ++ +  PE  F P+I  +   GL +  ++S+  +   +R  ++S+I+  GG   
Sbjct: 256 RCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTT 315

Query: 344 LPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYE 403
           L  F  R+  +L+       K +I I+    + + W   S       ++     + ++ E
Sbjct: 316 LKGFGDRMLWDLEALTKGTSKIKI-IAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLE 374

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 278 PLPEDSQSIT------LKDELFAVPETFFHPEISQILKPGLVE----TILESLSMIPEVI 327
           P P DS  +       L  E   VPE  F P +    + G+ E     +L+     P  +
Sbjct: 594 PRPHDSDDVHEQHQMHLNIERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQL 653

Query: 328 RPL---MVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSS 384
                 M +NI   GGN  +P   +R+ KE    LP   K  + +S  +  L  WK M+ 
Sbjct: 654 SKTAEDMANNIWLSGGNAKVPGLKNRIVKEFTSFLPVGTKLSVNMS-SDPLLDSWKGMAK 712

Query: 385 FASTDIYKATRVTREEYYEHGIDWCTKHRFG 415
           +A ++ Y  + +T++EY E+G ++  +H+ G
Sbjct: 713 WAKSEDYNKSFITKKEYEEYGPEYIKEHKMG 743

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 70/152 (46%), Gaps = 15/152 (9%)

Query: 278 PLPEDSQSIT------LKDELFAVPETFFHPEISQILKPG---LVETIL-ESLSMIPEVI 327
           P P DS++I       L  E   VPE  F P +    + G   L ETIL +     P  +
Sbjct: 598 PRPHDSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKL 657

Query: 328 RPL---MVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSS 384
                 M +N+   GGN  +P    R+ KE    LP      I +S   S L  WK M++
Sbjct: 658 SQTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININMSSDPS-LDAWKGMAA 716

Query: 385 FASTDI-YKATRVTREEYYEHGIDWCTKHRFG 415
            A  +  YK T ++R+EY E+G D+  +H+ G
Sbjct: 717 LAQNEEEYKRTIISRKEYEEYGPDYIKEHKLG 748

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 78/332 (23%), Positives = 121/332 (36%), Gaps = 66/332 (19%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDA----------SYLSNQXXXXXX 51
           E   +VIDNGS   K G A  +AP     +I                 SY+ ++      
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRG 63

Query: 52  XXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPEL 111
                    H  G +T+W+    IW +  YN        +   +   L+T E  M     
Sbjct: 64  ILTLRYPIEH--GIVTNWDDMEKIWHHTFYNE-----LRVAPEEHPVLLT-EAPMNPKSN 115

Query: 112 GKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQL 171
            + M Q++FE +   +   S  A    +                           R   +
Sbjct: 116 REKMTQIMFETFNVPAFYVSIQAVLSLYSSG------------------------RTTGI 151

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYN--VMDETILVNN 229
           V+DSG   T ++P+  G      + ++D+ GR L   L + LS R Y+     E  +V +
Sbjct: 152 VLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRD 211

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSN-EQGKPLPEDSQSITL 288
           IKEK                      YV  DF+       + S+ E+   LP D Q IT+
Sbjct: 212 IKEKLC--------------------YVALDFEQEMQTAAQSSSIEKSYELP-DGQVITI 250

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESL 320
            +E F  PE  FHP +  +   G+ +T   S+
Sbjct: 251 GNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 71/152 (46%), Gaps = 15/152 (9%)

Query: 278 PLPEDSQSIT------LKDELFAVPETFFHPEISQILKPGLVE----TILESLSMIPEVI 327
           P P DS++I       L  E   VPE  F P +    + G+ E     +L+     P  +
Sbjct: 598 PRPHDSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKL 657

Query: 328 RPL---MVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSS 384
                 MV+N+   GGN  +P    R+ +E    LP      + +S   S L  WK M++
Sbjct: 658 SSTSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMSSDPS-LDAWKGMAA 716

Query: 385 FA-STDIYKATRVTREEYYEHGIDWCTKHRFG 415
            A + + YK T ++++EY E+G D+  +H+ G
Sbjct: 717 LAQNKEEYKKTVISKKEYEEYGPDYIKEHKLG 748

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 70/152 (46%), Gaps = 15/152 (9%)

Query: 278 PLPEDSQ------SITLKDELFAVPETFFHPEISQILKPGLVE----TILESLSMIPEVI 327
           P P DS+       I L  E   VPE  F P +  + + G+ E     +L      P+ +
Sbjct: 597 PRPHDSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHL 656

Query: 328 RPL---MVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSS 384
             L   M +NI   GGN  +P    R+ KE +  LP + +  + ++  +     W  M+ 
Sbjct: 657 SELSLTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNTQFNVNMT-SDPTFDAWNGMAK 715

Query: 385 FASTDI-YKATRVTREEYYEHGIDWCTKHRFG 415
            A  +  YK T ++++EY E+G ++  +H+ G
Sbjct: 716 LAQNETDYKKTIISKKEYEEYGPEYIKEHKLG 747

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 68/153 (44%), Gaps = 17/153 (11%)

Query: 278 PLPEDSQSIT------LKDELFAVPETFFHPEISQILKPGLVE--------TILESLSMI 323
           P P DS++I       L  E   VPE  F P ++ + + G+ E            + S +
Sbjct: 590 PRPHDSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQL 649

Query: 324 PEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMS 383
            E  + L  +N+   GGN  LP    R+ +E    LP      + ++  +S +  W+ M+
Sbjct: 650 SEGSKKL-AANVFLTGGNMRLPGVRERIVREFTGMLPMGSNLNVRMA-SDSAVDAWRGMA 707

Query: 384 SFAST-DIYKATRVTREEYYEHGIDWCTKHRFG 415
             +     YK + +TR+EY E G D+  +H  G
Sbjct: 708 KLSQAGSQYKGSYITRKEYQELGADYIKEHNLG 740

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 95/249 (38%), Gaps = 49/249 (19%)

Query: 5   PVVIDNGSYRVKFGPASLEAP-YCALNAIAN-----DKYDASYLSNQXXXXXXXXXXXXX 58
           P+ ID GS  V+ G  + + P +   N I+         + +++ N              
Sbjct: 38  PIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRSQAKS 97

Query: 59  RPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQV 118
            P+    +++W+    I +Y  ++     G N  D  S  ++ +E   TL    +N  Q+
Sbjct: 98  -PYDGAIVSNWDYTEEIMEYTFHHL----GVNGNDGVSNPILMTEKLATLQSQRENWYQL 152

Query: 119 IFE-----EYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVV 173
           +FE     +  FG      +     F  N  D    G                    LV+
Sbjct: 153 LFECFGVPQVTFG------IDSLFSFYANN-DATASG--------------------LVI 185

Query: 174 DSGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVNN 229
           +SG   T +IPV+ G       K+++ GGR    +L+ LL   L + ++ +   T    +
Sbjct: 186 NSGNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL--ALKYPYFPIKPSTHQFQS 243

Query: 230 IKEKCLFVS 238
           + E   +VS
Sbjct: 244 LYEDFCYVS 252

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 69/154 (44%), Gaps = 19/154 (12%)

Query: 278 PLPEDSQSITLKDEL------FAVPETFFHPEI---SQILKPGLVETILESLSMIPEVIR 328
           P P D +SI  + ++        VPE  F P +    Q   P L ET+L  L       R
Sbjct: 592 PRPHDGESIHHQHQMHMNIERIRVPEVLFQPNMGGEDQAGIPELCETLL--LRKFGSTQR 649

Query: 329 PL------MVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAM 382
            L      M  N+   GGN  LP    R+ KE    LP+     I  S+  S L  W+ M
Sbjct: 650 QLSDVSTSMAQNVWITGGNAKLPGLRERIVKEFSEFLPSGSPFSIRKSQDPS-LDAWRGM 708

Query: 383 SSFA-STDIYKATRVTREEYYEHGIDWCTKHRFG 415
           +  A +T+ +K   +T++EY E+G ++  +H  G
Sbjct: 709 AKLAQNTEDFKHGYITKQEYLEYGPEYIKEHNLG 742

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 97/418 (23%), Positives = 149/418 (35%), Gaps = 75/418 (17%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKYDASYLSNQXXXXXXXXXXXXX----- 58
           P+VIDNG+  +K G      P C   + +   KYD    SN                   
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGIL 73

Query: 59  ---RPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNM 115
               P   G + +W+    IW Y   +       N    +   LIT      +    K M
Sbjct: 74  KLRHPMLRGVVQNWDDMETIWQYVFDDTLYLENLN----EHPILITEPPLNNMANRQK-M 128

Query: 116 DQVIFEEYEFGS--LMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVV 173
            + +FE + F +  +  SPV       + T                             V
Sbjct: 129 CEALFEIFGFPAVYISVSPVLSLYASGQTTG--------------------------CAV 162

Query: 174 DSGFNCTWIIPVIKGIPYYKAVKKLDIGG-----RFLNGLLKETLSFRHYNVMDETILVN 228
           D G      IPV  G     +VKK+DIGG     +    +LK T  F + +   E  +V 
Sbjct: 163 DCGDGYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLFMYSS--SEREIVR 220

Query: 229 NIKEKCLFVSPASYFDSFK---NKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285
            IKEK  +++     ++ K   N++  + ++ LPD +   +        QGK        
Sbjct: 221 TIKEKVCYIATDYNLETEKYLFNEEKMASQFKLPDGKMLNI-------SQGK-------- 265

Query: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345
                  +   E  F PE+       L E   +S+  +   +R  + SNI+  GG    P
Sbjct: 266 -------YTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSGGTTMCP 318

Query: 346 HFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYE 403
            F SR+ KELQ     D K RI I+    + + W   S  +    +    VT+  + E
Sbjct: 319 GFGSRLLKELQTLTGYDTKIRI-IAPPERKYTSWIGGSILSGLSTFSKIWVTKSMWEE 375

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 87/409 (21%), Positives = 154/409 (37%), Gaps = 77/409 (18%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYCALNA-IANDKYDASYLSNQXXXXXXXXXXXXXR---- 59
           PV++DNGS  +K G A  + P     A I N   + S ++               R    
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERRATLH 71

Query: 60  ---PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMD 116
              P++   + SW+    +WDY L N  E     I   +   ++ + +  T  +  + M 
Sbjct: 72  LESPYSTNAIMSWDRLEDLWDYVLLNKLE-----IEQLQEHPVVLTNSMSTSKKEEEKMC 126

Query: 117 QVIFEEYEFGSLM--KSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVD 174
           +V+FE++   ++   + P+       R T   +  G R                      
Sbjct: 127 EVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCSVSCGHRGI-------------------- 166

Query: 175 SGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH---YNVMDETILVNNIK 231
                  I  VI G+    + +  + GG  +   + + L   H    N  +   L+ +IK
Sbjct: 167 ------GITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIK 220

Query: 232 EKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDE 291
           E+C  +S   Y +         R Y L   +TS   Y  P          D   I +  E
Sbjct: 221 ERCCVLSKDFYNEI--------RAYELITSKTSNNKYRLP----------DGNIIEIGSE 262

Query: 292 LFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRV 351
            F  PE  F+P+     +  L + I+ S+S    + R  ++ +I+  GG+  +  F  R+
Sbjct: 263 RFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKGFGERL 322

Query: 352 AKELQRQLPTDWKCRITISK--------GNSELSG-------WKAMSSF 385
            KE+++++  + K  +            G S LSG       WK+ S++
Sbjct: 323 TKEIRKEIDGNQKIMLNAPHERRFLPWIGGSVLSGLSTMKLLWKSKSAY 371

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 84/386 (21%), Positives = 144/386 (37%), Gaps = 81/386 (20%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKYDASYLSNQXXXXXXXXXXXXXR---- 59
           P+VIDNGS  +K G +  E P     + + + KY+   L                R    
Sbjct: 14  PIVIDNGSGIIKVGFSGEERPKALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGLLR 73

Query: 60  ---PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMD 116
              P T G +  W+   LIW Y L          + + +   L+ +E  M   +  + M 
Sbjct: 74  LRYPMTHGVVEDWDSMELIWSYMLNEV-----LQLQNIEEHPLLITEAPMNPLKNREVMA 128

Query: 117 QVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPST----EEYRDFQLV 172
           QV+FE +   +L                            ++  P+        R    V
Sbjct: 129 QVLFETFNLPAL----------------------------YISNPAVLSLYASGRTTGCV 160

Query: 173 VDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVM-------DETI 225
           VD G      +P+  G     ++ ++DIGGR +     E L F+             E  
Sbjct: 161 VDCGEGYCSTVPIYDGFALPASIMRMDIGGRDIT----EQLQFQLRKSAGISLFSSSELE 216

Query: 226 LVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGK--PLPEDS 283
           +V  IKEK  +++          K+I   E            Y++  ++ G    LP D 
Sbjct: 217 VVRMIKEKVCYLA----------KNIKKEEDR----------YLQGHHDLGSVFKLP-DG 255

Query: 284 QSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFN 343
           + I + ++ +  PE  F P+I      GL +  ++S+  +   +R  ++S+I+  GG   
Sbjct: 256 KCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTTT 315

Query: 344 LPHFASRVAKELQRQLPTDWKCRITI 369
           L  F  R+  +L+    +   C+I I
Sbjct: 316 LRGFGERMLHDLEAL--SKGTCKIKI 339

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 69/152 (45%), Gaps = 15/152 (9%)

Query: 278 PLPEDSQSITLKDEL------FAVPETFFHPEISQILKPG---LVETILES-LSMIPEVI 327
           P P DS++I  + +L        VPE  F P I    + G   L ETIL +     P  +
Sbjct: 595 PRPHDSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPREL 654

Query: 328 RPL---MVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSS 384
                 M  NI   GG+  LP    R+ KE    LP   K  + +SK N  L  W  M  
Sbjct: 655 SETSLGMAKNIWLTGGHSKLPGLRERIVKEFTGFLPVGTKLGVKMSK-NPSLDAWYGMRK 713

Query: 385 FASTDI-YKATRVTREEYYEHGIDWCTKHRFG 415
            A  +  YK + +++++Y E+G ++  +H+ G
Sbjct: 714 LAQNEADYKDSIISKKDYEEYGAEYIKEHKLG 745

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 86/416 (20%), Positives = 155/416 (37%), Gaps = 72/416 (17%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKYDASYLSNQXXXXXXXXXXXXXR---- 59
           P+VIDNGS  +K G +  E P     + + + KYD   L                R    
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGLLR 73

Query: 60  ---PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMD 116
              P   G +  W+   LIW Y L          + + +   L+ +E  M   +  + + 
Sbjct: 74  LRYPMKHGVVEDWDSMELIWSYVLNEV-----LQLQNIEEHPLLITEAPMNPLKNREMIA 128

Query: 117 QVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSG 176
           QV+FE +   ++  S  A    +                           R    VVD G
Sbjct: 129 QVMFETFNLSAIYVSDPAVLSLYASG------------------------RTTGCVVDCG 164

Query: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-------LVNN 229
                 +P+  G     ++ ++DIGG    G + E L F+       ++       +V  
Sbjct: 165 EGYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQIRKSAGVSLFSSSEREIVRT 220

Query: 230 IKEKCLFVSPASYFDSFKNKDITSREYV--LPDFQTSFLGYVRPSNEQGKPLPEDSQSIT 287
           IKEK  +++     D+ K +D    +Y+    D  ++F             LP D +SI 
Sbjct: 221 IKEKVCYLAK----DAKKEED----KYLQGTQDLISAF------------KLP-DGKSIE 259

Query: 288 LKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHF 347
           + ++ +  PE  F P+I      GL    ++S+  +   +R  ++S+++  GG   L  F
Sbjct: 260 VGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTTTLKGF 319

Query: 348 ASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYE 403
             R+  +L+       K +I I+    + + W   S       ++     + ++ E
Sbjct: 320 GDRMLHDLEALTKGTSKIKI-IAPPERKYTAWIGGSILTGLSTFQKLWTKKSDWLE 374

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 85/414 (20%), Positives = 154/414 (37%), Gaps = 72/414 (17%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKYDASYLSNQXXXXXXXXXXXXXR---- 59
           P+V+DNGS  +K G    + P C   + I   KYD   +                R    
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGLLK 72

Query: 60  ---PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMD 116
              P   G + +WE    +WD+     D     N+G+     L+ +E  +      + M 
Sbjct: 73  LRYPMDHGIIENWEHMETVWDHIF--KDCLKVSNLGEHP---LVVTEAPLNPKPNREKMC 127

Query: 117 QVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPST----EEYRDFQLV 172
           + +FE +   +L                            ++  P+        R    V
Sbjct: 128 ETLFESFNIPAL----------------------------YIANPAVLSLYASGRTTGCV 159

Query: 173 VDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVM-----DETILV 227
           V++G      +P+ +G     +++++DIGGR +   L+  L  R    M      E  +V
Sbjct: 160 VEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQ--LQLRKSTGMWLYSSSEQEIV 217

Query: 228 NNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSIT 287
             IKE         Y  S   K+    E  L D +   + +  P          D +++ 
Sbjct: 218 RLIKEN------GCYICSNHKKE---EEKFLLDQEKKSISFKLP----------DGKNLV 258

Query: 288 LKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHF 347
           +    F  PE  F+P +       L + I++S+S +   +R  +++NI   GG+     F
Sbjct: 259 IGPGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGSTMFQGF 318

Query: 348 ASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEY 401
             R+  EL   +    K RI ++    + S +   S  A+   ++   VT++++
Sbjct: 319 CDRLITELDFSVDKTTKVRI-LAPPERKYSAFIGGSILANLSTFRNMWVTKDQW 371

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 73/265 (27%), Positives = 107/265 (40%), Gaps = 60/265 (22%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R     D ++     I
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEQDASLRTAERI 269

Query: 231 K-EKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLK 289
           K E C                     YV PD    F  + R S +  + + E+ +  T K
Sbjct: 270 KQEYC---------------------YVCPDIVKEFNKFDRDSEKFAQFIVENKERTTKK 308

Query: 290 D-----ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNF 342
                 E F  PE FF+PEI  S  L P L   + E++   P  +R  + +NI+  GG+ 
Sbjct: 309 VVDVGYERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRKGLYNNIVLSGGST 367

Query: 343 NLPHFASRVAKELQRQLPTDWKCRITISKGNSELSG--------------------WKAM 382
               F  R    LQR L      RI+ S+   +LSG                    W   
Sbjct: 368 MFKDFGRR----LQRDLKGIVNDRISQSE---KLSGTRSTGVDVSVISHKRQRNAVWFGG 420

Query: 383 SSFASTDIYKATRVTREEYYEHGID 407
           S  A T  +K+   T+++Y E+G D
Sbjct: 421 SLLAQTGEFKSYCHTKQDYEEYGPD 445

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 106/258 (41%), Gaps = 50/258 (19%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILV 227
           V+DSG   T +IPV +G     A+K + I GR    F+  LL+E           E I  
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEVDTSLRTAERIK- 270

Query: 228 NNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS-- 285
              +E C                     YV PD    F  + R + +  + + E+S+S  
Sbjct: 271 ---QEYC---------------------YVCPDIVKEFNKFDRDAGKFAQFIVENSESTK 306

Query: 286 ---ITLKDELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGG 340
              + +  E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+  GG
Sbjct: 307 KKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 365

Query: 341 NFNLPHFASRVAKEL---------QRQLPTDWKCR----ITISKGNSELSGWKAMSSFAS 387
           +     F  R+ ++L         Q +L +  K        IS      + W   S  A 
Sbjct: 366 STMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQ 425

Query: 388 TDIYKATRVTREEYYEHG 405
           T  +K+   T+++Y E+G
Sbjct: 426 TAEFKSYCHTKQDYEEYG 443

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 106/257 (41%), Gaps = 48/257 (18%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   +++ L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEQDTSLKTAERI 267

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           K++  +V P          DI           + F  +V  S E+ +      + + +  
Sbjct: 268 KQEYCYVCP----------DIVKEFNKFDRDASKFAQFVVESQEKTR-----KKIVDVGY 312

Query: 291 ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
           E F  PE FF+PEI  S  L P L   + E++   P  +R  + +NI+  GG+     F 
Sbjct: 313 ERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFG 371

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSG--------------------WKAMSSFAST 388
            R    LQR + +    RI  S+    LSG                    W   S  A T
Sbjct: 372 RR----LQRDMKSIVNNRIAQSEA---LSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQT 424

Query: 389 DIYKATRVTREEYYEHG 405
             +K+   T+++Y E+G
Sbjct: 425 AEFKSYCHTKKDYDEYG 441

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 79/368 (21%), Positives = 139/368 (37%), Gaps = 69/368 (18%)

Query: 5   PVVIDNGSYRVKFGPASLEAPYC-ALNAIANDKYDASYLSNQXXXXXXXXXXXXXR---- 59
           P+VIDNGS  +K G +  E P     + + + KYD   L                R    
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGLLR 73

Query: 60  ---PHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMD 116
              P   G +  W+   LIW + L          + + +   L+ +E  M   +  + M 
Sbjct: 74  LQYPIEHGVVEDWDSMELIWAHILNEV-----LQLQNIEEHPLLITEAPMNPLKNREVMA 128

Query: 117 QVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPST----EEYRDFQLV 172
           QV+FE +   +L                            +V  P+        R    V
Sbjct: 129 QVLFETFNLPAL----------------------------YVSNPAVLSLYASGRTTGCV 160

Query: 173 VDSGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILVN 228
           +D G      +P+  G     ++ ++DIGGR     L   L+++     ++  +  I V 
Sbjct: 161 IDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREI-VR 219

Query: 229 NIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITL 288
            IKEK  +++     D  K ++   +E    D  + F             LP D + I +
Sbjct: 220 TIKEKVCYLAT----DIKKEENTYMQES--QDLTSVF------------KLP-DGKCIEI 260

Query: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
            ++ +  PE  F P+I      GL +  ++S+  +   +R  ++S+I+  GG   L  F 
Sbjct: 261 GNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTTLRGFG 320

Query: 349 SRVAKELQ 356
            R+  +L+
Sbjct: 321 DRMLHDLE 328

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 105/250 (42%), Gaps = 34/250 (13%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           K++  +V P          DI           + F  +V  + E+ +      +++ +  
Sbjct: 263 KQEYCYVCP----------DIVKEFNKFDRDPSKFAQFVVENQEKTR-----RKAVDIGY 307

Query: 291 ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
           E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+  GG+     F 
Sbjct: 308 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 366

Query: 349 SRVAKEL---------QRQLPTDWKCR----ITISKGNSELSGWKAMSSFASTDIYKATR 395
            R+ ++L         Q +L +  K        IS      + W   S  A T  +K   
Sbjct: 367 RRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYC 426

Query: 396 VTREEYYEHG 405
            T+++Y E+G
Sbjct: 427 HTKKDYEEYG 436

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 106/250 (42%), Gaps = 34/250 (13%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R    +D ++     I
Sbjct: 211 VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLL--RERGEVDTSLRTAERI 268

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           K++  +V P          DI           T F  ++  + E+ +      + + +  
Sbjct: 269 KQEYCYVCP----------DIVKEFNKFDRDATKFAQFIVENKEKTQ-----KKVVDVGY 313

Query: 291 ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
           E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+  GG+     F 
Sbjct: 314 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 372

Query: 349 SRVAKEL---------QRQLPTDWKCR----ITISKGNSELSGWKAMSSFASTDIYKATR 395
            R+ ++L         Q +L +  K        IS      + W   S  A T  +K+  
Sbjct: 373 RRLQRDLRSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAVWFGGSLLAQTAEFKSYC 432

Query: 396 VTREEYYEHG 405
            T+++Y E+G
Sbjct: 433 HTKKDYEEYG 442

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 100/262 (38%), Gaps = 58/262 (22%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILV 227
           V+DSG   T +IPV +G     A+K + I GR    F+  LL+E           E I  
Sbjct: 214 VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLLRERGEADSSLKTAERIK- 272

Query: 228 NNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSIT 287
              +E C                     YV PD    F  + R   +  + + E+    T
Sbjct: 273 ---QEYC---------------------YVCPDIVKEFNKFDRQPEKFAQFIIENQDKTT 308

Query: 288 LKD-----ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGG 340
            K      E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+  GG
Sbjct: 309 KKVIDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 367

Query: 341 NFNLPHFASRVAKELQRQLPTDWKCRIT-----------------ISKGNSELSGWKAMS 383
           +     F+ R    LQR + +    RI                  IS      + W   S
Sbjct: 368 STMFKDFSRR----LQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGGS 423

Query: 384 SFASTDIYKATRVTREEYYEHG 405
             A T  +K    T+++Y EHG
Sbjct: 424 LLAQTAEFKGYCHTKKDYEEHG 445

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 105/257 (40%), Gaps = 48/257 (18%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R    +D ++     I
Sbjct: 218 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 275

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           K++  +V P          DI           + F  ++  + EQ +      + + +  
Sbjct: 276 KQEYCYVCP----------DIVKEFNKFDRDGSKFAQFIVENQEQTR-----KKVVDVGY 320

Query: 291 ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
           E F  PE FF+PEI  S  L P L   +  ++   P  +R  + +NI+  GG+     F 
Sbjct: 321 ERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 379

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSG--------------------WKAMSSFAST 388
            R    LQR L +    RI  S+    LSG                    W   S  A T
Sbjct: 380 RR----LQRDLKSIVSNRIAQSE---RLSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQT 432

Query: 389 DIYKATRVTREEYYEHG 405
             +K+   T+++Y E+G
Sbjct: 433 AEFKSYCHTKKDYEEYG 449

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 109/250 (43%), Gaps = 34/250 (13%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R     D ++     I
Sbjct: 209 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSLRTAERI 266

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           K++  +V P    D  K  +   R+   P+    F  YV  + E+ +      + + +  
Sbjct: 267 KQEYCYVCP----DIVKEFNKFDRD---PE---KFAQYVVENQEKTQ-----KKVVDVGY 311

Query: 291 ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
           E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+  GG+     F 
Sbjct: 312 ERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 370

Query: 349 SRVAKEL---------QRQLPTDWKCR----ITISKGNSELSGWKAMSSFASTDIYKATR 395
            R+ ++L         Q +L +  K        IS      + W   S  A T  +K+  
Sbjct: 371 RRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKSYC 430

Query: 396 VTREEYYEHG 405
            T+++Y E+G
Sbjct: 431 HTKKDYEEYG 440

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 104/250 (41%), Gaps = 34/250 (13%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           K++  +V P          DI           + F  +V  + E+ +      + + +  
Sbjct: 263 KQEYCYVCP----------DIVKEFNKFDKDPSKFAQFVVENQEKTR-----RKVVDIGY 307

Query: 291 ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
           E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+  GG+     F 
Sbjct: 308 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 366

Query: 349 SRVAKEL---------QRQLPTDWKCR----ITISKGNSELSGWKAMSSFASTDIYKATR 395
            R+ ++L         Q +L +  K        IS      + W   S  A T  +K   
Sbjct: 367 RRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYC 426

Query: 396 VTREEYYEHG 405
            T+++Y E+G
Sbjct: 427 HTKKDYEEYG 436

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 76/345 (22%), Positives = 139/345 (40%), Gaps = 52/345 (15%)

Query: 41  YLSNQXXXXXXXXXXXXXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLI 100
           Y+ N+              P   GQ+ +W+     W+  ++       +   + +  + +
Sbjct: 105 YIGNEALVAAQSPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYFL 158

Query: 101 TSETCMTLPELGKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVET 160
            +E  +  PE  + + ++ FE +    L  +  A        T  ++I  +R        
Sbjct: 159 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVI--DRSLT----- 211

Query: 161 PSTEEYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNV 220
                      V+DSG   T +IPV +G     A+K + I GR +   ++  L  R    
Sbjct: 212 ---------GTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RERGE 260

Query: 221 MDETI-LVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQ-TSFLGYVRPSNEQGKP 278
            D ++     IK++  +V P          DI  +E+   D Q   F  ++  S E+ K 
Sbjct: 261 ADTSLRTAERIKQEYCYVCP----------DIV-KEFNKFDRQPEKFAQFIVESQEKTK- 308

Query: 279 LPEDSQSITLKDELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIM 336
                + + +  E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+
Sbjct: 309 ----QKVVDVGYERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRKGLYNNIV 363

Query: 337 CIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKA 381
             GG+     F+ R    LQR + +    RI+    N +++G K+
Sbjct: 364 LSGGSTMFKDFSRR----LQRDMKSIVNARIS---QNEKMTGVKS 401

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 104/250 (41%), Gaps = 34/250 (13%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           K++  +V P          DI           + F  +V  + E+ +      + + +  
Sbjct: 263 KQEYCYVCP----------DIVKEFNKFDRDPSKFAQFVVENQEKTR-----RKVVDIGY 307

Query: 291 ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
           E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+  GG+     F 
Sbjct: 308 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 366

Query: 349 SRVAKEL---------QRQLPTDWKCR----ITISKGNSELSGWKAMSSFASTDIYKATR 395
            R+ ++L         Q +L +  K        IS      + W   S  A T  +K   
Sbjct: 367 RRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYC 426

Query: 396 VTREEYYEHG 405
            T+++Y E+G
Sbjct: 427 HTKKDYEEYG 436

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 102/254 (40%), Gaps = 42/254 (16%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R    +D ++     I
Sbjct: 217 VIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLL--RERGEVDTSLRTAERI 274

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           K++  +V P          DI             F  YV  + ++ +      + + +  
Sbjct: 275 KQEYCYVCP----------DIVKEFNKFDRDAEKFAQYVVENQDKTR-----QKVVDIGY 319

Query: 291 ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
           E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+  GG+     F 
Sbjct: 320 ERFLAPEIFFNPEIASSDFLTP-LPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 378

Query: 349 SRVAKELQRQLPTDWKCRIT-----------------ISKGNSELSGWKAMSSFASTDIY 391
            R    LQR L +    RI                  IS      + W   S  A T  +
Sbjct: 379 RR----LQRDLKSIVNNRIAETERLSGARSTGVDVQVISHRKQRNAVWFGGSLLAQTPEF 434

Query: 392 KATRVTREEYYEHG 405
           K    T+++Y E+G
Sbjct: 435 KGYCHTKKDYEEYG 448

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 102/254 (40%), Gaps = 42/254 (16%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           K++  +V P          DI           + F  +V  + E+ +      + + +  
Sbjct: 263 KQEYCYVCP----------DIVKEFNKFDRDPSKFAQFVVENQEKTR-----RKVVDIGY 307

Query: 291 ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
           E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+  GG+     F 
Sbjct: 308 ERFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 366

Query: 349 SRVAKELQRQLPTDWKCRIT-----------------ISKGNSELSGWKAMSSFASTDIY 391
            R    LQR L +    RI                  IS      + W   S  A T  +
Sbjct: 367 RR----LQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 392 KATRVTREEYYEHG 405
           K    T+++Y E+G
Sbjct: 423 KGYCHTKKDYEEYG 436

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 105/252 (41%), Gaps = 38/252 (15%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R    +D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 271

Query: 231 KEKCLFVSP--ASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITL 288
           K++  +V P     F+ F        ++++ +              QGK      + + +
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRDVGKFSQFIIEN--------------QGK---TQKKIVDV 314

Query: 289 KDELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPH 346
             E F  PE FF+PEI  S  L P L   +  ++   P  +R  + SNI+  GG+     
Sbjct: 315 GYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYSNIVLSGGSTMFKD 373

Query: 347 FASRVAKEL---------QRQLPTDWKCR----ITISKGNSELSGWKAMSSFASTDIYKA 393
           F  R+ ++L         Q +L +  K        IS      + W   S  A T  +K+
Sbjct: 374 FGRRLQRDLRSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFKS 433

Query: 394 TRVTREEYYEHG 405
              T+ +Y E+G
Sbjct: 434 YCHTKRDYEEYG 445

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 103/258 (39%), Gaps = 50/258 (19%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLLKETLSFRHYNVMDETILV 227
           V+DSG   T +IPV +G     A+K + I GR    F+  LL+E           E I  
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSLRTAERIK- 268

Query: 228 NNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS-- 285
              +E C                     YV PD    F  + R   +  + + E+ +S  
Sbjct: 269 ---QEYC---------------------YVCPDIVKEFNKFDRDGEKFAQFVVENQESTR 304

Query: 286 ---ITLKDELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGG 340
              + +  E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+  GG
Sbjct: 305 KKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 363

Query: 341 NFNLPHFASRVAKEL---------QRQLPTDWKCR----ITISKGNSELSGWKAMSSFAS 387
           +     F  R+ ++L         Q ++ +  K        IS      + W   S  A 
Sbjct: 364 STMFKDFGRRLQRDLKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLAQ 423

Query: 388 TDIYKATRVTREEYYEHG 405
           T  +K    T+++Y E+G
Sbjct: 424 TAEFKGYCHTKKDYDEYG 441

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 92/218 (42%), Gaps = 38/218 (17%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R     D T+     I
Sbjct: 201 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRTAERI 258

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS----- 285
           K++                      YV  D    F  + R S +  + + E+S+      
Sbjct: 259 KQEYC--------------------YVCSDIVKEFNKFDRDSEKFAQFIVENSEKTRRKV 298

Query: 286 ITLKDELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFN 343
           I +  E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+  GG+  
Sbjct: 299 IDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTM 357

Query: 344 LPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKA 381
              F  R    LQR L      RI +S+    LSG K+
Sbjct: 358 FKDFGRR----LQRDLKGIVNNRIALSE---HLSGTKS 388

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 107/255 (41%), Gaps = 44/255 (17%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R     D ++     I
Sbjct: 216 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 273

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQ-TSFLGYVRPSNEQGKPLPEDSQSITLK 289
           K++  +V P          DI  +E+   D Q   F  ++  + ++ K      + + + 
Sbjct: 274 KQEYCYVCP----------DIV-KEFNKFDRQPEKFAQFIIENQDKTK-----QKVVDIG 317

Query: 290 DELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHF 347
            E F  PE FF+PEI  S  L P L   +  ++   P  +R  + +NI+  GG+     F
Sbjct: 318 YERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDF 376

Query: 348 ASRVAKELQRQLPTDWKCRI-----------------TISKGNSELSGWKAMSSFASTDI 390
           + R    LQR + +    RI                  IS      + W   S  A T  
Sbjct: 377 SRR----LQRDIKSIVNSRIIQNEAVTGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAE 432

Query: 391 YKATRVTREEYYEHG 405
           +K+   T+++Y E+G
Sbjct: 433 FKSYCHTKKDYEEYG 447

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 91/213 (42%), Gaps = 28/213 (13%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   +++ L  R     D ++     I
Sbjct: 217 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEEDTSLRTAERI 274

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           K++  +V P          DI             F  +V  S E+ +      + + +  
Sbjct: 275 KQEYCYVCP----------DIVKEFNKFDRDSEKFAQFVVESQEKTR-----RKVVDVGC 319

Query: 291 ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
           E F  PE FF+PEI  S  L P L   +  ++   P  +R  + +NI+  GG+     F 
Sbjct: 320 ERFMAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 378

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKA 381
            R    LQR L +    RI  S+    LSG K+
Sbjct: 379 RR----LQRDLKSIVNNRIVQSE---YLSGTKS 404

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 91/213 (42%), Gaps = 28/213 (13%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R     D T+     I
Sbjct: 207 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRTAERI 264

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKD 290
           K++  +V            DI             F  ++  ++E+ K      + I +  
Sbjct: 265 KQEYCYVC----------SDIVKEFNKFDRDPQKFAQFIVENSEKTK-----RKVIDVGY 309

Query: 291 ELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348
           E F  PE FF+PEI  S  L P L   + +++   P  +R  + +NI+  GG+     F 
Sbjct: 310 ERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 368

Query: 349 SRVAKELQRQLPTDWKCRITISKGNSELSGWKA 381
            R    LQR L      RI +S+    LSG K+
Sbjct: 369 RR----LQRDLKGIVNNRIALSE---HLSGTKS 394

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 71/326 (21%), Positives = 124/326 (38%), Gaps = 84/326 (25%)

Query: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLN-----------------------G 207
           LVVD G +   + PV+ G+ + K+ ++  I G++LN                        
Sbjct: 179 LVVDIGHDIISVSPVVDGMTFSKSTRRNVISGKYLNVLINDFLKPREIVPLFEIKQRKPT 238

Query: 208 LLKETLSFRHYNVM----DETILVNNIKEKCLFVSPASYFDSFK---------------N 248
           L+K+T  F  ++ +    ++  +   IKE    VSP S  + +K               N
Sbjct: 239 LVKKTFDFPIHDSLKTYANDRGIYQEIKEALCRVSPNSSLEKYKPELEKMSKRKYETLWN 298

Query: 249 KDIT---------------SREYVLP-DFQTSFLGYVRPSNEQGKPLPEDSQSITLKDEL 292
           +DI                 +E  +P D+ TS  G V   +    PL  +  + T+K + 
Sbjct: 299 EDIVFDNETIYGFGEQLFIPKENDIPVDWNTSKDGIVETWHNDYIPLKRNKPAGTVKTDK 358

Query: 293 FAVPE---------------------TFFHPEISQILKPGLVETILESLSMIPEVIRPLM 331
            A  E                          E  + + PG+V+ I  S++     +R  +
Sbjct: 359 EATEELTPAVDNATPSEDTNDNGKRPIGNEGEEKEKIIPGIVDLIESSINAADVDLRTSL 418

Query: 332 VSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNS---ELSGWKAMSSFAST 388
             N++  GG   +P  + R+  EL ++LP   K R+ ++ G +   +   W   S  +S 
Sbjct: 419 AHNVVLTGGTSCIPGLSDRILLELNKRLPA-LKFRV-LANGQTRERQYQSWLGGSILSSL 476

Query: 389 DIYKATRVTREEYYEHGIDWCTKHRF 414
             +    V ++EY E G D     RF
Sbjct: 477 GTFHQLWVGKQEYEEIGADRLLTDRF 502

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 104/256 (40%), Gaps = 46/256 (17%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETI-LVNNI 230
           V+DSG   T +IPV +G     A+K + I GR +   ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGETDTSLRTAERI 262

Query: 231 KEKCLFVSP--ASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITL 288
           K++  +V P     F+ F            PD    F  ++  + E+ +      + + +
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRN---------PD---KFAQFIVENQEKTQ-----KKIVDV 305

Query: 289 KDELFAVPETFFHPEI--SQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPH 346
             E F  PE FF+PEI  S  L P L   +  ++   P  +R  + +NI+  GG+     
Sbjct: 306 GYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKD 364

Query: 347 FASRVAKELQRQLPTDWKCRIT-----------------ISKGNSELSGWKAMSSFASTD 389
           F  R    LQR + +    RI                  I+      + W   S  A T 
Sbjct: 365 FGRR----LQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGGSLLAQTA 420

Query: 390 IYKATRVTREEYYEHG 405
            +K+   T+++Y E+G
Sbjct: 421 EFKSYCHTKKDYEEYG 436

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 47/106 (44%), Gaps = 3/106 (2%)

Query: 311 GLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITIS 370
           GL + I  S+      +R  +  N++  GG  +LP    R++ EL R LP   K R+  S
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPA-LKFRMLTS 432

Query: 371 KG--NSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
                 +  GW   S  AS   +    V ++EY E G D   K RF
Sbjct: 433 GQLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 75/331 (22%), Positives = 117/331 (35%), Gaps = 48/331 (14%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRPH 61
           E T VVID GS+    G +  + P   L +    KY                       H
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCPQAILPSCYG-KYTEGEKDELFSEQSIGLPRKDYEIH 71

Query: 62  TL---GQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQV 118
            +   G++  WE     WD+ + +   F      ++    L+T E      E  K   +V
Sbjct: 72  NIVQNGEVVDWEKAEKQWDWAIRSELRFET----NSGMPALLT-EPIWNSEENRKKSLEV 126

Query: 119 IFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFN 178
           + E  +F +    P A  + F                           R   LVVD G +
Sbjct: 127 LLESMDFSACYLVPTATAVSFAMG------------------------RPTCLVVDIGHD 162

Query: 179 CTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH----YNVMDETILVNNIK--- 231
            T + PV+ G+   K+  +  I G  LN L++  L+ R     + V     +    K   
Sbjct: 163 VTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDY 222

Query: 232 ----EKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQ--GKPLPEDS-Q 284
                   FV+   +F  FK   +      +  F++      + S E   G+ L  DS Q
Sbjct: 223 EIHPSLQKFVNERQFFQEFKETMLQVAPTSISKFKSEIETTSKRSIEAPWGEELVYDSLQ 282

Query: 285 SITLKDELFAVPETFFHPEISQILKPGLVET 315
            +   ++LF  P+    PE   I K G+VET
Sbjct: 283 RLEFAEQLF-TPDLSQFPEDWPISKDGVVET 312

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 63/145 (43%), Gaps = 7/145 (4%)

Query: 271 PSNEQGKPLPEDSQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPL 330
           PS E  +  P D  + + K      P    +P  S ++ PG+V+ I  S+      +R  
Sbjct: 362 PSKEGEESTPSDKTNDSGKR-----PMESENPTESSVI-PGIVDLIESSIMATDVDLRAS 415

Query: 331 MVSNIMCIGGNFNLPHFASRVAKELQRQLPT-DWKCRITISKGNSELSGWKAMSSFASTD 389
           +  NI+  GG   +P F+ R+  EL ++LP   ++   T      +   W   S  +S  
Sbjct: 416 LAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTTGQTRERQYQAWLGGSILSSLG 475

Query: 390 IYKATRVTREEYYEHGIDWCTKHRF 414
            +    V ++EY E G D   K RF
Sbjct: 476 TFHQLWVGKQEYEESGADRLLKDRF 500

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 217
           LVVD G +   + PVI G+   K+  +  I GRF+N  +KE L  R 
Sbjct: 173 LVVDIGHDVASVSPVIDGMTLSKSSMRNFISGRFINEKIKEFLKPRE 219

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 62/144 (43%), Gaps = 11/144 (7%)

Query: 273 NEQGKPLPEDSQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMV 332
           NE GK   ED +++        VP+     +I  I+ PG+ + +  +++     +R  + 
Sbjct: 461 NENGKRSIEDGENVD-------VPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLA 512

Query: 333 SNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSE--LSGWKAMSSFASTDI 390
            N++  GG   +P  A R+  EL ++LP   K RI  S    E     W   S   S   
Sbjct: 513 HNVILTGGTSLIPGLADRLMYELNKKLPA-LKFRILSSGHRRERKYQAWLGGSILTSLGT 571

Query: 391 YKATRVTREEYYEHGIDWCTKHRF 414
           +    V + EY E G D   K RF
Sbjct: 572 FHQLWVGKREYEEVGPDRLLKDRF 595

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 217
           LVVD G +   + PVI G+   K+V++    GR+LN LL+  +  R 
Sbjct: 246 LVVDVGHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 5/107 (4%)

Query: 311 GLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITIS 370
           G+V+ I +S+      +R  +  N++  GG   +P  + R+  EL + LP   K R+ +S
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPA-LKFRM-LS 472

Query: 371 KGN---SELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
            G+    +  GW   S  AS   +    V REEY E G +   K RF
Sbjct: 473 SGHLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 61/143 (42%), Gaps = 15/143 (10%)

Query: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH----YNVMDET-- 224
           LVVD G + + + PVI G+   K+  +  + G++LN L+ + L  R     + V+ +   
Sbjct: 156 LVVDIGHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREIVPIFQVLKKKPD 215

Query: 225 ----ILVNNIKEKCL-FVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPL 279
                L  ++ E  + F +   +F  FK   +    ++ P   +SF   +    ++    
Sbjct: 216 FVKRTLSFDVNESVINFANERQFFQEFKETLL----HIAPKSLSSFKDELATQTKRSLEA 271

Query: 280 PEDSQSITLKDELFAVPETFFHP 302
           P   + I   D  ++  E  F P
Sbjct: 272 PWGEELIFDADTRYSFAEQLFRP 294

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 46/106 (43%), Gaps = 3/106 (2%)

Query: 311 GLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITIS 370
           GL + I  S+      +R  +  N++  GG+ ++P    R+  EL + LP   K R+  S
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPA-LKFRMLTS 433

Query: 371 KGNSE--LSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
               E     W   S  AS   +    V ++EY E G D   K RF
Sbjct: 434 GQAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 73/332 (21%), Positives = 121/332 (36%), Gaps = 49/332 (14%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAI----ANDKYDASYLSNQXXXXXXXXXXXX 57
           E T ++ID GS+    G +  + P   L +      ND+   S  + Q            
Sbjct: 13  EITAIIIDPGSFNTNIGYSGTDCPQAILPSCYGQYINDEEKPSLFNEQSIGLPRKDYEIK 72

Query: 58  XRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQ 117
               + G++  W+     W++ + +   F        K    + +E      +  K   +
Sbjct: 73  EIVRS-GEVVDWDKAQEQWEWAIKSVLLFES-----NKGLPALLTEPIWNSEDNRKKSLE 126

Query: 118 VIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGF 177
           V+ E  +F +   +P A  + F                           R   LVVD G 
Sbjct: 127 VLLEGMDFEACYLTPTATAVSFAMG------------------------RPTCLVVDIGH 162

Query: 178 NCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVN--------- 228
           + T + PVI G+   K+  +  I G  LN L++ +L  R    + +              
Sbjct: 163 DITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRPEFVKRSFD 222

Query: 229 -NIKEKCL-FVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQ--GKPLPEDSQ 284
             I    L FV+   +F  FK   +      L  F++      + S E   G+ L  DS+
Sbjct: 223 YEIHPSLLNFVNERQFFQEFKETMLQVAPTSLTKFKSELEQLSKRSIEAPWGEDLVFDSE 282

Query: 285 S-ITLKDELFAVPETFFHPEISQILKPGLVET 315
           +   + ++LF  PET   PE   I K G+VET
Sbjct: 283 TRFNIAEQLFR-PETAKFPEDWPISKDGVVET 313

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 69/171 (40%), Gaps = 28/171 (16%)

Query: 248 NKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFFHPEISQI 307
           NKD T +  V P      L     +NE GK + E S  IT K  L  V +   H  I   
Sbjct: 338 NKDSTPQNSVEPSITAEPLD---ETNENGKRIIESSSEIT-KGSLLGVAD-LVHSSI--- 389

Query: 308 LKPGLVETILESLSMIPEV-IRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCR 366
                         M  +V +R  +  N++  GG   +P  + R+  EL  +LP   K R
Sbjct: 390 --------------MASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPA-LKFR 434

Query: 367 ITISKGNS---ELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
           + I+ G++   +   W   S   S   +    V +EEY + G+D     RF
Sbjct: 435 M-ITTGHTRERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 167 RDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLS 214
           R   LVVD G +   + PV+ G+   K+ K+    G +LN L+K  +S
Sbjct: 156 RSSCLVVDLGHDTCSVSPVVDGMTLSKSTKRNFFAGGYLNELIKNYIS 203

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 58/138 (42%), Gaps = 19/138 (13%)

Query: 278 PLPEDSQSIT------LKDELFAVPETFFHPEISQILKPGLVE---TIL------ESLSM 322
           P P DS+ I       L  E   VPE  F P +    + G++E   TIL      E   +
Sbjct: 595 PRPHDSEDIHQQHQMHLNVERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKL 654

Query: 323 IPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAM 382
            P  +   M +N+   GGN  LP    R+ KE    LP      +  S  N  L  W  M
Sbjct: 655 SPTAL--AMANNLWITGGNSKLPGMKERIVKEFTGFLPVGTAFNVKQSY-NPSLDAWNGM 711

Query: 383 SSFA-STDIYKATRVTRE 399
           +    +++ YK T ++++
Sbjct: 712 AKLTLNSEDYKNTIISKK 729

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGR----FLNGLL 209
           LV+D G   T +IPV++G       K+++ GGR    +LN LL
Sbjct: 183 LVIDCGNEETDVIPVVEGAGMLTDAKRINWGGRQAVDYLNDLL 225

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 48/106 (45%), Gaps = 3/106 (2%)

Query: 311 GLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITIS 370
           GL + +  +++     +R  +  N++  GG+ ++P    R+  EL ++LP   K RI  S
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPA-LKFRILTS 434

Query: 371 KGNSELS--GWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
               E     W   S  +S   +    V R+EY E G +   K RF
Sbjct: 435 GHLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 72/221 (32%), Gaps = 35/221 (15%)

Query: 2   EETPVVIDNGSYRVKFG-----PASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXX 56
           E + VVID GSY    G        L  P C     A  K      ++Q           
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQFMIMPRPDFEI 72

Query: 57  XXRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMD 116
             R    G +  WE     W + + +  +F  F     K      +E      E  K   
Sbjct: 73  K-RILENGCVVDWEAAQEQWAWAIRDELKFESF-----KGTPAFLTEAIWNPEENRKKSL 126

Query: 117 QVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSG 176
           +V+ E  EF +   +P A    F                           R   LV+D G
Sbjct: 127 EVLLEGMEFEACYIAPTATCTSFAMG------------------------RPTCLVLDIG 162

Query: 177 FNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 217
            +   + PV+ G+   K+  +  + G+ LN L++  L  R 
Sbjct: 163 HDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRE 203

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 82/224 (36%), Gaps = 37/224 (16%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXX-XXXXXXXXRP 60
           E T +VID GSY    G +  + P   + +      D +   NQ              RP
Sbjct: 11  EITSIVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARP 70

Query: 61  H-------TLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGK 113
                     G++  W+     WD+ L N + F   N G      ++ +E      E  K
Sbjct: 71  DYEIKRIVENGEIADWDTAQEQWDWVLKN-ELFLKSNSG----IPVLLTEPIWNSVENRK 125

Query: 114 NMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVV 173
              +V+ E  +F +   SPV+  + F                           R   LVV
Sbjct: 126 KSLEVLLEGMDFEACYLSPVSTCVSFAAG------------------------RPNCLVV 161

Query: 174 DSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 217
           D G + T + PVI G+   K+  +  I GR++N L++  L  R 
Sbjct: 162 DIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKPRE 205

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 61/145 (42%), Gaps = 10/145 (6%)

Query: 273 NEQGKPLPEDSQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMV 332
           NE GK   ED+ + T K+E   V       +I      G+ + +  S+      +R  + 
Sbjct: 377 NENGKRPIEDTTTSTAKNEDSEVSSNGNGVDII-----GIADLVQRSILDSDVDLRASLA 431

Query: 333 SNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGN---SELSGWKAMSSFASTD 389
            N++  GG   +P    R+  EL ++LP   K RI ++ G+    +   W   S   S  
Sbjct: 432 HNVVITGGTSCIPRLNDRLMYELSKRLPA-LKFRI-LTTGHLREKQYQAWLGGSILTSLG 489

Query: 390 IYKATRVTREEYYEHGIDWCTKHRF 414
            +    V +EEY E G D     RF
Sbjct: 490 TFHQLWVGKEEYKEVGADRLLVDRF 514

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 3/106 (2%)

Query: 311 GLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITIS 370
           GL + +  S+      +R  +  N++  GG  ++P  + R+  EL + LP+  K RI  +
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS-LKFRILTT 442

Query: 371 KGNSE--LSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
               E     W   S   S   +    V ++EY E G+D     RF
Sbjct: 443 GHTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 43/216 (19%), Positives = 76/216 (35%), Gaps = 34/216 (15%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAI----ANDKYDASYLSNQXXXXXXXXXXXX 57
           E + VVID GSY    G +  + P   L ++     +DK   +  S Q            
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSKTIFSEQSIGIPRKDYELK 72

Query: 58  XRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQ 117
                 G +  W+     W + L N        +        + +E      E  K   +
Sbjct: 73  PIIEN-GLVIDWDTAQEQWQWALKNE-----LYLDSNSGIPALLTEPVWNSTENRKKSLE 126

Query: 118 VIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGF 177
           V+ E  +F +   +P +  + F                           R   LVVD G 
Sbjct: 127 VLLEGMQFEACYLAPTSTCVSFAAG------------------------RPNCLVVDIGH 162

Query: 178 NCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 213
           +   + P++ G+   K+ ++  I G+F+N L+K+ +
Sbjct: 163 DTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 42/105 (40%), Gaps = 1/105 (0%)

Query: 311 GLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPT-DWKCRITI 369
           GL + +  S+      +R  +  N+   GG   +P  + R+  EL  +LP   ++   T 
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 370 SKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
            K   E   W   S   S   +    V R+EY E G D     RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 44/106 (41%), Gaps = 3/106 (2%)

Query: 311 GLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITIS 370
           GL + I  S+      +R  +  N++  GG  ++P    R+  EL + LP   K R+  S
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPA-LKFRMLTS 450

Query: 371 K--GNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
                 +   W   S  +S   +    V ++EY E G     K RF
Sbjct: 451 GHLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 49/150 (32%), Gaps = 29/150 (19%)

Query: 64  GQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIFEEY 123
           G +  W+     W + + +   F       TK      +E      E  K   +V+ E  
Sbjct: 92  GSVIDWDSAQEQWSWAIQHELHFES-----TKGMPAFLTEPIWNTEENRKKSLEVLLENM 146

Query: 124 EFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNCTWII 183
           EF +   SP    + F                           R   LVVD G +   + 
Sbjct: 147 EFEACFLSPTPTCVSFAMG------------------------RPTCLVVDIGHDVCSVS 182

Query: 184 PVIKGIPYYKAVKKLDIGGRFLNGLLKETL 213
           PV+ G+   K+     I G  LN LL + L
Sbjct: 183 PVVDGMTLSKSSTSNFIAGSLLNALLSKQL 212

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 59/298 (19%), Positives = 113/298 (37%), Gaps = 73/298 (24%)

Query: 167 RDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETL------------- 213
           R+  LVVD G +   + P+I G     AV +    G FL+  + E L             
Sbjct: 137 RNTSLVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDS 196

Query: 214 ----SFRHYNVMDETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYV 269
               SF+++        +++ K   L VSP+   +    +D  +  +   D +  FL   
Sbjct: 197 KVPESFKYWE--SSRTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHNPLDNKKYFL--- 251

Query: 270 RPSNEQGKPLPEDSQSITLKD-ELFAVPETFFHPEISQ---ILKPGLVETILESL----- 320
                      + ++++TL+  E + + E  F P+++      K GL E +++++     
Sbjct: 252 ---------YKKGNKTLTLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGA 302

Query: 321 ---------------------------SMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAK 353
                                      +  PE I   +++NI+  G    +P    R+  
Sbjct: 303 AVTTSNSGPAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVN 362

Query: 354 ELQRQLP----TDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGID 407
           EL  Q P    + +   + + +      G   MS+  S ++     +TR+EY  +GI+
Sbjct: 363 ELSYQFPQYKLSSFANPMVLDRKLQSWQGGVTMSNLPSWEL--GNWITRQEYDANGIN 418

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 60/140 (42%), Gaps = 12/140 (8%)

Query: 278 PLPEDSQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMC 337
           PLPE S +     +  A        +I +   PG+V+ I  S+S     IR  +  N++ 
Sbjct: 362 PLPESSSTTNENGKRTA-------EDIKREELPGIVDLISSSISSCDVDIRASLAHNLVI 414

Query: 338 IGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNS---ELSGWKAMSSFASTDIYKAT 394
            GG+  +P  + R+  EL  + P   K R+ ++ G S   +   W   S  +S   +   
Sbjct: 415 TGGSSTIPGLSDRILNELNMKFPA-LKFRV-LATGQSIERQYQSWLGGSILSSLGTFHQL 472

Query: 395 RVTREEYYEHGIDWCTKHRF 414
            + ++EY E G +     R 
Sbjct: 473 WIGKKEYEEVGSERLLHDRL 492

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/231 (19%), Positives = 77/231 (33%), Gaps = 44/231 (19%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQXXXXXXXXXXXXXRPH 61
           E T V+ID GSY    G A  + P   L +   + ++A   +++                
Sbjct: 13  EITAVIIDPGSYTTNIGYAGTDCPQSILPSSFGEIHEAEESTSEDNTEKTRKTRKVFSEQ 72

Query: 62  TL---------------GQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCM 106
           ++               GQ+  W+     W + L N       +I   +    + +E   
Sbjct: 73  SIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNE-----LHIESNRGIPAMLTEPLW 127

Query: 107 TLPELGKNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEY 166
              E      +++ E  EF +   +  +  + F                           
Sbjct: 128 NSKENRSKSLEILLEGMEFEACYLTATSTAVSFATG------------------------ 163

Query: 167 RDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 217
           R   L+VD G +   + PVI G+   K+ +     GRFLN LL + L  R 
Sbjct: 164 RPNSLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 57/144 (39%), Gaps = 22/144 (15%)

Query: 272 SNEQGKPLPEDSQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLM 331
           +NE GK   EDS+S  L                      G+ + +  S++     +R  +
Sbjct: 360 TNEHGKRPMEDSESSELA---------------------GISDLVHSSITSADVDLRATL 398

Query: 332 VSNIMCIGGNFNLPHFASRVAKELQRQLPT-DWKCRITISKGNSELSGWKAMSSFASTDI 390
             NI+  GG+ ++P F+ R+  EL ++LP   ++   T      +   W   S   S   
Sbjct: 399 AHNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTGHLRERQYQSWLGGSILTSLGS 458

Query: 391 YKATRVTREEYYEHGIDWCTKHRF 414
           +    V + EY E G +     RF
Sbjct: 459 FHQLWVGKREYEEVGAERLLNDRF 482

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 327 IRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGN---SELSGWKAMS 383
           +R  +  NI+  GG  ++P F+ R+  EL ++LP   K RI ++ G+    +   W   S
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPA-LKFRI-LTTGHLRERQYQAWLGGS 448

Query: 384 SFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
              S   +    V ++EY E G D     RF
Sbjct: 449 ILTSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 213
           LVVD G + T + PV+ G+   K+  +  + G  +N L+K+ L
Sbjct: 159 LVVDLGHDTTSVSPVVDGMTLSKSTMRNFLAGNCINELIKKPL 201

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 5/107 (4%)

Query: 311 GLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITIS 370
           GL + +  ++      +R  +  N++  GG+ ++P  + R+  EL R+LP   K RI +S
Sbjct: 392 GLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNRRLPA-LKFRI-LS 449

Query: 371 KGNS---ELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
            G++   +   W   S   S   +    V + EY E G++     RF
Sbjct: 450 TGHTKERQYQAWLGGSILTSLGTFHQLWVGKNEYNEVGVERLLMDRF 496

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%)

Query: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 217
           LVVD G + T + PV+ G+   K+  +  I G+++N L+++ L  R 
Sbjct: 163 LVVDIGHDTTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPRE 209

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 3/90 (3%)

Query: 327 IRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELS--GWKAMSS 384
           +R  +  N++  GG+ ++   A R+  EL ++LP   K RI  S    E     W   S 
Sbjct: 392 LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPA-LKFRILTSGHLRERQSRAWLGGSI 450

Query: 385 FASTDIYKATRVTREEYYEHGIDWCTKHRF 414
            +S   +    V R+EY E G +   K RF
Sbjct: 451 LSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 45/220 (20%), Positives = 74/220 (33%), Gaps = 33/220 (15%)

Query: 2   EETPVVIDNGSYRVKFGPASLEAPYCAL----NAIANDKYDASYLSNQXXXXXXXXXXXX 57
           E + VVID GSY    G +  ++P   +          + +     N             
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMARPDFEI 72

Query: 58  XRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQ 117
            R    G +  WE     W + + +  +F  F     K      +E      E  K   +
Sbjct: 73  KRILEDGCVVDWEAAQEQWTWAIRDELKFGSF-----KGTPAFLTEAIWNSEENRKKSLE 127

Query: 118 VIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGF 177
           V+ E  EF +   +P A  + F                           R   LVVD G 
Sbjct: 128 VLLEGMEFEACYIAPTATCVSFAMG------------------------RPTCLVVDIGH 163

Query: 178 NCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRH 217
           +   + PV+ G+   K+  +  + G+ LN L+++ L  R 
Sbjct: 164 DVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 50/107 (46%), Gaps = 5/107 (4%)

Query: 311 GLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITIS 370
           GL + +  S+      +R  +  N++  GG  ++P  + R+  EL + LP+  K RI ++
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS-LKFRI-LT 441

Query: 371 KGNS---ELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
            G++   +   W   S   S   +    V ++EY E G++     RF
Sbjct: 442 TGHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 213
           LVVD G +   + P++ G+   K+ ++  I G+F+N L+K+ L
Sbjct: 156 LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 48/107 (44%), Gaps = 5/107 (4%)

Query: 311 GLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITIS 370
           GL   +  S+      +R  +  N++  GG  ++P  + R+  EL + LP+  K RI ++
Sbjct: 383 GLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS-LKFRI-LT 440

Query: 371 KGN---SELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
            G+    +   W   S   S   +    V ++EY E GI+     RF
Sbjct: 441 TGHIRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 27/43 (62%)

Query: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 213
           LVVD G +   + P++ G+   K+ ++  I G+F+N L+++ L
Sbjct: 156 LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

>KNAG0G02750 Chr7 (611571..612794) [1224 bp, 407 aa] {ON} Anc_8.713
           YOR264W
          Length = 407

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 67/156 (42%), Gaps = 9/156 (5%)

Query: 258 LPDFQTSFLGYVRPSNEQGKPLPED-SQSITLKDELFAVPETFFH--PEISQILKPGLVE 314
           LP FQ ++       N++GK L      ++ LK  L +VPE F H     SQ  +  ++ 
Sbjct: 32  LPVFQDNYEDTGLKGNKEGKRLSRKFGGTLRLKQRLESVPEIFLHDFKRRSQEQRHSVLS 91

Query: 315 TILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNS 374
           TI E      +  RP+  +    +  +   PH   +  + LQR+LP   + R   S+  S
Sbjct: 92  TIDEKTR---DPSRPMHAAKSNGVAAH---PHNKIQSKRVLQRRLPPKQQLRSVSSQPTS 145

Query: 375 ELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCT 410
           ++ G   +     ++  K T    ++  E+   + T
Sbjct: 146 QVFGGSNVRVLQGSNKPKITVTAVQDTEENEAKFMT 181

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 5/107 (4%)

Query: 311 GLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITIS 370
           GL   +  S+      +R  +  N++  GG   +P  + R+  EL + LP+  K RI ++
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPS-LKFRI-LT 441

Query: 371 KGNS---ELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRF 414
            G++   +   W   S   S   +    V ++EY E G++     RF
Sbjct: 442 TGHTMERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 27/43 (62%)

Query: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETL 213
           LVVD G +   + P++ G+   K+ ++  + G+F+N L+K+ L
Sbjct: 156 LVVDIGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 81/212 (38%), Gaps = 20/212 (9%)

Query: 167 RDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETIL 226
           R+  L+VD G     + PVI G     A+ +    G FL+  + + LS +      E   
Sbjct: 90  RNTALIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQVGKLLSEKDDKQNGEESH 149

Query: 227 VNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSI 286
                E  L+ +  ++   FK+  +      L D  ++ L  +  S  +           
Sbjct: 150 EPTPLE--LWRNSRTWIQDFKSYMLQVAPSKLQDLDSAALDMMGLSYVKNFLYRRQKTIS 207

Query: 287 TLKDELFAVPETFFHPE-ISQILKP--GLVETILESL---------------SMIPEVIR 328
            ++ E  A+ E  F P  +SQ      GL E + +++               +  PE I 
Sbjct: 208 LMQKECCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTATNSSATNATTPEQIH 267

Query: 329 PLMVSNIMCIGGNFNLPHFASRVAKELQRQLP 360
             +++NI+  G +  +P    R+  +L  Q P
Sbjct: 268 AALLTNIVITGSSSLIPGLEQRIVNDLSYQFP 299

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 82/214 (38%), Gaps = 20/214 (9%)

Query: 167 RDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETIL 226
           R+  LVVD G   + + P+I G     AV +    G FL+  + E L+       +E   
Sbjct: 134 RNTALVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGD 193

Query: 227 VNNIKEKCLFV--SPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQ 284
            NN K+  L +  +  ++   FK   +      L D  ++ L  +  +  +   L +   
Sbjct: 194 PNNRKDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYIKNFLLQKQKT 253

Query: 285 SITLKDELFAVPETFFHPE-ISQ--ILKPGLVETILESLS---------------MIPEV 326
               + +   + E  F P  +SQ  +   GL E + +S+                  PE 
Sbjct: 254 ISLTQKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTPEQ 313

Query: 327 IRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLP 360
               +++NI+  G +  +     R+  +L  Q P
Sbjct: 314 THAALLTNILITGSSSLISGLEQRIVNDLSYQFP 347

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 321 SMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPT-DWKCRITISKGNSELSGW 379
           S  PE I   +++N++ IGG   L     R+  +L  Q P        T +  + +L  W
Sbjct: 313 SATPEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHVDRQLQSW 372

Query: 380 KAMSSFASTDIYK-ATRVTREEYYE 403
           +   +      +K  + VT++EY E
Sbjct: 373 QGGVNMCHLPDWKLGSWVTKQEYLE 397

>NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11
          Length = 330

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%)

Query: 93  DTKSKHLITSETCMTLPELGKNMDQVIFEEYEF 125
           +T SKH  + E C+ LP L K++DQV   E EF
Sbjct: 165 NTNSKH--SEEICLNLPNLSKDIDQVESNENEF 195

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 75/192 (39%), Gaps = 26/192 (13%)

Query: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNI 230
           LV+D   + + + P++ G+     + K   GG FL+  +      + ++ +DE +     
Sbjct: 156 LVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLDYQI-----IKKFSTIDEDLEEEMT 210

Query: 231 KEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNE---QGKPLPEDSQSIT 287
               ++VS  S+  +FK   +   +  L D +  +   +R   E   QG      +  ++
Sbjct: 211 NSSNIWVSSNSWIKNFKKTMLQVTDKKLQDVEKYYEEQLRLQAELQNQGSITSVGTNPLS 270

Query: 288 LKD---------------ELFAVPETFFHPEISQ---ILKPGLVETILESLSMIPEVIRP 329
           +K                EL+   E  F P+++        GL E I  S++       P
Sbjct: 271 VKKEYLYRSRKTVTFESRELYQFGEYLFQPQLASEQYNRDDGLGELIYRSITSAAMGNMP 330

Query: 330 LMVSNIMCIGGN 341
             V+    IGG+
Sbjct: 331 AAVAASNNIGGS 342

>Kpol_1036.15 s1036 complement(31585..40677) [9093 bp, 3030 aa] {ON}
            complement(31585..40677) [9093 nt, 3031 aa]
          Length = 3030

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 54/129 (41%), Gaps = 13/129 (10%)

Query: 285  SITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMV------SNIMCI 338
            S+ +  ELF +  TF   E   I +  L       L +I  + R  M       +N + +
Sbjct: 2704 SLPIMKELFWLSTTFLTSEHLTIFEGAL-------LFLINVLKRIYMTKFESESNNRLVV 2756

Query: 339  GGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTR 398
               F +  F+  +  EL++   T W  +       S L    ++SS  +T +Y   ++ R
Sbjct: 2757 TSLFEVRSFSEPMISELEKLYDTHWTEKNFTHTVISFLCKGLSISSIKTTSLYCIEQLFR 2816

Query: 399  EEYYEHGID 407
              YYEH ++
Sbjct: 2817 NTYYEHTLN 2825

>Suva_16.403 Chr16 complement(700071..702113) [2043 bp, 680 aa] {ON}
           YPR074C (REAL)
          Length = 680

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 47/123 (38%), Gaps = 21/123 (17%)

Query: 275 QGKPL-PEDSQSITLK-----DELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIR 328
            G PL P+D + +  K     D+ F VP+  +      ILKPG VE   +   +  E  +
Sbjct: 263 HGSPLQPDDVKQLKTKFGFNPDKSFVVPQEVYDHYQKTILKPG-VEANNKWNKLFSEYQK 321

Query: 329 PLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFAST 388
                           P   + +A+ L  QLP +W+ ++            + +S     
Sbjct: 322 --------------KYPELGAELARRLSGQLPANWESKLPTYTTKDSAVATRKLSEIVLE 367

Query: 389 DIY 391
           D+Y
Sbjct: 368 DVY 370

>KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 788

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 61/149 (40%), Gaps = 32/149 (21%)

Query: 172 VVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGR-----FLNGLLKETLSFRHYNVMDET-- 224
           V+D G   T I  V  G+    +  +L+ GG      F + LL+    +  +N+ +    
Sbjct: 379 VIDIGAKQTKIACVDDGVVVKNSALRLNYGGDDITRLFAHMLLQNKFPYADWNINEPNGW 438

Query: 225 ILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLG---YVRPSNEQGKPLPE 281
            L   +K++C+         +F++ DI  + Y       SF+    Y R   +  K    
Sbjct: 439 TLAETLKKQCI---------TFQDADIAIQLY-------SFIKRDPYARKYTQSHK---- 478

Query: 282 DSQSITLKDELFAVPETFFHPEISQILKP 310
                 L DE+   P   F P+I +++KP
Sbjct: 479 --YEYKLFDEVMCAPMGIFFPDIFEVIKP 505

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,020,351
Number of extensions: 2075882
Number of successful extensions: 5316
Number of sequences better than 10.0: 157
Number of HSP's gapped: 5230
Number of HSP's successfully gapped: 195
Length of query: 420
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 308
Effective length of database: 40,638,807
Effective search space: 12516752556
Effective search space used: 12516752556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)