Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B026908.256ON1210121052480.0
NCAS0B049808.256ON1204117623460.0
NDAI0B023808.256ON1219118822590.0
Suva_10.1688.256ON1220118822000.0
Skud_12.1528.256ON1220118921610.0
YLR084C (RAX2)8.256ON1220118921430.0
Smik_12.1438.256ON1220118821320.0
ZYRO0C01804g8.256ON1209119020430.0
Kpol_392.108.256ON1226120420310.0
TDEL0F038308.256ON1195118919400.0
SAKL0H17204g8.256ON1211120518320.0
TPHA0B032508.256ON1215120517680.0
KNAG0G020008.256ON1202118616750.0
TBLA0E043908.256ON1278126315520.0
CAGL0L12144g8.256ON1156118615270.0
AGR095W8.256ON1201121714491e-179
Kwal_56.235898.256ON1213119914021e-172
KLTH0G13838g8.256ON1214120413831e-170
Ecym_43158.256ON1212121413821e-169
KLLA0F18975g8.256ON1200119413551e-166
Ecym_27201.371ON67871980.007
KLLA0E00287gsingletonON51193791.1
KLLA0F08459g3.153ON837116801.2
YAR019C (CDC15)3.177ON97492737.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B02690
         (1210 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...  2026   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   908   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   874   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   852   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   837   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   830   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   825   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   791   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   786   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   751   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   710   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   685   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   649   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   602   0.0  
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   592   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   562   e-179
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   544   e-172
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   537   e-170
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   536   e-169
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   526   e-166
Ecym_2720 Chr2 (1392398..1394434) [2037 bp, 678 aa] {ON} similar...    42   0.007
KLLA0E00287g Chr5 (15302..16837) [1536 bp, 511 aa] {ON} weakly s...    35   1.1  
KLLA0F08459g Chr6 complement(787966..790479) [2514 bp, 837 aa] {...    35   1.2  
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    33   7.5  

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score = 2026 bits (5248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1045/1210 (86%), Positives = 1045/1210 (86%)

Query: 1    MRTHHKXXXXXXXXXXXXXXXXXXXXXXXXGIQTFAPPALIFSSNNDSSLQLLGSYDALS 60
            MRTHHK                        GIQTFAPPALIFSSNNDSSLQLLGSYDALS
Sbjct: 1    MRTHHKLIKSLSLFTTLSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALS 60

Query: 61   LYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSG 120
            LYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSG
Sbjct: 61   LYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSG 120

Query: 121  SLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVA 180
            SLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVA
Sbjct: 121  SLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVA 180

Query: 181  VWNITSNSTGLLPFLGFGENSSXXXXXXXXXXXXXFAGEFYTLDDXXXXXXXXXXXXXXI 240
            VWNITSNSTGLLPFLGFGENSS             FAGEFYTLDD              I
Sbjct: 181  VWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLDDASLLTSNTSNATTNI 240

Query: 241  YDLELSPLLPLNEATWXXXXXXXXXXXXICVNPDSDAWFVSGTTGTLACSLPYDSALTKI 300
            YDLELSPLLPLNEATW            ICVNPDSDAWFVSGTTGTLACSLPYDSALTKI
Sbjct: 241  YDLELSPLLPLNEATWSSDVSDFDASSFICVNPDSDAWFVSGTTGTLACSLPYDSALTKI 300

Query: 301  RIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDAA 360
            RIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDAA
Sbjct: 301  RIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDAA 360

Query: 361  SVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEY 420
            SVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEY
Sbjct: 361  SVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEY 420

Query: 421  AVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANL 480
            AVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANL
Sbjct: 421  AVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANL 480

Query: 481  PYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSG 540
            PYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSG
Sbjct: 481  PYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSG 540

Query: 541  YLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTVALNGLFQY 600
            YLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTVALNGLFQY
Sbjct: 541  YLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTVALNGLFQY 600

Query: 601  QLXXXXXXXXXXXAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESSN 660
            QL           AKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESSN
Sbjct: 601  QLSNFSSTFNSSSAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESSN 660

Query: 661  DLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGNSSID 720
            DLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGNSSID
Sbjct: 661  DLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGNSSID 720

Query: 721  TFKNVTFGNSEILVFNNAYLYNVXXXXXXXXXXXXXXXXXXAGANANGDLLFNGASSQMS 780
            TFKNVTFGNSEILVFNNAYLYNV                  AGANANGDLLFNGASSQMS
Sbjct: 721  TFKNVTFGNSEILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLLFNGASSQMS 780

Query: 781  YSFNNESINIGANNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSW 840
            YSFNNESINIGANNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSW
Sbjct: 781  YSFNNESINIGANNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSW 840

Query: 841  QWPNDVVAAIYSDNQSLLIAGTXXXXXXXXFLTVLNTTTYDVIANEXXXXXXXXXXGIVN 900
            QWPNDVVAAIYSDNQSLLIAGT        FLTVLNTTTYDVIANE          GIVN
Sbjct: 841  QWPNDVVAAIYSDNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANESLSSQQSQISGIVN 900

Query: 901  FASNATAIIGGNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSG 960
            FASNATAIIGGNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSG
Sbjct: 901  FASNATAIIGGNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSG 960

Query: 961  LFSTKNISSITMASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVWT 1020
            LFSTKNISSITMASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVWT
Sbjct: 961  LFSTKNISSITMASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVWT 1020

Query: 1021 VERXXXXXXXXXXDNLNYVTLASALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSSW 1080
            VER          DNLNYVTLASALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSSW
Sbjct: 1021 VERISNINSSSVVDNLNYVTLASALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSSW 1080

Query: 1081 VPYLLINSESDSSINAFIDRDMSSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPN 1140
            VPYLLINSESDSSINAFIDRDMSSFTNTQVALL                        IPN
Sbjct: 1081 VPYLLINSESDSSINAFIDRDMSSFTNTQVALLTNSGTVSNSSSSTTSPGASASATSIPN 1140

Query: 1141 KTHKRKIDRGFXXXXXXXXXXXXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIET 1200
            KTHKRKIDRGF                     IMAYVFRDDNGAYEPINPRIDENEMIET
Sbjct: 1141 KTHKRKIDRGFVVLLGLALALGTVAVLGIAGVIMAYVFRDDNGAYEPINPRIDENEMIET 1200

Query: 1201 VPPEKLMKYI 1210
            VPPEKLMKYI
Sbjct: 1201 VPPEKLMKYI 1210

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1176 (44%), Positives = 721/1176 (61%), Gaps = 25/1176 (2%)

Query: 46   NDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLDDTRINN 105
            +D+S +LLG  D+LS Y YTGQQNF+  I P++NSNGL YYSNNT IQL +   D+RI  
Sbjct: 43   DDNSFELLGGIDSLSFYRYTGQQNFTSGILPNSNSNGLTYYSNNTFIQLYEPSLDSRIER 102

Query: 106  IVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGG 165
            I+P GSDSFILSG GSL  YSL NQL +NLSS S+  IFN TL+ V SILVD  +V FGG
Sbjct: 103  IIPFGSDSFILSGKGSLGGYSLSNQLLFNLSSFSLKQIFNQTLDSVNSILVDGTVVCFGG 162

Query: 166  NFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXXXXXXXFAGEFYTLDD 225
            NFT S  + +GHSVA+WN T+NST LLPF+GFGENS              FAG+FYTLD+
Sbjct: 163  NFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGENSLINSITKLNDDNILFAGKFYTLDN 222

Query: 226  XXXXXXXXXXXXXXIYDLELSPLLPLNEATWXXXXXXXXXXXXICVNPDSDAWFVSGTTG 285
                          I D+ L  L+PL+ ATW            +C +P  +AWF +GT+G
Sbjct: 223  -STLLNVVNDTMRNISDINLGQLIPLSAATWSSTGSFFDEETFVCPDPTIEAWFQNGTSG 281

Query: 286  TLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYC 345
            TL C+LP+D A TKIRIYNSPD  N+IS FR+ SDPS SIMN+TYIDP  G L+HCD++C
Sbjct: 282  TLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFC 341

Query: 346  PLLSRDTLSSASDAASV-SEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSY 404
            PL ++  L SAS+  ++ SEM  LL+DN + I+WS ++QEF FVN +S + L+FLALNSY
Sbjct: 342  PLYTKQVLKSASENVTLSSEMIELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSY 401

Query: 405  GSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFY 464
            G+NV L+ + +YQD YA+FANNSLN  SC S  S ++SS LS+N W  G   Q YV T Y
Sbjct: 402  GTNVGLSSFQIYQDAYAIFANNSLNEPSCNSLES-FSSSDLSNNTWTRGMDDQNYVKTTY 460

Query: 465  TEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVE 524
                  +P+VTF+ +L YSG Y I LYTPGC  D TCS+RG+VNVTV++ +++SILST  
Sbjct: 461  IPHQGVLPEVTFHPDLKYSGQYSIELYTPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTL 520

Query: 525  IYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQIS 584
            IYQNN+ LKYDEL+SGYL  S +I + Y SGI S +T  TVV DR NI + SLDIL +I 
Sbjct: 521  IYQNNDQLKYDELYSGYLNYSPKITVTYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIH 580

Query: 585  SSKNGSTVALNGLFQYQLXX-XXXXXXXXXAKVGKTFLNQYPLDIFNTNSSLFASTYDNY 643
            +S N  ++ LNGLFQYQL            A+V  T +NQ  L  F++N SL AS Y++ 
Sbjct: 581  NSTN--SLELNGLFQYQLSNFSTSSKDSSIARVANTSINQLTLTGFSSNVSLSASLYNDT 638

Query: 644  LLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVT 703
            LLVG  +  +   E + DL   +S   G+EG+   ++ +S G+ +YG+FN S  +   ++
Sbjct: 639  LLVGAGDDGLSIYELNKDLAIQSSSQQGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLS 698

Query: 704  YNGSFNPFTQYGN--SSIDTFKNVTFGNSEILVFNNAYLYNVXXXXXXXXXXXXXXXXXX 761
            +NGSF+     GN  S I  F N+T  +SE+LVF+N  ++NV                  
Sbjct: 699  FNGSFDSI---GNITSPITNFANITIDDSELLVFDNNLIFNVSSSSQISNTSSFSLSLWS 755

Query: 762  AGANANGDLLFNGASSQMSYSFNNESINIGANNIVQGLNFNESIDPYLGLYMNTSHGAYF 821
            +G+N+NGD LF+GA SQ+ ++  + S++I ANN+    +      PY  +++N S   Y 
Sbjct: 756  SGSNSNGDTLFSGALSQVQFTNLSGSVSI-ANNL-SATSLRSIGSPYAAIFLNDSVTGYV 813

Query: 822  YQDDDNT-RVYFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTXXXXXXXXFLTVLNTTTY 880
             ++D +T  + F++GS+  W+W   V + +Y  NQS+L  G+         L++LN  ++
Sbjct: 814  LKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLTNQSMLAVGSSSSVNGE--LSILNLDSF 871

Query: 881  DVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNSTWSSFADAS 940
             V+ANE           +V+F  N++ ++GGNFS+ N  CFGLCL+NY  + W +F + +
Sbjct: 872  KVLANETLNQNSSVKT-MVHFERNSSILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGT 930

Query: 941  INGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKSGESNTFKSFTVAD 1000
            INGT+  +Q+FN+S+LI++G+F TK+ SS+ +A +NL +NK+  ++ G     K F   D
Sbjct: 931  INGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDFITID 990

Query: 1001 QKIVAWNNTALSIYEDNVWTVERXXXXXXXXXXDNLNYVTLA-SALSKRDTS--SSDAIL 1057
              I AWN T+L  Y  N W              D++ + T   + L KRD S  S++ ++
Sbjct: 991  DNIFAWNETSLFEYTSNSWVDIPISNSNSSTTIDSIGWTTTTDNNLKKRDNSETSNNVLI 1050

Query: 1058 VSGQLYDNSYGHIQAMVYDFSSWVPYLLIN---SESDSSINAFIDRDMSSFTNTQVALLX 1114
            V GQ+YDN YGHIQAM+Y+F  W+PYL IN   S ++     FIDRD+S   ++Q+AL  
Sbjct: 1051 VKGQIYDNVYGHIQAMIYNFEEWIPYLSINSLVSSANQPAELFIDRDVSKLFDSQLAL-- 1108

Query: 1115 XXXXXXXXXXXXXXXXXXXXXXXIPNKTHKRKIDRGFXXXXXXXXXXXXXXXXXXXXXIM 1174
                                         K+KIDRGF                     I+
Sbjct: 1109 QVSNTTASITASSSTPTPTSSPKKKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVIL 1168

Query: 1175 AYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210
            AY FRDD+G Y+ I PR++E+EM++TVPPEKLM++I
Sbjct: 1169 AYAFRDDDGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/1188 (40%), Positives = 714/1188 (60%), Gaps = 19/1188 (1%)

Query: 38   PALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQG 97
            P L  +++ND + QLLG  D LS Y Y GQQNF+  I P +NSNGL+YYSNNTLIQL + 
Sbjct: 36   PTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIPGSNSNGLIYYSNNTLIQLEEP 95

Query: 98   LDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVD 157
             +DT I  I P GSDSFILSG+GSL+ YSL NQL YNL++LS+ PIFNT++E+V++IL+D
Sbjct: 96   SNDTYIAKITPFGSDSFILSGTGSLSGYSLTNQLLYNLTTLSIEPIFNTSIEEVKTILID 155

Query: 158  EDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXXXXXXXFA 217
            + LVYFGGNFT  NGT + HS+ +W+ TS+ST  L F GFGENS              FA
Sbjct: 156  DSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGGFGENSIINSIVKLNDDNILFA 215

Query: 218  GEFYTLDDXXXXXXXXXXXXXXIYD---LELSPLLPLNEATWXXXXXXXXXXXXICVNPD 274
            GEFYTLD+              I++   +++  L+PL+ +TW            +C +  
Sbjct: 216  GEFYTLDEPDFLIQNTTSSQNNIFNSTTVDIGQLVPLSASTWDTGESTFDSDTFVCPDTT 275

Query: 275  SDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPR 334
             ++W  SGTTG+L C LP++ A TKIRIYNSP+  NQ+S FR++++ +  IMN+TYIDP 
Sbjct: 276  EESWIQSGTTGSLTCKLPFEVAPTKIRIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPI 335

Query: 335  TGNLEHCDSYCPLLSRDTLSSA-SDAASVSEMARLLSDNATVIKWSAEYQEFGFVNVVST 393
            +  L+HCD++CPL S+  LS A ++  S S+   LL+DN T IKW+ E+QEF F+N +S 
Sbjct: 336  SHELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLADNTTDIKWTQEFQEFAFINQISV 395

Query: 394  TLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFG 453
            + +QF+AL+SYG+NVAL+ + LYQ+ YAVFAN++LN  +C S  S  +SS  + NDW  G
Sbjct: 396  SSVQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNEPNCNSIESSSSSSLSA-NDWEMG 454

Query: 454  ASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYD 513
             +GQTY++T YT   DP+P V+F+  + Y G Y IN+YTPGC+ D TCS+R +VNVTV+D
Sbjct: 455  LTGQTYISTTYTPNQDPVPYVSFSPQIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWD 514

Query: 514  ESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIY 573
                SIL+T  IYQNN+ LKYDEL+SGYL +S R+ +EYVSG+ + +T  TVVADR N+ 
Sbjct: 515  SDGTSILATELIYQNNKELKYDELYSGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVL 574

Query: 574  VTSLDILGQISSSKNGSTVA-LNGLFQYQLXX-XXXXXXXXXAKVGKTFLNQYPLDIFNT 631
            + SL++ G  S+  N + +  LNGL QYQ+             K+  T LNQ  L+ F+ 
Sbjct: 575  IDSLEVPGLTSNGTNNTEIMNLNGLLQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSK 634

Query: 632  NSSLFASTY-DNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYG 690
            N+S++A  Y DN LL+G +   +  ++ + +++  +S+ + + G       +S GI  YG
Sbjct: 635  NTSMYADLYDDNTLLLGNSNGGIKVVKLNENMDIESSNEASLTGNTAGFSSYSGGILAYG 694

Query: 691  NFNLSGVTEGAVTYNGSFNPFTQY-GNSSIDTFKNVTFGNSEILVFNNAYLYNVXXXXXX 749
             +NLS      V YNG+FN    +  NSSI    N+T  ++E+LV +N  +YNV      
Sbjct: 695  EYNLSSKITYLVNYNGTFNEIPNFNKNSSITNVVNLTIHDTELLVIDNQAIYNVSSSSTI 754

Query: 750  XXXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGANNIVQGL--NFNESIDP 807
                        +G+N N D +F+GA + + Y+  N SI IG N  V  +  N + +   
Sbjct: 755  TNSSALQLSLWSSGSNLNRDTVFSGAIALLDYTDLNGSIAIGNNFTVTNITNNVSSTNSL 814

Query: 808  YLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTXXXXX 867
            Y GL++N S   Y  + D  + + F+NG    W +   +   +YS +Q++L   +     
Sbjct: 815  YTGLFLNDSLSIYASKTDSYSELLFSNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNK 874

Query: 868  XXXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNVNCFGLCLFN 927
                L++LN TT++ IANE          G++NF  N+T I+GGNF++   NC GLCL+N
Sbjct: 875  NSE-LSILNLTTFETIANE-TLNVNSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYN 932

Query: 928  YGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKS 987
            Y ++ W +FA+ SINGT+  M+L N ++L++SGLF+ +NISS+ +A ++L    ++++K 
Sbjct: 933  YDSNEWLTFANHSINGTIAQMELINGTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKM 992

Query: 988  GESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERXXXXXXXXXXDNLNYVTLASALSK 1047
            G++N  +SF     KI+ WN   L  YE+  W+  +           ++  +     L K
Sbjct: 993  GDANILQSFATIGDKIITWNGIMLESYENGAWSTIQSNFNSSTTIR-SIEPIGFGPTLQK 1051

Query: 1048 RD-TSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINS-ESDSSINAFIDRDMSSF 1105
            RD T S+D  +++G +YD  YG IQAM+Y+F  W PY +I+S  S  +   F++RD S+ 
Sbjct: 1052 RDGTGSADGFIINGNIYDTEYGTIQAMIYNFKEWRPYYIISSTNSQIAGQIFMNRDDSAL 1111

Query: 1106 TNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPN---KTHKRKIDRGFXXXXXXXXXXX 1162
             N+Q  L                          P+   +  ++KIDRGF           
Sbjct: 1112 YNSQSVLQNPNNATVTTPSSTSSGTPSATHSSQPHHQKQVGRKKIDRGFVVLIGLALALG 1171

Query: 1163 XXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210
                      ++AY+F+D +G+++ +NPR +E+EM+ETVPPEKLMK++
Sbjct: 1172 TVSLLGIIGLVLAYIFKDGDGSHDALNPRTNEDEMLETVPPEKLMKFL 1219

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1188 (40%), Positives = 695/1188 (58%), Gaps = 20/1188 (1%)

Query: 38   PALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQG 97
            P+L  S +ND+++Q+LG  DALS Y YTGQQNF+ +I  +TNS GLVYYSNNT I L + 
Sbjct: 38   PSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEA 97

Query: 98   LDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVD 157
             +DTRI+ I P G+DSFILSGSGS+N   L NQ+ YNLS+LS+  IF  +L  VE++LV+
Sbjct: 98   DEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVN 157

Query: 158  EDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXXXXXXXFA 217
            +  VYFGGNF+++NG+  GH   VW+ TSN+T LLPF GFGE+S+             FA
Sbjct: 158  DTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFA 217

Query: 218  GEFYTLDDXXXXXXXXXXXXXXIYD-----LELSPLLPLNEATWXXXXXXX-XXXXXICV 271
            G+FYTLDD                      LEL   +PL  A+W             +C 
Sbjct: 218  GKFYTLDDSSILTTSSTNTTNASSTLNATTLELGQRIPLRYASWDSQGSTTFESSYLVCP 277

Query: 272  NPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYI 331
            +   DAW   GT+G+L C+LPY+ A TKIR+YNSP+S N IS F+++++PSGSIMN+TY+
Sbjct: 278  DTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYL 337

Query: 332  DPRTGNLEHCDSYCPLLSRDTLSSASDAASVS-EMARLLSDNATVIKWSAEYQEFGFVNV 390
            DP +G L+ CD +CPL SRDTL SAS   S S +M   + +N T +KWS+++Q+F F N 
Sbjct: 338  DPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANE 397

Query: 391  VSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDW 450
            +S T L+F ALNSYG+ V L+G  LYQD ++ +ANNSLN   C++  +D +SS LSDN W
Sbjct: 398  LSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKW 457

Query: 451  VFGASGQTYVTTFYTEGD-DPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNV 509
              G +GQ+Y+   Y      P P VTF  ++ + G Y IN YTPGC  D TCS+RG+VNV
Sbjct: 458  YDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNV 517

Query: 510  TVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADR 569
            T+++  +++++ T  IYQNN  LKYD+++SGYL  S  IV++YVSGI + +T T +VAD+
Sbjct: 518  TMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQ 577

Query: 570  SNIYVTSLDILGQISSSKN-GSTVALNGLFQYQLXXXXXXXXXXXAKVGKTFLNQYPLDI 628
             NI   SLD    +S + +      LNG+ QYQ             K+  T LN + +D 
Sbjct: 578  VNIITDSLDSFSSLSETTSVKRHTPLNGILQYQ-RSNFTATTSNGTKIANTTLNLFSVDN 636

Query: 629  FNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFL 688
            +  NSS+FA  YD  L++GG +  +  ++ +++L  ++S+N  ++G    M   ++G+ +
Sbjct: 637  YPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLI 696

Query: 689  YGNFNLSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVXXXXX 748
            +G+   S      + +NGSF   + Y + +++   N+T  N++++VFNN Y++N      
Sbjct: 697  FGDVRSSDNKSTVLMFNGSFESVSNY-SKAVENAINITLANNDLIVFNNDYIFNASSNSQ 755

Query: 749  XXXXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGANNIVQGLNFNESIDPY 808
                         AG N N D+LF+GA SQM +S  + S      + V+ LN N+ I PY
Sbjct: 756  ISNSTSFSLSLWSAGNNDNDDVLFSGAVSQMQFSDLSGSARFLNESTVEALNLNKGIVPY 815

Query: 809  LGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTXXXXXX 868
            LG Y+N S  AY Y+ +  +++YF+N   PSW W N++   +Y++NQ+LL+ G+      
Sbjct: 816  LGAYLNESTIAYAYKTNSLSKIYFSNNVSPSWNWSNNITKMVYANNQTLLVIGSESSTTA 875

Query: 869  XXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNVNCFGLCLFNY 928
               L++LN   +  IANE            VNF  N++ ++GG+F M   NC GLC++NY
Sbjct: 876  E--LSILNLRNFTTIANE-TLGSNAKINAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNY 932

Query: 929  GNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKSG 988
             + +WS+F + +I G +  +   NESELI+SGLF+T+   SI + S NL N+ +  L +G
Sbjct: 933  ESKSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTG 992

Query: 989  ESNTFKSFTVADQKIVAWNNTALSIYEDNVW-TVERXXXXXXXXXXDNLNYVTLASALSK 1047
                  SFTV ++ IVAWN+T+L IY+D  W T               ++  T + AL K
Sbjct: 993  SGGKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPGNGSSVSSVTTIDTNTDSYALRK 1052

Query: 1048 RDTSSSDA---ILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINSESDSSINA--FIDRDM 1102
            R T+ ++    +L++G      YG++Q +++D  +W PY    +   SS N   FI+RD+
Sbjct: 1053 RATTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTPYFTSETLEASSYNPTIFINRDV 1112

Query: 1103 SSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPNKTHKRKIDRGFXXXXXXXXXXX 1162
            S+  N+Q+ L                            K+ K+ +DRGF           
Sbjct: 1113 SADFNSQIPLSNSNMTVTSPQSTSPLSPSSSASSEPNKKSKKKNMDRGFVVLIGLALALG 1172

Query: 1163 XXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210
                      I+AYVF+D  G Y PI PRIDENEM++TVPPEKLMK++
Sbjct: 1173 TVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVPPEKLMKFV 1220

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1189 (39%), Positives = 686/1189 (57%), Gaps = 22/1189 (1%)

Query: 38   PALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQG 97
            P L  S +N +++Q+LG  DALSLY YTGQQNF+ +I+P TNS GLVYYSNNT IQ+   
Sbjct: 38   PNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDA 97

Query: 98   LDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVD 157
             DDTRI+ I P G+DSFILSGSG++N   + NQ+ YNLS+LS+ PIF+  L  VES+L++
Sbjct: 98   SDDTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLIN 157

Query: 158  EDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXXXXXXXFA 217
               VYFGGNF+++NG+  GHS  +W+  SN T LLPF GFGENS+             FA
Sbjct: 158  GTSVYFGGNFSYNNGSMTGHSALIWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFA 217

Query: 218  GEFYTLDDXXXXXXX------XXXXXXXIYDLELSPLLPLNEATWX-XXXXXXXXXXXIC 270
            G+FYTLDD                       LEL   +PL  ATW             +C
Sbjct: 218  GKFYTLDDSSALITAGSNNTTNSTSLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVC 277

Query: 271  VNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTY 330
             N + DAW    T+GTL C LPY+ + TK+R+YNS DS  +IS F+++++PS SIMN+TY
Sbjct: 278  PNANEDAWVYPATSGTLVCKLPYEVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTY 337

Query: 331  IDPRTGNLEHCDSYCPLLSRDTLSSAS-DAASVSEMARLLSDNATVIKWSAEYQEFGFVN 389
            +DP +G L++CD +CPL SR TL SAS + +S  +M   L +N T +KWS+++Q+F F N
Sbjct: 338  LDPLSGKLKNCDEFCPLYSRATLLSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFAN 397

Query: 390  VVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDND 449
             +  TLL+F A+NSYG +V L+G  LYQD ++ +ANNSLN   C++  +D +SSTLS N 
Sbjct: 398  ELPVTLLKFTAINSYGKSVGLSGLELYQDTFSTYANNSLNEYGCSALANDSSSSTLSSNS 457

Query: 450  WVFGASGQTYVTTFYTEG-DDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVN 508
            W  G  G++Y+ T Y    D+P P+V F  N+ + G Y+IN YTPGC  D TCS+RG+VN
Sbjct: 458  WYNGLGGESYIATEYVPNQDEPTPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVN 517

Query: 509  VTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVAD 568
            VT+++  + +++ T  IYQNN+ LKYD+++SGYL  S  I+LEYVSGI + +T T VVAD
Sbjct: 518  VTMWNPQNKTMMKTYTIYQNNDNLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVAD 577

Query: 569  RSNIYVTSLDILGQISSSKNGST-VALNGLFQYQLXXXXXXXXXXXAKVGKTFLNQYPLD 627
            + N+    LD    +S S N    + LNG+ QYQ             K+G T LN + +D
Sbjct: 578  QVNVITVLLDAFSTLSESANTKEYIPLNGVLQYQ-KSNFTSTTSNETKIGNTTLNVFAVD 636

Query: 628  IFNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIF 687
             +  NSSLFA T  + L++GG    +  +  +++L    S+   ++G    M   S+G+ 
Sbjct: 637  NYPNNSSLFADTNGDRLILGGTNNHISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLL 696

Query: 688  LYGNFNLSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVXXXX 747
            ++G+   S      + +NGSF     Y + ++++  N++  N++++VF+N Y+ N     
Sbjct: 697  IFGDLLSSNNQSSVLLFNGSFENVFNY-SRTVNSAINISLANNDLIVFDNDYIVNTSSSA 755

Query: 748  XXXXXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGANNIVQGLNFNESIDP 807
                          AG+N N D+LF+GA S+M +   N S    + + VQ LN + ++ P
Sbjct: 756  QILNSTSFSLSLWSAGSNGNDDVLFSGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVP 815

Query: 808  YLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTXXXXX 867
            YL  Y+N S  AY Y+ +   ++YF+N   PSW W   +   +Y++NQSLL  G+     
Sbjct: 816  YLAAYLNESTTAYAYETNLLNKIYFSNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTT 875

Query: 868  XXXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNVNCFGLCLFN 927
                L++ N   + +IANE           +VNF  N++ ++GGNF M   NC GLCL+N
Sbjct: 876  AE--LSIFNLKNFTMIANE-TMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYN 932

Query: 928  YGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKS 987
            Y + +WS+F + +  G +  +     S+L++SGLF T+   S+ +AS NL N+ +  L +
Sbjct: 933  YESKSWSTFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLT 992

Query: 988  GESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERXX-XXXXXXXXDNLNYVTLASALS 1046
            G      SF V ++ IVAWN+T+L IY D  W +               +N       L+
Sbjct: 993  GAEGKINSFVVTEESIVAWNDTSLLIYRDQEWNITSVPGNDSSIGSVSTINTNAGPGTLN 1052

Query: 1047 KRDTSSSD---AILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINSESDSSINA--FIDRD 1101
            +R T++++    +L+SG      YG++Q +++DF +W PY +  S + S+ N   FI+RD
Sbjct: 1053 RRATNNAENGTILLLSGNFSIPDYGNLQGLLFDFETWSPYFVSESSNTSNRNPTIFINRD 1112

Query: 1102 MSSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPNKTHKRKIDRGFXXXXXXXXXX 1161
            +S+  N+Q+ L                         +  K+ KR IDRGF          
Sbjct: 1113 VSTEFNSQIPLSNLNVTETGPQSASSQFPSSSASSELKPKSKKR-IDRGFVVLIGLALAL 1171

Query: 1162 XXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210
                       I+AYVF+D  G Y+PI PRIDENEM++TVPPEKLMK++
Sbjct: 1172 GTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/1189 (39%), Positives = 689/1189 (57%), Gaps = 22/1189 (1%)

Query: 38   PALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQG 97
            P L  S NN +++Q+LG  DALS Y YTGQQNF+ +I P+T+S+GLVYYSNNT IQL   
Sbjct: 38   PNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDA 97

Query: 98   LDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVD 157
             DDTRI+ I P G DSFILSGSG++N  S+ NQ+ YNLS+LS+ PIFN +L  V+++L D
Sbjct: 98   SDDTRIDKITPFGVDSFILSGSGTINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLAD 157

Query: 158  EDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXXXXXXXFA 217
               +YFGGNF+++NG+  G+S  +W+  SN+T LLPF GFGENSS             FA
Sbjct: 158  NSSIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFA 217

Query: 218  GEFYTLDDXXXXXXXX-----XXXXXXIYDLELSPLLPLNEATWXXXXXXX-XXXXXICV 271
            G+FYTLDD                      LEL   +PL  A+W             +C 
Sbjct: 218  GQFYTLDDPSALISSSNNGTNSTSSLNATTLELGQRIPLRYASWDSQGSTTFASDSLVCP 277

Query: 272  NPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYI 331
            N + DAW    T+G+L C+LPY+ + TKIR+YNS  S ++IS F++++DPS SIMN+TY+
Sbjct: 278  NTNEDAWLYPDTSGSLVCNLPYEVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYL 337

Query: 332  DPRTGNLEHCDSYCPLLSRDTLSSASDAASVS-EMARLLSDNATVIKWSAEYQEFGFVNV 390
            DP +G L++C  +CPL SR TL SAS   S S +M   + +N T +KW++++Q+F FVN 
Sbjct: 338  DPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNE 397

Query: 391  VSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDW 450
            +  + L+F+ALNSYG +V L+G  LYQD ++ +AN+SLN   C++  +D +SSTLS NDW
Sbjct: 398  LPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDSLNEYGCSALTNDSSSSTLSSNDW 457

Query: 451  VFGASGQTYVTTFYT-EGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNV 509
              G +G++Y+   Y  + ++PIP+V F  N+ + G Y IN+YTPGC  D TCS RG+VNV
Sbjct: 458  YNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNV 517

Query: 510  TVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADR 569
            T++++ +++I+ T  IYQNN+ LKYD+++SGYL  S  IVLEYVSGI + +T T VVAD+
Sbjct: 518  TMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQ 577

Query: 570  SNIYVTSLDILGQISSSKNGST-VALNGLFQYQLXXXXXXXXXXXAKVGKTFLNQYPLDI 628
             N+   SLD    +S S N      LNG+ QYQ             KVG T LN +P+  
Sbjct: 578  VNVITVSLDAFNTLSDSSNAKKETLLNGILQYQ-KSNFTSTRLNETKVGNTTLNLFPVKN 636

Query: 629  FNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFL 688
            +  NSSL+A  YDN L++GG    +  ++ ++D   ++S N  ++G    +   ++G+ +
Sbjct: 637  YPKNSSLYADIYDNKLVIGGVSNRISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLI 696

Query: 689  YGNFNLSGVTEGAVTYNGSF-NPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVXXXX 747
            +G+   S        +NGSF N F Q  + ++++  N++  N++ +V +N Y+ N     
Sbjct: 697  FGDILSSNNQSAVFLFNGSFENVFNQ--SRTVNSALNISLANNDFIVLDNDYVVNASSNA 754

Query: 748  XXXXXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGANNIVQGLNFNESIDP 807
                          AG N +GD+LF+GA S M Y   N S+     N ++ LN    I P
Sbjct: 755  LIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGNLNGSVRFLNENEIEPLNLEGGIVP 814

Query: 808  YLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTXXXXX 867
            YLG Y+N S  AY Y+ D   ++YF+N   PSW W + +   +Y+DNQ+LL         
Sbjct: 815  YLGAYLNESATAYAYEVDSLNKIYFSNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTT 874

Query: 868  XXXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNVNCFGLCLFN 927
                L++ +     +IANE           +VNF  N + ++GG+F M   NC GLCL+N
Sbjct: 875  AE--LSIFDLRNLTMIANE-TLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYN 931

Query: 928  YGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKS 987
            Y + TWS+F + +I G +  +   N SELI+SGLF TK   SI + S NL N+ +  L S
Sbjct: 932  YESKTWSTFLNNTIFGEITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLS 991

Query: 988  GESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERXXXXXXXXXXDNLNYVTLAS-ALS 1046
            G      SFTV +  IVAWN+T+L IY +  W +             +  Y  + S  L+
Sbjct: 992  GSEGKLNSFTVTEDSIVAWNDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLN 1051

Query: 1047 KR---DTSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINSESDSSINA--FIDRD 1101
            KR   + ++   +L++G    + YG++Q++++DF  W PY +  + + S+ N   FI+RD
Sbjct: 1052 KRGINNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPIIFINRD 1111

Query: 1102 MSSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPNKTHKRKIDRGFXXXXXXXXXX 1161
            +S+  N+Q  L                           +K+ K+KI RGF          
Sbjct: 1112 VSTEFNSQSPLANVNITVTSPQSTSSQPPSSSASSESKSKSKKKKIGRGFVVLIGLALAL 1171

Query: 1162 XXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210
                       I+AYVF+D  G Y+PI PRIDENEM++TVPPEKLMK++
Sbjct: 1172 GTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1188 (39%), Positives = 687/1188 (57%), Gaps = 20/1188 (1%)

Query: 38   PALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQG 97
            P L  S NN +++Q+LG  DA+S Y YTGQQNF+  I+P TNS+GLVYYSNNT IQL   
Sbjct: 38   PNLNISQNNSNAVQILGGVDAISFYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDA 97

Query: 98   LDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVD 157
             DDTRI+ I P G DSFILSGSG++N  S+ NQ+ YNLS+LS+ PIFN +L  VE++LV+
Sbjct: 98   SDDTRIDKITPFGDDSFILSGSGTINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVN 157

Query: 158  EDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXXXXXXXFA 217
            +  VYFGGNF+++NG+  GHS  VW+  S++  LLPF GFGENS+             FA
Sbjct: 158  DTSVYFGGNFSYNNGSMIGHSALVWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFA 217

Query: 218  GEFYTLDDXXXXXXXXXXXXXXIY-----DLELSPLLPLNEATW-XXXXXXXXXXXXICV 271
            G+FYTLDD               +      LEL   + L  A+W             +C 
Sbjct: 218  GKFYTLDDSSVLITSSNNGTNSTFSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCP 277

Query: 272  NPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYI 331
            N + +AW    T+G+L C+LPY+ + TKIR+YNS D+ ++I+ F+++++PS SIMN+TY+
Sbjct: 278  NDNGNAWLYPATSGSLVCNLPYEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYL 337

Query: 332  DPRTGNLEHCDSYCPLLSRDTLSSASDAASVS-EMARLLSDNATVIKWSAEYQEFGFVNV 390
            DP +G L++CD +CPL SR TL +AS  AS S +M   +  N T +KWS+++Q+F F N 
Sbjct: 338  DPLSGELKNCDEFCPLYSRATLLAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANE 397

Query: 391  VSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDW 450
            +  T L+ +ALNSYG ++ L+G  LYQ+ ++ +ANNSLN   C++  +D +SS LS+N W
Sbjct: 398  LPVTSLKLIALNSYGDSIGLSGLELYQNTFSTYANNSLNEYGCSALVNDSSSSILSNNSW 457

Query: 451  VFGASGQTYVTTFYT-EGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNV 509
              G +G++Y+ T Y  + ++PIP+V F  N+ +SG Y IN YTPGC  D TCS+RG+VNV
Sbjct: 458  YNGLTGESYIATNYIPDQNEPIPRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNV 517

Query: 510  TVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADR 569
            TV++  +++++ T  IYQNN+ LKYD++FSGYL  S  IVLEY+SGI S +T T VVADR
Sbjct: 518  TVWNPQNNTMMKTYTIYQNNDNLKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADR 577

Query: 570  SNIYVTSLDILGQISSSKN-GSTVALNGLFQYQLXXXXXXXXXXXAKVGKTFLNQYPLDI 628
             N+   SLD    +S   N      LNG+FQYQ             KVG T LN +P++ 
Sbjct: 578  VNVITVSLDTFNALSEINNVKRQTPLNGIFQYQ-KSNFTGTTSNKTKVGNTTLNLFPVNN 636

Query: 629  FNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFL 688
            +  N+SL    Y++ L+VGG    +  ++ + +    +S+N  ++G    +    +G+ +
Sbjct: 637  YPKNASLLVEIYNDKLIVGGVSNRISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLI 696

Query: 689  YGNFNLSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVXXXXX 748
            YG+   S      + +N SF     Y    +++  N++  ++E+ VF+N Y+ N      
Sbjct: 697  YGDLRSSDNQSTVLLFNESFGKVPNYS-KRVNSATNISIADNELFVFDNNYIINASSNAQ 755

Query: 749  XXXXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGANNIVQGLNFNESIDPY 808
                         AG N NGD+LF+G  S M +S  N S +    + VQ LN    I PY
Sbjct: 756  ISNSTSFSLSLWAAGNNGNGDVLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPY 815

Query: 809  LGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTXXXXXX 868
             G Y+N S  AY Y+ D   ++YF+N   PSW W N +   +Y++NQ++L+  +      
Sbjct: 816  FGAYLNESVSAYAYETDALNKIYFSNKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTA 875

Query: 869  XXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNVNCFGLCLFNY 928
               LT+ N      IANE           +VNF  N++ ++GG+F +   NC GLCL+NY
Sbjct: 876  D--LTIFNLRNMTTIANE-TLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNY 932

Query: 929  GNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKSG 988
               +WS+F + +I G V  + L N SELI+SGLF+T+   SI + S NL N  +  L SG
Sbjct: 933  ETKSWSTFFNNTIFGEVTQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSG 992

Query: 989  ESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERX-XXXXXXXXXDNLNYVTLASALSK 1047
                  SF V D  +VAWN+T+L IY +  W +               ++  T +  L+K
Sbjct: 993  SEGKLNSFVVTDNSLVAWNDTSLFIYGNQKWNITSLPSDDSLIGSVSTISTNTKSDTLNK 1052

Query: 1048 RDTSSSD---AILVSGQLYDNSYGHIQAMVYDFSSWVPYLL--INSESDSSINAFIDRDM 1102
            R T+++     +L++G      YG++Q++++DF +W PY +  I++ S+ +   FI+RD+
Sbjct: 1053 RATNNAHDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFISEISNSSNYNPTFFINRDV 1112

Query: 1103 SSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPNKTHKRKIDRGFXXXXXXXXXXX 1162
            S+  N+Q+ L                           +K+ K+KIDRGF           
Sbjct: 1113 STEFNSQITLPNLNITVTNPQSTSSQSPSTSATSESKSKSEKKKIDRGFVVLIGLALALG 1172

Query: 1163 XXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210
                      I+AYVF+D  G Y+PI PRIDENEM++TVPPEKLMK++
Sbjct: 1173 TVSVLGIVGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/1190 (37%), Positives = 671/1190 (56%), Gaps = 33/1190 (2%)

Query: 38   PALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQG 97
            P L  +S+ + +L+LLG +  L+ Y YTGQ+NF+  +   T+S+GL+YYSN+T +QL  G
Sbjct: 36   PKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTDSHGLIYYSNDTFLQLANG 95

Query: 98   LDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVD 157
             +DT I  IVP+G DSFILSGSG ++ Y+L+ QL YNL+ LS  PIF   L +V SILVD
Sbjct: 96   SNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDLSFKPIFQEGLTEVNSILVD 155

Query: 158  EDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXXXXXXXFA 217
            + LVYFGGNFTFSNG+  GHSV +WN   NST LLPF+GFG+NS+             FA
Sbjct: 156  QPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFA 215

Query: 218  GEFYTLDDXXXXXXXXXXXXXXIY-----DLELSPLLPLNEATWXXXXXXXXXXXXICVN 272
            G FY LDD                     D+EL   +PL  A W            IC +
Sbjct: 216  GNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPLQNANWTSSSSQFDADDFICPD 275

Query: 273  PDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYID 332
            P+ ++W  SGT+G+LACSLP ++   KIRIYNSP   N++S FR++++P+  I+N++Y+D
Sbjct: 276  PERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNEVSLFRILAEPTKGILNLSYVD 335

Query: 333  PRTGNLEHCDSYCPLLSRDTLSSA-SDAASVSEMARLLSDNATVIKWSAEYQEFGFVNVV 391
            P  G L +CD++CPL +R  L  A S+++SV  M     +N T IKW  ++QEF FVN V
Sbjct: 336  PEEGELRYCDAFCPLYNRQRLEEASSNSSSVENMTTFSDNNTTDIKWGRDFQEFAFVNNV 395

Query: 392  STTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWV 451
              + ++F+AL+SYGSNV L+ +  +Q   +++ANNSLN  +C    S Y+++T+S+NDW 
Sbjct: 396  PISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQPACGKMQS-YSNATISNNDWR 454

Query: 452  FGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTV 511
             G +GQTY++T Y E    IP+VTF+  + Y G+Y I LYTPGC  DGTC+ R +VNVT+
Sbjct: 455  QGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKLYTPGCLGDGTCNQRAIVNVTL 514

Query: 512  YDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSN 571
            +D   +  LS+  IY+NN  LKYDEL+ G+LK+S ++ LEY S I  ++  + VVAD  +
Sbjct: 515  WDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLEYHSPIYPNNPTSVVVADYIS 574

Query: 572  IYVTSLDILGQISSSKNGSTVALNGLFQYQLXXXXXXXXXXXAKVGKTFLNQYPLDIFNT 631
            +   S D        K+   + LNG+FQYQ+             +G T L+ +PL  F+ 
Sbjct: 575  LEAKSFDHF-----EKHKKDITLNGIFQYQI--SNFTKNITKESIGNTSLDVFPLSYFSN 627

Query: 632  NSSLFASTYDN-YLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYG 690
            NSSLFAS Y+N  LL+  ++     ++   + +  +S +  +  Q + +  +S+G+ L+G
Sbjct: 628  NSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNLASQVRGIGSYSDGLILFG 687

Query: 691  NFNLSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVXXXXXXX 750
            ++N S     A+++NGSFN + +  N S++ F N+    +E+LVF+N + YNV       
Sbjct: 688  DYNSSQRQPLALSFNGSFNSYDKI-NRSVERFTNIDLKGTELLVFDNEFFYNVSSQSYVS 746

Query: 751  XXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGANNIVQGLNFNESIDPYLG 810
                       AG N NGDL+F+GA S   Y      +++  N      N  ++I+PY+G
Sbjct: 747  NTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLFQNGSAVSSNIKDNINPYMG 806

Query: 811  LYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTXXXXXXXX 870
             Y+N +  AY Y+D  ++R+ F+NG +  W+W N +   IY +  +LL  GT        
Sbjct: 807  AYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIETMIYRNRDALLALGTSSSPSLPQ 866

Query: 871  FLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGN 930
             L+VLN TT +V+ANE           I+ F  N+T +IGGNFS  + +C GLCL+NY N
Sbjct: 867  -LSVLNLTTSEVLANETLDKGAEVNSMIL-FGKNSTLLIGGNFSFSDAHCNGLCLYNYKN 924

Query: 931  STWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKSGES 990
              WS+FA+ SI G V  +QL N SEL+++G       S + + S+N+    +  L  G  
Sbjct: 925  KRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLVSVNITGQGMKTLLRGWE 984

Query: 991  NTFKSFTVADQKIVAWNNTALSIYEDNVWTVERXXXXXXXXXXDNLNYVTLASALSKRDT 1050
               +SF V++ ++V WN+T+L  Y++  W               +++ V+L  +L KR  
Sbjct: 985  GPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNSTSFTKLQDIHQVSLEHSLEKRAN 1044

Query: 1051 SSS----DAILVSGQLYDNSYGH-IQAMVYDFSSWVPYLLINSESDSS---INAFIDRDM 1102
            SSS    D +LV G   D + G   QA +YD+ SW P  + NS+S++S    N F+++D+
Sbjct: 1045 SSSNSNLDGLLVYGN--DKTQGDSYQASIYDYYSWTPLFIANSKSENSNSGPNIFMNQDV 1102

Query: 1103 SSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPNKTHK--RKIDRGFXXXXXXXXX 1160
            S F  ++  L                           +K H+   K+DRG+         
Sbjct: 1103 SDFFISEQML---PNPTNHTSSRSSSSSSSAVTSNSGDKKHRASHKVDRGYVVLIGLALA 1159

Query: 1161 XXXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210
                        ++AY+F +D G YE ++P  +  +  ET PP K  K++
Sbjct: 1160 IGTVVVIGVFGILIAYMFGEDIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/1204 (37%), Positives = 686/1204 (56%), Gaps = 31/1204 (2%)

Query: 31   GIQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNT 90
            GI T   P + F + N+  +Q+L + + L+ Y Y GQQNF+  I  ++N++GL+YYSN+T
Sbjct: 30   GINTVNIPQINFGNTNNE-IQILSNIEGLTFYQYQGQQNFTGSIDTNSNTHGLIYYSNDT 88

Query: 91   LIQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQ 150
            LI+L +G D+T+I+ IVP+  D+FILSGSG+L  + LENQL YNLS LS+ P+FN  L+ 
Sbjct: 89   LIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYNLSDLSIIPLFNNQLQN 148

Query: 151  VESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXX 210
            ++SILVD+D+VYFGGNF++++     +S+  WN  + +  +LPF+GFG+NS+        
Sbjct: 149  IKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPFIGFGKNSTVNSILKLD 208

Query: 211  XXXXXFAGEFYTLDDXXXXXXXXXX--------XXXXIYDLELSPLLPLNEATWXXXXXX 262
                 F G+F TLDD                        +LEL   + L  A+W      
Sbjct: 209  EDNLLFFGDFSTLDDKSLLVSNITTYTQQNSTSSSSTETNLELEQQISLKYASWASLGDL 268

Query: 263  XXXXXXICVNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPS 322
                  IC N  ++AW  +GTTG + C+L ++++L+KIRI+NSP  Q+QI+ FR+++ PS
Sbjct: 269  KSSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIFNSPYEQDQIASFRIVTAPS 328

Query: 323  GSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDAASVS-EMARLLSDNATVIKWSAE 381
              IMN+TY+DP T  +++CD++CPL S + L ++S+ A+ S   +  ++ N T I WS +
Sbjct: 329  NGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTSASTSAFINGNKTNIGWSTD 388

Query: 382  YQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYT 441
            YQEF FVN V  T LQ +AL SYG NV L+G+ LYQ+ Y++FANNSLN  +C S N+   
Sbjct: 389  YQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFANNSLNEPACDSPNTVIP 448

Query: 442  SSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTC 501
            SS LS+N W  G + Q+Y+ T YT GDDP P V F  ++   G+Y +N+YTPGC+ DGTC
Sbjct: 449  SSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINRIGNYTVNIYTPGCTGDGTC 508

Query: 502  STRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDST 561
            S RG+VNVT++D + + ++ST  IYQNN  +KYD+LF G+L  + ++ LEY SGI+ +++
Sbjct: 509  SFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDYAPKVTLEYYSGINDENS 568

Query: 562  GTTVVADRSNIYVTSLDI---LGQISSSKNGSTVALNGLFQYQLXXXXXXXXXXXAKVGK 618
               VVAD  ++   ++++   +G ++SS     V LNG+FQYQL            KV  
Sbjct: 569  PVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQYQLSNFTSSNNNSTLKVDN 628

Query: 619  TFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKN 678
            T LN +P+  F+++ SL+   Y+  LL+GG+   VYAL  SN  N  ++      G+   
Sbjct: 629  TSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVYALSLSNYTNIRSTRIVETGGEVTG 688

Query: 679  MQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNA 738
               ++ G+ L+GNFN+S     +++YNG+F+ F    NS+I TF N+TFG SEIL FNN 
Sbjct: 689  TGAYAGGVVLFGNFNISNRIVSSLSYNGTFDSFGNV-NSNIATFSNLTFGESEILAFNNE 747

Query: 739  YLYNVXXXXXXXXXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGANNIVQG 798
            Y +N                   AG+N  GD LF+G  ++  +   N S  +  N   Q 
Sbjct: 748  YFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRNEFPNLNNSAVLTGNGTAQS 807

Query: 799  LNFNESIDPYLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIYSDNQSLL 858
            L     I PYLG+Y+N S  AY Y    N+ + F+NG Q +W  P  V +A YSDN+++ 
Sbjct: 808  LQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFSNGLQGNWNLPRSVSSAYYSDNETMF 867

Query: 859  IAGTXXXXXXXXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNV 918
            +  +         L VLN TT D++ NE           IV+F  N++ ++GG+F+ PN 
Sbjct: 868  VGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSINS-IVSFGRNSSLLVGGDFTAPNT 926

Query: 919  NCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLK 978
            NC  LCL N GN+ WSSF++   +GT+  ++  N+S L++SG +  +N S I++  ++L 
Sbjct: 927  NCSNLCLLNLGNNQWSSFSNK-FDGTITGLEFANDSRLLISGSYRFENQSGISLGYIDLN 985

Query: 979  NNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERXXXXXXXXXXDNLNY 1038
            N +  +L S +S    SF   +  IVAW+++ +  Y  + W+  +           N+  
Sbjct: 986  NQEFKSLLS-DSQKVNSFNYNNGTIVAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQI 1044

Query: 1039 VT----LASALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINSESDSSI 1094
            V+      S  +  +  + + ILV G+LY   YG +QAM YDF +W+PY +  ++  SS+
Sbjct: 1045 VSKLNNSLSTNNTSNNLNDELILVFGELYSEDYGFVQAMFYDFQNWIPYYI--TQPYSSL 1102

Query: 1095 NA-----FIDRDMSSFTNTQVALL---XXXXXXXXXXXXXXXXXXXXXXXXIPNKTHKRK 1146
            N      F+++D+S    +QV L                            + N   + K
Sbjct: 1103 NTSKNSLFMNKDISLLYESQVVLQNPNSTISISSTSSSSATTRSSSTSSTSLKNGNIESK 1162

Query: 1147 IDRGFXXXXXXXXXXXXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKL 1206
            I RG+                      MAY+F DD G Y  I PRIDE+EM++TVPPEKL
Sbjct: 1163 IHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVRIKPRIDEHEMLDTVPPEKL 1222

Query: 1207 MKYI 1210
            MK+I
Sbjct: 1223 MKFI 1226

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/1189 (38%), Positives = 651/1189 (54%), Gaps = 30/1189 (2%)

Query: 31   GIQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNT 90
            GI     P L F      +LQL G ++AL+   Y GQ+NF+  I  +T+S G+VYYSN+T
Sbjct: 28   GIVNIGTPRLDFPG---EALQLFGGFNALTFPQYEGQENFTGTINNNTDSRGIVYYSNDT 84

Query: 91   LIQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQ 150
             I+L  G  D+ +  IVP GS+SFIL GSGSL  Y L  QL YNLS LS+ PIF  +L  
Sbjct: 85   FIKLINGSSDSYVEKIVPFGSESFILGGSGSLLGYELGRQLLYNLSDLSLRPIFENSLTD 144

Query: 151  VESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXX 210
            V  IL D  + YFGGNF+F NG+  GHSVA WN +SN+T LLPF GFGE S         
Sbjct: 145  VRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSSNTTSLLPFGGFGEESIVNSIIKLD 204

Query: 211  XXXXXFAGEFYTLDDXXXXXX-XXXXXXXXIYDLELSPLLPLNEATWXXXXXXXXXXXX- 268
                 F GEFYTLDD                  +E++ LLPL  ATW             
Sbjct: 205  SDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIEINELLPLRAATWNTDSDSSFDSSAF 264

Query: 269  ICVNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNM 328
            IC N   +AW V  T+G+L  SLPY+S   K+RIYNSP+  N +S FR+I+ PS  IMN+
Sbjct: 265  ICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSPEEHNAVSLFRIITKPSNGIMNL 324

Query: 329  TYIDPRTGNLEHCDSYCPLLSRDTLSSASDAASVSEMARLLSDNATVIKWSAEYQEFGFV 388
            TY+DP +G L +CD++CPL+ +D+L +A    + S++ R L +N T I+WS +YQ+F FV
Sbjct: 325  TYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQVVR-LDNNLTDIQWSYDYQDFAFV 383

Query: 389  NVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDN 448
            N ++ T LQFLAL+SYG  V L+ + LYQD    +ANNSLN   C SN+   TS+ LSD+
Sbjct: 384  NKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLNEVGCESNDIASTSA-LSDS 442

Query: 449  DWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVN 508
            +W  G  GQ+Y+   +  G + +P+VTF   + Y+G Y +NLYTPGCS D TC++R +VN
Sbjct: 443  EWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQYTMNLYTPGCSSDQTCTSRSIVN 502

Query: 509  VTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVAD 568
            VT++ E   SILS++ ++QNNEA+KYD+++SG+L+ +  + LEY S IS ++    VVAD
Sbjct: 503  VTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVLTLEYYSPISPNNPSNVVVAD 562

Query: 569  RSNIYVTSLDILGQISSSKNGSTVALNGLFQYQLXXXXXXXXXXXAKVGKTFLNQYPLDI 628
            R  + V S+DIL     ++   T+ LNG+FQYQL           + +  T LN Y +  
Sbjct: 563  RLEVIVESVDIL----KNQTDETIPLNGMFQYQLSNFTNSTDSKPS-IANTTLNSYTVQN 617

Query: 629  FNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFL 688
            F  N+SLF+S Y+N L VGG+   V A+E   DL+ S++      G  + +  +S+GI L
Sbjct: 618  FPKNASLFSSMYNNTLWVGGSVSGVAAVELDEDLHVSSTAKYATGGTVEGISSYSDGIIL 677

Query: 689  YGNFNLSGVTEGAVTYNGSFNPFTQYGN--SSIDTFKNVTFGNSEILVFNNAYLYNVXXX 746
            +G FNLS      +T+NG F  F   GN  +++ T+ NV+F   E+LVFNN Y++N+   
Sbjct: 678  FGTFNLSSQPVSTLTFNGVFGSF---GNLETTLRTYTNVSFQQDELLVFNNEYVFNLSSN 734

Query: 747  XXXXXXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGANNIVQGLNFNESID 806
                           AG N   D LF+GA ++  +     S +I +N+ V   +      
Sbjct: 735  SYISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYSNSSVAHFSLQNGAQ 794

Query: 807  PYLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTXXXX 866
            PY   ++N S  AY Y+    +++YF NG +  W W   + +  YS N ++L  GT    
Sbjct: 795  PYAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSMRYSKNSTILAIGT-DGS 853

Query: 867  XXXXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNVNCFGLCLF 926
                 L++ N T++DV+AN            +V F  N++ ++GG++ + + +C GLCL+
Sbjct: 854  TDEPILSLFNLTSFDVLAN-TTISENGTISSMVFFDRNSSLLVGGDYHISDADCSGLCLY 912

Query: 927  NYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALK 986
            NY    W+ FA+ SI G +  MQL    +L++SG  +  N +S+ + S N+ N ++  L 
Sbjct: 913  NYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVNLLSFNMSNYEVNPLV 972

Query: 987  SGESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERXXXXXXXXXXDNLNYVTLASALS 1046
               +   KSF   D  I+ WN T+LS Y D  W              D +  V    AL 
Sbjct: 973  WDSNGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEFDNSSLISIVDVIA-VKTEPALD 1031

Query: 1047 KRDTSSS--DAILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINSESD---SSINAFIDRD 1101
            KR T SS  DAILV+GQ Y     + QA +Y+F  W+PY + N   D   S    F ++D
Sbjct: 1032 KRQTFSSTFDAILVAGQNYAE---YPQASIYNFQRWLPYYVANKADDEDPSRTTFFTNQD 1088

Query: 1102 MSSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPNKTHKRKIDRGFXXXXXXXXXX 1161
             S   ++Q  LL                                KI+RGF          
Sbjct: 1089 DSQLYDSQ-NLLSDPTRTTTSSSSSTTSSSQTSPSKGSLVRKSGKINRGFVVLIGLALAL 1147

Query: 1162 XXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210
                       ++A VF   +G YE ++PR DE+EMI+TVPPEKL+K++
Sbjct: 1148 GTVVIIGITGVLLALVFNGHSG-YEQVDPRADESEMIDTVPPEKLLKFL 1195

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1205 (36%), Positives = 656/1205 (54%), Gaps = 51/1205 (4%)

Query: 32   IQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTL 91
            IQ  + P +  SS+ +  + LLG ++ L+ Y YTGQ+NF+  IT       L+YYSN T 
Sbjct: 32   IQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGSITE--TEKDLIYYSNGTF 89

Query: 92   IQLNQGLDD---TRINNIVPIGSDSFILSGSGSL-NEYSLENQLFYNLSSLSVYPIFNTT 147
            I+L+   D+     IN+I+P G DSFILSG+G+L   ++LE QL YNLSSL    IFN +
Sbjct: 90   IKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQLLYNLSSLEYTAIFNQS 149

Query: 148  LEQVESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXX 207
            +  V  IL D+++VYFGG F ++ G   GHSV +WN T+N   LLPF GFG +S      
Sbjct: 150  ISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQLLPFKGFGLDSVVNSIL 209

Query: 208  XXXXXXXXFAGEFYTLDDXXXXXXXX-XXXXXXIYDLELSPLLPLNEATWXXXXXXXXXX 266
                    FAG+F TLDD                 D+E   L+PL  A W          
Sbjct: 210  RLDNDNIVFAGKFNTLDDNTLLKQIRGSNSSKNATDIEFDQLIPLKHAGWSSQGSLEHSS 269

Query: 267  XXICVNPDSDAWFVSGT-TGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSI 325
              IC + DSD WF  GT TG    SL  D   +K+RIYN+ DS  Q+S FR+I+ P+  I
Sbjct: 270  L-ICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNAFDSDYQVSLFRIITSPANGI 328

Query: 326  MNMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDAASVS-EMARLLSDNATVIKWSAEYQE 384
            MN+TY+DP+TG L +CD++CPLLS + L  A    ++S +    + +N T IKW++ YQE
Sbjct: 329  MNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDSVAYIGNNNTNIKWTSAYQE 388

Query: 385  FGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSST 444
            F FVN VS   L FLAL+SYGS+V L G+ +YQ+ Y  FAN++LN  +C + NS   + T
Sbjct: 389  FAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFANDTLNQPNCDNINSYSHAVT 448

Query: 445  LSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTR 504
             S   W  G+   +Y+ + Y +G   +P V F  N+ Y+GDY +N+ TPGC+ DG+CS+R
Sbjct: 449  SSKQQWTQGSMDSSYILSTY-DGTGDLPSVNFYPNITYAGDYTLNMVTPGCTGDGSCSSR 507

Query: 505  GLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTT 564
            G+VNVTV+D+ +D++LST  IYQNN   KYD L+SGYL+++ +I L++   I++DS+ + 
Sbjct: 508  GIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLESAPKITLKFYESINTDSSTSI 567

Query: 565  VVADRSNIYVTSLDILGQISSSKNGSTV---ALNGLFQYQLXXXXXXXXXXXAKVGKTFL 621
            +VADR ++ + S+D       SK G       LNGLFQYQ+            K+G T +
Sbjct: 568  MVADRVDVIIDSID------QSKIGLKTINETLNGLFQYQI-SNFTTISNDSLKIGNTTI 620

Query: 622  NQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQP 681
            N+Y ++   +NS LFA  Y+N LLV GA   +  L+ ++DLN  +    G  G  + +  
Sbjct: 621  NRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDDLNIISEQRMGTGGPTEGINT 680

Query: 682  FSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLY 741
            +S G+   G+FNLS      ++YNG+F+ F     ++I  F N+T  +SE+LVFNN Y++
Sbjct: 681  YSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNL-RTNITRFNNITIDDSELLVFNNRYIF 739

Query: 742  NVXXXXXXXXXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGANNIVQ--GL 799
            NV                  AG+N+  D +  GA SQ  Y+  N ++ I   N +   GL
Sbjct: 740  NVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELNGAVYINDANSISTIGL 799

Query: 800  NFNESIDPYLGLYMNTSHGAYFY--QDDDNTRVYFTNGSQPS---WQWPNDVVAAIYSDN 854
               +    Y   Y+N S  AY Y  ++D    V    G++       W + V   IY+ +
Sbjct: 800  PSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGNRSEDLPVSWSHAVNTMIYNKD 859

Query: 855  QSLLIAGTXXXXXXXXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFS 914
             SLL  GT         L++ N +   +I  E           IV F  N++ ++GG+F+
Sbjct: 860  DSLLAVGTNAGDTNGTSLSLFNISNSKMIGEE-NLGAKSSVNAIVAFNKNSSLLVGGDFT 918

Query: 915  M--PNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITM 972
            +   + +C GLCL+NY  S WS+F + SI+G +  +Q FN ++L++SG   T+N + I +
Sbjct: 919  IDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQLLISGNLYTENETGINL 978

Query: 973  ASLNLKNNKITALKSGES--NTFKSFTVADQKIVAWNNTALSIYEDNVWTVERXXXXXXX 1030
            A LN+ +N++T L+ G +   +F +F     +++  ++  +S Y +  W           
Sbjct: 979  AKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQSDNEISYYTNGEWK-----NLTSE 1033

Query: 1031 XXXDNL----NYVTLASALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLLI 1086
               D+L      + L    SKRD S+  A+LV+G L  ++YG + AM+YDF  W+PY ++
Sbjct: 1034 DFNDSLYMGAQLIPLKQTSSKRDVSNR-ALLVNGDLKHSTYGSVSAMLYDFEDWMPYFIV 1092

Query: 1087 NSE-SDSSINAFIDRDMSSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPNKTHKR 1145
            + E +  + N F+++D+SS   TQ  L                           N++   
Sbjct: 1093 DGENAGRASNIFMNKDLSSLYTTQTILQGSNTSTSTTSSNMPSETSD------KNESSSD 1146

Query: 1146 KIDRGFXXXXXXXXXXXXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEK 1205
            KIDRGF                     I+AY F  + G YEP+ PR+DE +MI+TVPPEK
Sbjct: 1147 KIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQYEPLKPRVDEGDMIDTVPPEK 1206

Query: 1206 LMKYI 1210
            LMK++
Sbjct: 1207 LMKFV 1211

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1205 (35%), Positives = 639/1205 (53%), Gaps = 49/1205 (4%)

Query: 32   IQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNS-----NGLVYY 86
            IQ F  P L F+ N  +S+QLLG  + L  Y Y GQQNF    T D NS     N L+YY
Sbjct: 34   IQEFELPNLNFN-NTSNSIQLLGDVENLQFYHYEGQQNF----TDDGNSGISSTNNLIYY 88

Query: 87   SNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNT 146
            S++ LIQL  G +DT I  I+P+G DSF+LSGSG LN Y+L  QL YNL++LS+ PIF+ 
Sbjct: 89   SDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQ 148

Query: 147  TLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXX 206
             L  + SILVDE++VYFGG FT+   + +  SV  WN+TS+    LPF GFG +S     
Sbjct: 149  DLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSI 208

Query: 207  XXXXXXXXXFAGEFYTLDDXXXXXXXXXXXXXXIYD-------LELSPLLPLNEATWXXX 259
                     F G F TL +                +       ++L   + L  ATW   
Sbjct: 209  LKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNSTENSSTIQLEQQISLKYATWDAG 268

Query: 260  XXXXXXXXXICVNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLIS 319
                     +C    S+AW V G +G L  + P   + +KIRIYN+  +++ +S FR+++
Sbjct: 269  TAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVT 328

Query: 320  DPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDAASVSEMARL-LSDNATVIKW 378
             PS  IMN+TY+DP TG L++CD++CPLL+   L +AS  ++     R+ +++N T + W
Sbjct: 329  SPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTW 388

Query: 379  SAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASC-TSNN 437
            S  YQEF F+N +  + L  +A +SYGS  AL+G  L+QD +  +ANN+LN   C T + 
Sbjct: 389  SESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEST 448

Query: 438  SDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSD 497
            S ++SS LSDN W  G    +Y+   Y     P+P V F  N+   GD+ I +YTPGC  
Sbjct: 449  SLFSSSVLSDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLA 508

Query: 498  DGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGIS 557
            DGTC +R +VNVTV D +D ++LST  IYQNN  +KYDE+F+G L  S  I L + S I 
Sbjct: 509  DGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTIL 568

Query: 558  SDSTGTTVVADRSNI---YVTSLDILGQISSSKNGSTVALNGLFQYQLXXXXXXXXXXXA 614
             D     +VADR ++   Y+   DIL  + S+   +++ LNGLFQYQL            
Sbjct: 569  PDLDSAIIVADRVDLTPTYINVDDIL--LDSNLKSTSLKLNGLFQYQL---SNFTSDTKT 623

Query: 615  KVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTS---DNSG 671
            KVG   ++Q  L  F ++ SL  +T++N + + G+  ++  L+ ++DL    +   DN G
Sbjct: 624  KVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGG 683

Query: 672  VEGQFKNMQPFSEGIFLYGNFNLSGV-TEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNS 730
               + +N   +S+G+  +G +N+S       +++NG+F+ F+Q G+ ++ TF N T+  S
Sbjct: 684  ETTRIEN---YSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGD-NVTTFANFTYEGS 739

Query: 731  EILVFNNAYLYNVXXXXXXXXXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINI 790
            E+L FNN YLYNV                   GAN+N D L  G   +  YS  NE + +
Sbjct: 740  ELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKL 799

Query: 791  GANNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAI 850
              N+ ++ L F+ SI PY  +++N +   Y Y+D +N+++ + N    S  +   +    
Sbjct: 800  YGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTLNKLS 859

Query: 851  YSDNQSLLIAGTXXXXXXXXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIG 910
            +S+N SLL A           L + N +    +A+E           +++F SN T ++ 
Sbjct: 860  FSNNSSLLFANAITNNGSSS-LVISNISDGMSLASE-NLNNYGYITSMIDFNSNNTILVS 917

Query: 911  GNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSI 970
            GNF++ +V+C G+CL+NY    WS+FA+++I G++  MQL+N  ++++SGLFS +N SSI
Sbjct: 918  GNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSI 977

Query: 971  TMASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERXXXXXXX 1030
            T+ASL++K   I+ L         SF    Q I  W+N  +  Y+   W  E        
Sbjct: 978  TLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWN-EISFPNTTS 1036

Query: 1031 XXXDNLNYVTLASALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINS-- 1088
               +++  V++   L    ++ S  +   G+     YG + AM++    W PY  IN+  
Sbjct: 1037 KYIESVEAVSI--DLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQ 1094

Query: 1089 -ESDSSINAFIDRDMSSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPNKTHKR-- 1145
               D +I  F +RD+SS  N++ +L                         + NK   +  
Sbjct: 1095 VNEDPAITLFENRDLSSLFNSKNSL---PANITSAETSSRSTVSSATATTVVNKIEGKHS 1151

Query: 1146 KIDRGFXXXXXXXXXXXXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEK 1205
            KIDRGF                      +AY+FRD+   YE I PRID  EM++TVPPEK
Sbjct: 1152 KIDRGFVVLIALALAVGTVALLGLFGVTIAYIFRDEQ-KYESIKPRIDGQEMLDTVPPEK 1210

Query: 1206 LMKYI 1210
            LMK+I
Sbjct: 1211 LMKFI 1215

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/1186 (34%), Positives = 628/1186 (52%), Gaps = 53/1186 (4%)

Query: 45   NNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLD-DTRI 103
            N ++  Q+L   + +S Y Y GQQNF+      T+   L+YYSN T + L+  +  + +I
Sbjct: 42   NKNNQFQILDDINGISFYEYLGQQNFTTDANV-TDVQRLIYYSNETFMSLSDSIAAEAQI 100

Query: 104  NNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYF 163
              I+P+G DSFILSG G +N  SL +QL +N++ LS+  IF+T L  +E + VD  LVYF
Sbjct: 101  QGIIPLGDDSFILSGQGMINNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYF 160

Query: 164  GGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXXXXXXXFAGEFYTL 223
             GNFTF+N T       +W+    S  LLPF GFG  ++             FAG F T+
Sbjct: 161  MGNFTFNNNT----GAIMWDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTV 216

Query: 224  --DDXXXXXXXXXXXXXXIYDLELSPLLPLNEATWXXXXXXXXXXXXICVNPDSDAWFVS 281
                                 L L+P +PL  + W            IC +P  D+W VS
Sbjct: 217  WNSSLLLQSNVSEESVRNTTSLLLNPSVPLQYSQWKTNGELDSSQL-ICPDPSKDSWSVS 275

Query: 282  GTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHC 341
             TTG   C LP+    +KIRIYNSPD  +Q+S FR ++ P+GSIMN+TY+DP +GN+  C
Sbjct: 276  ATTGDFTCELPFQITPSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSC 335

Query: 342  DSYCPLLSRDTLSSASDAASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLAL 401
            D++CPL S+  L S  D  + +    ++++N+T I+W+  YQEF  V+ V+ T L+F AL
Sbjct: 336  DAFCPLYSKTVLQSQWDNTAEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNAL 395

Query: 402  NSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSD----YTSSTLSDNDWVFGASGQ 457
             SYG+N+ LAG+ +YQ  ++ F NNS N  +C +N+ D    +TSS+LS N+W    S  
Sbjct: 396  ASYGNNLGLAGFQIYQASFSAFGNNSFNTPNCNNNDKDSNNTFTSSSLSPNNW---TSVG 452

Query: 458  TYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDD 517
             Y+T  YT  ++P+P+VT+  ++ +SG+Y IN++TPGCS D TCSTRG+VN T++D   +
Sbjct: 453  EYLTVGYTPNENPVPKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTN 512

Query: 518  SILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSL 577
             +L+T  IYQNN+ +KYD L+SG L +S  I + Y SG+ + +T TT+VADR ++ + S+
Sbjct: 513  KMLATSLIYQNNDEIKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISM 572

Query: 578  DILGQISSSKNGSTVALNGLFQYQLXXXXXXXXXXXAKVGKTFLNQYPLDIFNTNSSLFA 637
            D+  +   SK    +ALNGLFQYQ+            K+  T LNQ+ L+ F  + SL A
Sbjct: 573  DLSHRTEVSK----LALNGLFQYQI--SNFTNDSIPMKIANTSLNQFALNNFEPSVSLRA 626

Query: 638  STYDN-YLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEG-IFLYGNFNLS 695
                N  +L+ G E +++++  + DL+   S        F   QP+S G + L G  N+S
Sbjct: 627  FPLSNSSILLSGTEGNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVS 686

Query: 696  GVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVXXXXXXXXXXXX 755
               +     N + +     G+ + D   N+T    E+LVFNN Y+YNV            
Sbjct: 687  LFKDNFKNLNTTMD-----GSLATDV-ANITLNGDELLVFNNGYIYNVTSQQQTRSNSSI 740

Query: 756  -XXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGA--NNIVQGLNFNESIDPYLGLY 812
                   AGAN+  D +F G   Q  Y+  N+S  + A  N+ ++ ++   +  P  G++
Sbjct: 741  FNLTVSSAGANSINDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIF 800

Query: 813  MNTSHGAYFYQDDDNTRVYFTNGSQPS-WQWPNDVVAAIYSDNQSLLIAGTXXXXXXXXF 871
            +N     YFY++ + +++Y TN +  S  +W  +    +Y  N +LL+ G          
Sbjct: 801  LNDDSTGYFYKESNKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMVGYYNDNTFSST 860

Query: 872  LTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNS 931
            L++ N T++DVI  E           ++ FA N T ++ G+F   N NC  LCL+NY + 
Sbjct: 861  LSLTNLTSFDVIKEE-NLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSG 919

Query: 932  TWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITAL--KSGE 989
             W S A+ S++G+V  +QL+    ++V G  +    + + MA +NL NN + +L  K   
Sbjct: 920  QWDSLANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDA 979

Query: 990  SNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERXXXXXXXXXXDNLNYVTLASALSKRD 1049
                 S  V++ +IVAWN+T L  ++ N WT  R           +++ V   S      
Sbjct: 980  PVNLHSMIVSNSRIVAWNDTVLFSFDGNSWT--RVSVPGTDSSATSISSVQFISM----- 1032

Query: 1050 TSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLL-INSESDSSINAFIDRDMSSFTNT 1108
              + DA+L+ G+   + +G I+++VY+F  W+PYLL ++     + + F++RD+S     
Sbjct: 1033 EGTDDALLLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDGPRQGTGHLFMNRDISLHNIA 1092

Query: 1109 QVALLXXXXXXXXXX-XXXXXXXXXXXXXXIPN------KTHKRKIDRGFXXXXXXXXXX 1161
            Q+ LL                         +P       K  +R +DRGF          
Sbjct: 1093 QIPLLNSTRVLTNQSFASSTSSSVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLIGLALAL 1152

Query: 1162 XXXXXXXXXXXIMAYVFRDDNG-AYEPINPRIDENEMIETVPPEKL 1206
                       ++AY+FRD+ G +Y+ +NPR+DEN M+ T+PPEKL
Sbjct: 1153 ATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/1263 (32%), Positives = 619/1263 (49%), Gaps = 104/1263 (8%)

Query: 32   IQTFAPPALIFSSNNDSSLQLLGS--YDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNN 89
            I+    P      + + SLQLL S  +D L+   Y GQQNF+  I   ++ N L+YYSN+
Sbjct: 35   IENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPII-SSSQNHLIYYSND 93

Query: 90   TLIQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIF-NTTL 148
            T I+L      TRI +I+P G D+FILSG+GSLN + L NQL YNL+ LS+ PIF N  +
Sbjct: 94   TYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTDLSLTPIFENKLV 153

Query: 149  EQVESILVDED--LVYFGGNFTF-SNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXX 205
             +V +I  D D  LVYFGGNF++    ++  + + +W+ +SN T    F GFG NS    
Sbjct: 154  PEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYEFGGFGSNSVINN 213

Query: 206  XXXXXXXXXXFAGEFYTLDDXXXXX----------XXXXXXXXXIYDLELSPLLPLNEAT 255
                      F+G+FYTLDD                        +   EL+  +PL    
Sbjct: 214  ILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTFELNQRIPLTFGK 273

Query: 256  WXXXXXX--XXXXXXICVNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQIS 313
            +              IC   + +AW      G+L  +LP+    +KIRI+NSPD  ++++
Sbjct: 274  FSTADTNDYINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIRIFNSPDPDDEVA 333

Query: 314  EFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSS-ASDAASVSEMARLLSDN 372
             FR+      SIM++ Y+DP  G L++C  +CPL +R+ L    S+    S +  LL +N
Sbjct: 334  TFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDNLKSHVITLLDNN 393

Query: 373  ATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGAS 432
             T IKWS  YQEF FVN    T L+F AL+SYGS V L+G SL+Q + AVFAN S N  S
Sbjct: 394  TTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDIAVFANESYNKPS 453

Query: 433  CTS----NNSDYTS-----------STLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFN 477
            C      +N D              S LSDNDW        Y+   Y      IP VTF 
Sbjct: 454  CNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYLSSSKLIPTVTFY 513

Query: 478  ANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDEL 537
             NL Y+G+Y +++ TPGC+ D +C +RG+VNVT+++++D SIL T  IYQ NE  K+D++
Sbjct: 514  PNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSLIYQTNENYKFDQI 573

Query: 538  FSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSK-NGSTVALNG 596
            F+GYL   V+I + + SG+ S++   T+VADR N+ + SLD +   SS++ +   V LNG
Sbjct: 574  FNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTSSNEIDIYNVTLNG 633

Query: 597  LFQYQLXXXXXXXXXXXAKVGKTFLNQYPLDIFNTNSSLFASTYD-NYLLVGGAEQSVYA 655
            LFQY                  + +NQY    +  N SL A+ YD + LLVGG+   +  
Sbjct: 634  LFQYP---EYNSVNNLNENYTNSTINQYAYSNYPANVSLIAAAYDKDTLLVGGSINKLQE 690

Query: 656  LESSNDLNFSTSDNSGVEGQFKNMQ------PFSEGIFLYGNFNLSGVTEGAVTYNGSFN 709
             +   +       N  ++  FK++       P+S+G+  YG+   S  +  A+T+    N
Sbjct: 691  FQIEKN-----GQNISLQNTFKDLNSVTGIVPYSDGLIAYGDIMDSSGSYKAITFTN--N 743

Query: 710  PFTQYGN--SSIDTFKNVTFGNS-EILVFNNAYLYNVXXXXXXXXXXXXXXXXXXAGANA 766
             F   GN    I +F N++   S EIL FNN Y YN                   AG NA
Sbjct: 744  KFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELSLWSAGKNA 803

Query: 767  NGDLLFNGASSQMSYSFNNESIN------IGANNIVQGLNFNESIDPYLGLYMNTSHGAY 820
              DL+F+G  S+      NE++N      I AN  ++ LN   +I PY  +++N S   Y
Sbjct: 804  QNDLIFSGLVSE------NENVNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDSSTIY 857

Query: 821  FYQDDDNT--RVYFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTXXXXXXXXFLTVLNTT 878
             Y + +    R+  +NG Q SW W N + +  +  N+SLL  GT          ++LN T
Sbjct: 858  AYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSILNLT 917

Query: 879  TYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNSTWSSFAD 938
            +  VIANE           ++ F  N++ ++GGNF+  +  C GLCLFNY    WS+F +
Sbjct: 918  SNKVIANE-TLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMN 976

Query: 939  ASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKSGESNTFKSFTV 998
             ++ GTV  ++L N S +++SG  ST   ++I +A LNL    ++ L   ++    SF  
Sbjct: 977  NTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNVSILL--QNTNLTSFEF 1034

Query: 999  ADQKIVAWNNTALSIYEDNVWTVERXXXXXXXXXXDNLNYVTL-----ASALSKRDTSSS 1053
               +I AWN++ L  Y +  W+             D+++   +     +S L KR    +
Sbjct: 1035 TGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDT 1094

Query: 1054 DAILVSGQLYDNSYGHIQAMVYDFSSWVPY----LLINSESDSSINAFIDRDMSSFTNTQ 1109
            + ++ +GQ Y    G +QA+ Y   +W+PY    L  N ++ +SIN F ++D+SS   + 
Sbjct: 1095 NIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDTSNSINIFPNKDISSKIISD 1154

Query: 1110 VAL------------------LXXXXXXXXXXXXXXXXXXXXXXXXIP----NKTHKRKI 1147
              L                                           IP     +  K KI
Sbjct: 1155 FVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSIIPIIGKQQNKKHKI 1214

Query: 1148 DRGFXXXXXXXXXXXXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLM 1207
             RGF                     +++++FRD  G YE + PR  E+EM + VPPEKLM
Sbjct: 1215 QRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTTEHEMFDAVPPEKLM 1274

Query: 1208 KYI 1210
             ++
Sbjct: 1275 PFV 1277

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1186 (33%), Positives = 595/1186 (50%), Gaps = 46/1186 (3%)

Query: 40   LIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLD 99
            L FSS+ ++ +QLLGS +  + Y Y GQQNF+   +   N   L+YYSNNTL++L+    
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFT-TASSSQNELELIYYSNNTLLRLDAVPT 60

Query: 100  DTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDED 159
            D  + +I+P   D FILSG G+++   L  Q+  NL+ LS  PIF   L  V+SI VD +
Sbjct: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120

Query: 160  LVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXXXXXXXFAGE 219
            +VYFGG+ T++N    G SV  WN T+NS+ LLPF GFG NS+             F G+
Sbjct: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQ 180

Query: 220  FYTLDDXXXXXXXXXXXXXXI--YDLELSPLLPLNEATWXXXXXXXXXXXXICVNPDSDA 277
            F  L++              I   D E+   + L +ATW            IC N D  A
Sbjct: 181  FAKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAF-ICPNSDQQA 239

Query: 278  WFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGN 337
            W+  G+ G + C+ P    L+KIRIYN+P + NQIS FRLI+ P   I+N+TY+DP + +
Sbjct: 240  WYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHD 299

Query: 338  LEHCDSYCPLLSRDTLSSA-SDAASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLL 396
            ++HC   CPL +R+TL +A  +    S++ R +++N+T IKW+  YQEF FVN +  T L
Sbjct: 300  IKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSL 359

Query: 397  QFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASG 456
            QF+A NSY  NV L+G+ +YQD + +F NNS N  +C S+N   +   LS N W   A+ 
Sbjct: 360  QFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVAND 419

Query: 457  QTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESD 516
             +Y+   Y       P +T+   +   G+YV+NL TPGC  D TCSTRG+VNVT +D S+
Sbjct: 420  NSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSN 479

Query: 517  DSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTS 576
             +IL +  IYQNN  LKYD++F+G L NS+ + +EY SGI++++   TVV    ++   S
Sbjct: 480  GNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVDVVRVS 539

Query: 577  LD---ILGQISSSKNGSTVALNGLFQYQLXXXXXXXXXXXAKVGKTFLNQYPLDIFNTNS 633
            +    I  QI   +   ++ LNG+F+Y              K+  T L+ + +  FN  +
Sbjct: 540  ISSEFISDQIDGDR---SLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGA 596

Query: 634  SLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFN 693
            S+FA   +  L +G    SVY L S N  +  +++N+ + G    M    EG+ ++G+  
Sbjct: 597  SIFAVDQNQNLYLGSTNGSVYELNSLNGSSVPSTENN-LSGLINGMYSVEEGLVIFGSIA 655

Query: 694  LSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVXXXXXXXXXX 753
              G   GAV  N S  P     N SI    N T   S +LVF+N+ ++N+          
Sbjct: 656  HRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFENTS 715

Query: 754  XXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGANNIVQGLNFNESIDPYLGLYM 813
                    AG N+N D+L  G       +  NES+ I +N      + +++      +Y+
Sbjct: 716  YRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYL 775

Query: 814  NTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTXXXXXXXXFLT 873
            N +   Y     +      ++  +  W W + VV   YS+ Q LL  G          + 
Sbjct: 776  NDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLL--GAIQENSNKSQIV 833

Query: 874  VLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNSTW 933
            +++  +  VI N+           IVNFASNATA++GG+FS+ N  C GLCL+NY NS W
Sbjct: 834  LIDLFSSQVI-NDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCLYNYNNSNW 892

Query: 934  SSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKSGESNTF 993
            SSF + SI G +  ++ FN++++++SG       + I + S+NL +NK   L    S   
Sbjct: 893  SSFLNNSITGNISQIK-FNDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVL 951

Query: 994  KSFTVADQKIVAWNNTALSIYEDNVWTVERXXXXXXXXXXDNLNYV-----TLASALSKR 1048
              F +    +V WN+T + I     W+              NLN          + +   
Sbjct: 952  DDFILVRNLVVGWNSTDIFIRNVTQWS--------------NLNIFDDGTNATINRIENF 997

Query: 1049 DTSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINSESDSSINAFI-DRDMSSFTN 1107
               S+ A+++ GQ     YG I A++YDF+SW PY  ++  S ++   F  DRD SS+ N
Sbjct: 998  GADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQTATPLFFADRDQSSYGN 1057

Query: 1108 TQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPNKTHKR--KIDRGFXXXXXXXXXXXXXX 1165
            T+  +                           +KT+++  KI RGF              
Sbjct: 1058 TRHVV-------PDHIIVSSSHSSSAPSSSSSHKTNEKPYKIRRGFVVLIGLALALATLI 1110

Query: 1166 XXXXXXXIMAYVFRDD-NGAYEPINPRIDENEMIETVPPEKLMKYI 1210
                   ++A +F    NG Y+ I     +N     + PEKL++ +
Sbjct: 1111 VLGITGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  562 bits (1449), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 391/1217 (32%), Positives = 585/1217 (48%), Gaps = 85/1217 (6%)

Query: 32   IQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTL 91
            I+ +  P L  S+  +  L +   + A   Y Y GQQ F+ Q     +S  L+YYS  T 
Sbjct: 32   IKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQEQHQGSS--LIYYSEGTY 89

Query: 92   IQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQV 151
            +QL +  DDT +  IVP GSDSFILSG+G L +  LE+QL YNLS+L V  I   +LE V
Sbjct: 90   VQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLSTLEVTEILPQSLESV 149

Query: 152  ESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXXX 211
              ILVD D+VYFGG FT+S+G   GHS   WN TS +T LLPF GFG  SS         
Sbjct: 150  NDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGGFGRGSSVNNILKLSG 209

Query: 212  XXXXFAGEFYTLD-----DXXXXXXXXXXXXXXIYDLELSPLLPLNEATWXXXXXXXXXX 266
                F G F  L+     +              +  +E + L  L  +T           
Sbjct: 210  SGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTIETNALTSLRYST-ITSDGHLDKG 268

Query: 267  XXICVNPDSDAWFVSGT-----TGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDP 321
              IC   + D+WFV  +      G L   + +    +KIRIYNS  + N+I  FR+++ P
Sbjct: 269  KFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSP 328

Query: 322  SGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDAASVSEMARLLSDNATVIKWSAE 381
            S SIMNMTYIDP TG L  CD++CPL+ R  L+S +  +  +++ARL++D   +IKW+ +
Sbjct: 329  SQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAESGPADVARLVNDEKVLIKWTPD 388

Query: 382  YQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYT 441
            YQEF F+N +    ++F+AL+SYG+NV L G  L+Q EY  + N++LN  +C        
Sbjct: 389  YQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNSTLNQPNCGEQQLSPF 448

Query: 442  SSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTC 501
            S+T   N W  GA+  +Y++    E +   P V     +P+SG Y +NLYTPGC DDGTC
Sbjct: 449  STTA--NIWHQGATDASYLSANVVESN---PMVNVKPVIPHSGTYTLNLYTPGCEDDGTC 503

Query: 502  STRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDST 561
              RG+VNVT+   S+ + L T  IYQNN  LKYD L++G+L  +  + +E+VS I+S   
Sbjct: 504  DYRGIVNVTLL-ASNGTTLMTRWIYQNNYRLKYDPLYTGHLDPNPTVRMEWVSPINSAVN 562

Query: 562  GTTVVADRSNIYVTSLDILGQISSSKNGSTVALNGLFQYQLXXXXXXXXXXXAKVGKTFL 621
               +VADR +  + SLD L  I   +  S   LNGLFQY                 + ++
Sbjct: 563  RKIMVADRVSAIIDSLDGLDDIRHPREKS---LNGLFQYTPAGSSLDNGI------QKYI 613

Query: 622  NQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESS-----NDLNFSTSDNSGVEGQF 676
            N+ P        SL    YD  L++G       A+ +      ND++ +  D   V G  
Sbjct: 614  NKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVDVTRQD---VPGSL 670

Query: 677  KNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFN 736
              + P+S+G+   G FNLS     A+ Y+G+F  F    NS   +  N+T   SE+L+FN
Sbjct: 671  NGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDL-NSETSSIINMTIDGSELLLFN 729

Query: 737  NAYLYNVXXXXXXXXXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGA--NN 794
            N ++YN                   A AN+N DLLF G+ + + +   + ++ + A  N 
Sbjct: 730  NKFIYNT-STSQMLTSSMFQLSALSAAANSNNDLLFTGSIADIKHGSAHGAVALDAEGNI 788

Query: 795  IVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRVYFTNG---SQPS--WQWPNDVVAA 849
               G         + G+Y+N +  AY Y          T G     P   +   N++   
Sbjct: 789  FTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGNNFNLSNNIATV 848

Query: 850  ---IYSDNQSLLIAGTXXXXXXXXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNAT 906
               IY    + L+  T         L + +  T   +A E           IV F  + T
Sbjct: 849  REMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGERINS-IVLFGEDNT 907

Query: 907  AIIGGNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKN 966
             ++GG+F      C  LCL+N+   +WS+FA   I+G +  +Q  N   LI  G  + ++
Sbjct: 908  LLVGGSFEKD--GCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNRNLIAVGSMTVQS 965

Query: 967  ISSITMASLNLKNNKITALKSGESNTFKSF----TVADQ--KIVAWNNTALSIYEDNVW- 1019
              +I   + +L  +++  ++  E    ++F    T+ D   + VA +   +  Y  + W 
Sbjct: 966  RPNILFLNFDLVRSRV--VEQHEQPNGRAFNSVLTIGDSGDEYVAEDGKQVWHYSGSEWK 1023

Query: 1020 TVERXXXXXXXXXXDNLNYVTLASALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSS 1079
            TV             +L  +    + +KR+   ++ +++ GQ+  + YG I AM Y+F +
Sbjct: 1024 TVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIHGQMNSSEYGEINAMHYNFEN 1083

Query: 1080 WVP-YLLINSESDSSINA-----FIDRDMSSFTNTQVALLXXXXXXXXXXXXXXXXXXXX 1133
            W P Y  I S +    N      F+++D+S  T T + L                     
Sbjct: 1084 WEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPL------------------EVV 1125

Query: 1134 XXXXIPNKTHKRKIDRGFXXXXXXXXXXXXXXXXXXXXXIMAYVFRDDNGAYEPINPRID 1193
                 P    KRK+ +G+                     I+AY F D N AY+P+ PRI+
Sbjct: 1126 VSDSPPTAEPKRKLAKGYVVLIALGLALATIALLGIIGVILAYAFGDHN-AYQPLKPRIN 1184

Query: 1194 ENEMIETVPPEKLMKYI 1210
            E+EM++TVPPEKLMK+I
Sbjct: 1185 EDEMLKTVPPEKLMKFI 1201

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  544 bits (1402), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 369/1199 (30%), Positives = 579/1199 (48%), Gaps = 35/1199 (2%)

Query: 31   GIQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNT 90
            G++ F  P+L  S +N+  +QLLG++  L+ Y YTGQ NF+  I+ +     L+Y+SN T
Sbjct: 31   GVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDNFT-GISDEKARESLIYHSNGT 89

Query: 91   LIQLNQGL---DDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTT 147
            L++L+      +   +++++P+  DSFILSG+G+++   L++Q+ +NLS LS   IFN +
Sbjct: 90   LLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVLDHQVVFNLSDLSYTAIFNQS 149

Query: 148  LEQVESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXX 207
            L  V +I V+ +  YFGG+F F     D H + VW+   N    LPF G G++S+     
Sbjct: 150  LSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVKNEVETLPFGGLGKDSNVNSIL 209

Query: 208  XXXXXXXXFAGEFYTLDDXXXXXXXXXXXXXXIYDLELSPLLPLNEATWXXXXXXXXXXX 267
                    FAG F T+D+                  ELS  +PL  A W           
Sbjct: 210  VLDDNNILFAGNFSTIDEKSALNSTLGINSTSDSAPELSHKIPLKTAKWTSDGSLQKDDL 269

Query: 268  XICVNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMN 327
                N  + AW  +GTTG    S+ +    +K+R++N+     ++S FR+I+ PS  IMN
Sbjct: 270  VCPSNSATSAWLGTGTTGQFELSIAHTIRPSKLRLHNARTLDEEVSLFRVITTPSNGIMN 329

Query: 328  MTYIDPRTGNLEHCDSYCPLLSRDTLSSASDAASVSEMARLLSDNATVIKWSAEYQEFGF 387
            +TY+DP +G L  CD++CPLLS   L++A   A+ ++    L +N T ++WS  YQ+F F
Sbjct: 330  LTYLDPSSGELRTCDAWCPLLSTQNLTAAKSKAASTDQVEFL-NNQTTVQWSESYQDFAF 388

Query: 388  VNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSD 447
            VN V  T + F+AL+SYGS+V + G+ LY+D+++V+AN+S N   C+S  S+Y+ ++LS 
Sbjct: 389  VNSVPVTSITFMALDSYGSSVGVNGFELYEDDFSVYANDSFNVPDCSST-SNYSKASLSA 447

Query: 448  NDWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLV 507
            + W  G+S + YV T   E     P VTF   + YSG Y IN+ TPGC  DG+C +R +V
Sbjct: 448  SQWDQGSSDEDYVYTL-VENSQEAPSVTFYPQIVYSGLYTINVLTPGCLADGSCQSRSVV 506

Query: 508  NVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVA 567
            N +++D ++ ++LS++ IYQNN+  KYD L+SGYL+N V++VLEY   I +      +VA
Sbjct: 507  NASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVA 566

Query: 568  DRSNIYVTSLDILGQISSSKNGSTVALNGLFQYQLXXXXXXXXXXXAKVGKTFLNQYPLD 627
             + ++     D        K G    LNGL  Y L           +    T L QY + 
Sbjct: 567  GQISVNTDEFDSSVFTDKYKTGK---LNGLLHYSLSNSSSYLQNFKSN-NSTDLAQYSVS 622

Query: 628  IFNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIF 687
             F  NS+ F   + NY+++  +   V  LE     +  T     V  +   +  FSEG+ 
Sbjct: 623  NFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLG 682

Query: 688  LYGNFNLSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVXXXX 747
            + G F+  G T+GA  YNGSF       +S++ TF N T   +E++   N Y  N     
Sbjct: 683  VIGTFD--GSTKGAKFYNGSFFDI-PLSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDT 739

Query: 748  XXXXXXXXXXXXXXAGANANGDLLFNGASSQMSYS-FNNESINIGANNIVQGLNFNESID 806
                          AG N  G+ +F G+ ++  Y+  N        +     L  ++   
Sbjct: 740  LFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLNGSFFISSNSQSSSRLRGSQGRI 799

Query: 807  PYLGLYMNTSHGAYFYQDDDNTR------VYFTNGSQP--SWQWPNDVVAAIYSDNQSLL 858
             Y   Y++ S   Y + D  +T       +Y     +   S++W N V + +YS N SLL
Sbjct: 800  WYDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLL 859

Query: 859  IAGTXXXXXXXXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNV 918
              G          L    TT  D    E           ++ F  N + ++GG+F+    
Sbjct: 860  ALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINS--LIFFDQNTSVLVGGDFNESES 917

Query: 919  NCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLK 978
            NC GLCLF+Y    WS F D  ING++  M++FN+S L++ G F   +   + +AS++L 
Sbjct: 918  NCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLT 977

Query: 979  NNKITALKSGESNTFKSFTVADQKI---VAWNNTALSIYEDNVWTVERXXXXXXXXXXDN 1035
            +     L  G + T   F   D K+   VA +   L    +N W                
Sbjct: 978  DGSYNILHQG-TETILDFIFVDGKVDNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGL 1036

Query: 1036 LNYVTLASALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYL----LINSESD 1091
              +       +K+     +++L++G L   +YG I A +YDF+ W+PY       +++  
Sbjct: 1037 SEFPIQQGGQNKKREEEKNSLLITGDLLHKTYGKISAALYDFNDWIPYFSTTPATSTDGL 1096

Query: 1092 SSINAFIDRDMSSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPNKTHKRKIDRGF 1151
                 + ++D+SS  N Q  L                         +  K  K KI RGF
Sbjct: 1097 GQSRIYSNKDISSAFNYQGVLQSSRGGNSSSVPSGTSSPTSSSPSQLGAK--KNKIARGF 1154

Query: 1152 XXXXXXXXXXXXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210
                                  + + F   +  Y+ + PR DE+EMI+TVPPEKLM++I
Sbjct: 1155 VVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  537 bits (1383), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 374/1204 (31%), Positives = 596/1204 (49%), Gaps = 44/1204 (3%)

Query: 31   GIQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNT 90
            G++ +  P L  S + ++ +QLLG++  +++  Y+GQ+NF+ +++ +   N L+YYSN T
Sbjct: 31   GVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGEVSGNP-ENALIYYSNET 89

Query: 91   LIQLNQGLDDTRI---NNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTT 147
             +++    D + +   ++IVP   D+FILSG+GS++ + L  QL +NLSSL    IF   
Sbjct: 90   FLEIYSSSDSSEVFSVDHIVPFKDDAFILSGAGSISGHQLSRQLLFNLSSLEFREIFGQD 149

Query: 148  LEQVESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXX 207
            L QV +I  + D V+FGG+F +       HS+ VW+   +   +LPF GFG+NS+     
Sbjct: 150  LAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEVLPFGGFGKNSTVNSIL 209

Query: 208  XXXXXXXXFAGEFYTLDDXXXXXXXXXXXXXXIYDLELSPLLPLNEATWXXXXXXXXXXX 267
                    FAG F  +D+                  EL   + L  A W           
Sbjct: 210  NLDNSNILFAGNFSAVDNTQQLNNINVSNTSNTSVPELGHQISLQSAAWVSDGTLDKSAI 269

Query: 268  XICVNPDSDAWFVSGTT-GTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIM 326
              C + +S  W  +G+T G     +P ++  +K+R++N+ DS  Q+S FR+++ PS  IM
Sbjct: 270  K-CPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFNARDSDEQVSLFRIVTTPSNGIM 328

Query: 327  NMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDAASVSEMARLLSDNATVIKWSAEYQEFG 386
            N+TY+DP TG L  CD++CPLLS   L+  S  +   +  +   +N T ++WS  +Q+F 
Sbjct: 329  NLTYLDPTTGELASCDAWCPLLSSQNLTDISSKSYPGDQVQYF-ENRTTLQWSESFQDFA 387

Query: 387  FVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLS 446
            FVN V  + L F+AL+SYGS+V LAG  LY+  Y+V+ANN+LN  +C   ++  TS+ L 
Sbjct: 388  FVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTLNAPNCAQGSA--TSNALL 445

Query: 447  DND--WVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTR 504
             N   W  G+S   Y++T   +  +  P V F  ++ Y G Y I++ TPGC +D +C TR
Sbjct: 446  SNSSAWDSGSSEGNYLST-SVQDSETNPFVIFYPSIIYPGVYTIDVLTPGCLEDSSCQTR 504

Query: 505  GLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTT 564
            G++N T+ D  ++++L ++EIYQNN+  K+D L+SG+L + V++ LE+   I+S +    
Sbjct: 505  GIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTLEFDGAINSGTEVPV 564

Query: 565  VVADRSNIYVTSLDILGQISSSKNGSTVALNGLFQYQLXXXXXXXXXXXAKVGKTFLNQY 624
            +VA +  + +   D     S  +N ++  +NGL  Y                  T L  Y
Sbjct: 565  MVASKIVVNIEDFD----QSVFENNTSGFINGLLHYS-TSNTSSFLSELGSYSATDLAHY 619

Query: 625  PLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSE 684
             +     +S++FA+ +++ L++   +  +  L+ +N+L+        +      +  +S 
Sbjct: 620  SVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLSIEEYTFETIGKDISTISEYSG 679

Query: 685  GIFLYGNFNLSGVTEGAVT-YNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNV 743
            G+ + G FN  G +E A   +NG+F   T++ NS++ TF N+T G +E+L+F+   + N 
Sbjct: 680  GLIIVGTFN--GSSEPAARGFNGTFFNLTEF-NSTVRTFSNLTLGQTEMLIFDKNIILNG 736

Query: 744  XXXXXXXXXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGANNIVQGLNFNE 803
                              AG N   D LF G   Q  Y+  N S  I  N+     NF  
Sbjct: 737  TTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEEVSQNFWA 796

Query: 804  --SIDPYLGLYMNTSHGAYFYQDDDNTR----VYFTNGSQPSWQ---WPNDVVAAIYSDN 854
                 PY   +++ S  AY Y + DNT     V   N S  + Q   W   V A   S N
Sbjct: 797  LGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQLSAWSGKVGAMASSKN 856

Query: 855  QSLLIAGTXXXXXXXXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFS 914
             SLL  G          L V N+++ + +A+            I+ FA N + ++GG+F 
Sbjct: 857  DSLLAIGGKDQHTDSQLL-VTNSSSGESLAS-YKWDSEISLNSIIFFARNNSVLVGGSFR 914

Query: 915  MPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMAS 974
            + N  C GLCLFNY +  WS F + SI G ++ M++FN S L+++G F       +++AS
Sbjct: 915  VNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDGVSLAS 974

Query: 975  LNLKNNKITALKSGES--NTFKSFTVADQKIVAWNNTALSIYEDNVWTVERXXXXXXXXX 1032
            + LK++    L  G    N F S   +   +VA+++T+L   E   W  +          
Sbjct: 975  ICLKDSSSEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQ-QISTNFTENSK 1033

Query: 1033 XDNLNYVTLA--SALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLLINSES 1090
               L+   L   +   KRD SSS  +L++G L    +G I A  YD   W P+L  N  +
Sbjct: 1034 FKGLDVFPLKDTTRKQKRD-SSSKVLLITGSLQHAKFGSINAAFYDSGEWTPFLSSNQAT 1092

Query: 1091 DSS----INAFIDRDMSSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPNKTHKRK 1146
             SS     + F++RD+S F + +  L                         +  K  K+K
Sbjct: 1093 SSSDLETSHVFLNRDLSDFLDYKGYLQGTFSSNTSSGTSGTPSPSGSSPSNLQRK--KKK 1150

Query: 1147 IDRGFXXXXXXXXXXXXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKL 1206
            IDRGF                     I +Y F D    Y+   PR DENEMI+TVPPEKL
Sbjct: 1151 IDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSGDGYQLSKPRTDENEMIDTVPPEKL 1210

Query: 1207 MKYI 1210
            M++I
Sbjct: 1211 MRFI 1214

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  536 bits (1382), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 387/1214 (31%), Positives = 585/1214 (48%), Gaps = 68/1214 (5%)

Query: 32   IQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTL 91
            I  +  P L  S+  +S L +   +     YTY GQQ F+     D   N L+YYSNNT 
Sbjct: 32   ITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTG--LADERKNSLIYYSNNTY 89

Query: 92   IQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQV 151
            +QL +  D   I  IVP G DSFILSG G    + LE+QL YNLSS  +  I    LE V
Sbjct: 90   VQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHRLEHQLIYNLSSFEITEILKEPLEHV 149

Query: 152  ESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXXX 211
              IL D ++VYFGG FT+++G   GHSV  W+ T  S+ LLPF GFG+ S          
Sbjct: 150  NDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSLLPFYGFGQGSVVNNIIKLDD 209

Query: 212  XXXXFAGEFYTLDDXXXXXXXXXXXX--XXIYDLELSPLLPLNEATWXXXXXXXXXXXXI 269
                F G+F T+D+                  ++E + L  L  ++             +
Sbjct: 210  SNILFVGKFSTIDNTALLPHRNVSSSFLSNSTNIETNALASLRFSSLVHDGTLNSSAF-V 268

Query: 270  CVNPDSDAWFVSGTT-GTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNM 328
            C    +D+W +  +T G L   +      +KIRIYNS DS NQ++ FR+++ PS SIMNM
Sbjct: 269  CPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNM 328

Query: 329  TYIDPRTGNLEHCDSYCPLLSRDTLSSASDAASVSEMARLLSDNATVIKWSAEYQEFGFV 388
            TY+DP TG L  CD++CPL     LS+ ++ ++ S MA   ++N  ++KW+A YQEF FV
Sbjct: 329  TYVDPITGALAVCDAWCPLQPLSVLSNLAENSTSSVMAAFPNNNNVLVKWTAAYQEFAFV 388

Query: 389  NVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDN 448
            N V    L F+A++S+G NV L G  L+Q EY  + NN+LN  +C S  +   S    D 
Sbjct: 389  NRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDT 448

Query: 449  DWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVN 508
             W  G   Q+Y+ T +T G    P VT   ++PY G Y +NL TPGC  D TC+ RG+VN
Sbjct: 449  VWYQGLPDQSYMATSFTAGK---PSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVN 505

Query: 509  VTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVAD 568
            VT+  ++   +++   IYQNNE LKYD LF GYL +S  +VLE++  I   +    +VAD
Sbjct: 506  VTIRAQNGTHLMNR-WIYQNNENLKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVAD 564

Query: 569  RSNIYVTSLDILGQISSSKNGSTVA--LNGLFQYQLXXXXXXXXXXXAKVGKTFLNQYPL 626
            R    + S++ L      KNG++ +  LNGLFQY               VG T ++QYP+
Sbjct: 565  RVTSIIDSIEDL----EMKNGTSNSNLLNGLFQY--AASNFTNTNLSTLVGSTNIDQYPV 618

Query: 627  DIFNTNSSLFASTYDNYLLVGGAEQSVYAL--ESSNDLNFSTSDNSGV--EGQFKNMQPF 682
                 +SSLF   Y++ L +G       A      +D N    D   +  EG    + P+
Sbjct: 619  RNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWNDIIVDPQLIDTEGPVTGIFPY 678

Query: 683  SEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYN 742
            S G+ L  + N + +   ++++NGS +   +    S+    N+T   SEILVF+N Y+YN
Sbjct: 679  SNGLALTVHSNQTNMAS-SLSFNGSISTIFRSNAPSLSIL-NLTIDGSEILVFDNGYVYN 736

Query: 743  VXXXXXXXXXXXXXXXXXXAGANANGDLLFNGASSQMSYSFNNESINIGANN---IVQGL 799
            V                  AGAN   DL+  G      +   N +I I A++   +  GL
Sbjct: 737  VSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNGAIAIDADSNEVVTSGL 796

Query: 800  NFNESIDPYLGLYMNTSHGAYFYQDD----DNTRVYFTNGSQPSWQWPND--VVAAIYSD 853
               +    Y GL++N S  AY Y           +      +P +   +D  V   +Y  
Sbjct: 797  PSVDDGIIYRGLFINDSSSAYAYYSKSLGSSKGGIVVYGEHEPEYLSTDDSTVNDMLYIK 856

Query: 854  NQSLLIAGTXXXXXXXXFLTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNF 913
            + +LL   T         L + + +  D    +           +V F  N T ++GG F
Sbjct: 857  DSNLLAVVTSGTSQGLASLYIHDLSA-DFAPIKETFEIGEVINTMVLFGRNYTLLVGGTF 915

Query: 914  SMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSITMA 973
            +     C  LCL+NY  + W+ F D +I G +  +Q  + + L+V+GL ++ +   + + 
Sbjct: 916  TRN--GCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLV 973

Query: 974  SLNLKNNK-ITALKSGESNTFKS-FTVAD--QKIVAWNNTALSIYEDNVWTVERXXXXXX 1029
             ++L N + I+ L+   + TF+   TV +   +++A +   +  + D  W          
Sbjct: 974  EIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFVDGQWK----NISPD 1029

Query: 1030 XXXXDNLNYVTLAS-------ALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVP 1082
                  +N +TL S       ++ KRD   ++ ++++G      YG I AM YDF+ W P
Sbjct: 1030 TSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSPDYGDINAMYYDFNGWNP 1089

Query: 1083 Y---LLINSESDSSI---NAFIDRDMSSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXX 1136
            Y   +   S SD  I     F+++D+S  +++Q+ L                        
Sbjct: 1090 YYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYL----------SNDNDNDDTPAASE 1139

Query: 1137 XIPNKTHKRKIDRGFXXXXXXXXXXXXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENE 1196
               ++ H +K+ + F                     + AY+F D N AYEP+ PRI+E E
Sbjct: 1140 PATHEKHTKKLAKIFVVLIALALALATVAVLGVVGVLFAYLFGDHN-AYEPLKPRINEAE 1198

Query: 1197 MIETVPPEKLMKYI 1210
            M++TVPPEKLMK+I
Sbjct: 1199 MLKTVPPEKLMKFI 1212

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  526 bits (1355), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 377/1194 (31%), Positives = 599/1194 (50%), Gaps = 71/1194 (5%)

Query: 50   LQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPI 109
            L  + +++ L++ +YTGQQNF+ Q     N + L+YYSN+T ++L +   +T +  IVP+
Sbjct: 45   LTYMNNFEELTVISYTGQQNFTVQ----ANESSLLYYSNDTFVKLFETSPETTVTMIVPL 100

Query: 110  GSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTF 169
              DSFILSG+G +N  +LE Q+  NL+SL+  PIF + +E V  IL   + V F GNF+ 
Sbjct: 101  FEDSFILSGTGQINGVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSM 160

Query: 170  SNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSXXXXXXXXXXXXXFAGEFYTLDDXXXX 229
            S   + GH   +W++ +N+T L PF GFGENS              FAG F  + +    
Sbjct: 161  SVSNETGHGAVLWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLL 220

Query: 230  XXXXXXXXXXIYDL---ELSPLLPLNEATWXXXXXXXXXXXXICVNPDSDAWFVS-GTTG 285
                        DL   +    +PL  ++             +C +   + W  S     
Sbjct: 221  QEFGNATNSSHEDLTSLQFDQSVPLKLSS--ITGENVQSDILLCPSGGQNGWSASEAVQS 278

Query: 286  TLACSLPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYC 345
            TL   L  +   +K+RIYNS +  ++IS FR+I+ PS  IMN+TY+DP +G L+ CD++C
Sbjct: 279  TLQFDLKNEIHPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWC 338

Query: 346  PLLSRDTLSSASDAASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYG 405
            PLLS + L+  S  ++ +  +  +++N+T +KWS  YQEF FVN +  T+LQF+AL SYG
Sbjct: 339  PLLSIEDLTQISQNSTAAPKSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYG 398

Query: 406  SNVALAGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYT 465
            SN AL    +++ E+ V+ANNS N  +C S  ++Y+ + LS ++W       TY++   T
Sbjct: 399  SNAALHSIEIFETEFMVYANNSYNEPNCES-VTEYSKAELSSDNWYTTDESDTYIS---T 454

Query: 466  EGDDPIPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEI 525
              DD IP VTF+ N+ Y G Y  N+YTPGC  D +CS RG+VNVT+ D S + +L++V I
Sbjct: 455  NIDDNIPYVTFHPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLI 514

Query: 526  YQNNEALKYDELFSGYLKNSVRIVLEYVSGI-SSDSTGTTVVADRSNIYVTSLDILGQIS 584
            YQ N   K+D L++G L ++  I++ +   I  SDS    +V DR  +    +D    IS
Sbjct: 515  YQTNNEDKFDPLYTGSLGSAPEIIVTWDKAIGESDS---VMVVDRLGVITEYID---TIS 568

Query: 585  SSKNGSTVALNGLFQYQLXXXXXXXXXXXAKVGKTFLNQYPLDIFNTNSSLFASTYDNYL 644
             S N +T  LNGLFQY                    L  +PLD     ++L+A++ +N +
Sbjct: 569  ISSNDTTFHLNGLFQYNTANVTASIFSTNDTFNDYALYNFPLD-----ANLYAASLNNDI 623

Query: 645  LVGGAEQSVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAV-T 703
            L+GG    +  +E +++   S+S   G  G    +  +S G+ L G + +   +   + +
Sbjct: 624  LIGGNFNGIAKVELNDEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILS 683

Query: 704  YNG-SFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVXXXXXXXXXXXXXXXXXXA 762
            Y+G +FN F Q  +  ID   N T    E+L+F+NAY++NV                  A
Sbjct: 684  YDGNAFNSFGQL-DEPIDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSA 742

Query: 763  GANANGDLLFNGASSQMSYSFNNESINIGANNIVQGLNFNE---SIDPYLGLYMNTSHGA 819
            G N+  D L  G+  + S    N   ++ ++  V      E    + PY   Y+N +  A
Sbjct: 743  GINSGNDSLLFGSFLKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAA 802

Query: 820  YFYQ----DDDNTRVYFTNGSQPSW----QWPNDVVAAIYSDNQSLLIAGTXXXXXXXXF 871
            Y  Q    D+   RV  TN +  S     QW   + A +Y +  ++L  GT        +
Sbjct: 803  YALQEGSTDNVQHRVLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQY 862

Query: 872  ---LTVLNTTTYDVIANEXXXXXXXXXXGIVNFASNATAIIGGNFSMPNVNCFGLCLFNY 928
                ++LN T Y+ +A             +V+F+SN + ++GG++ +   NC  LCL+NY
Sbjct: 863  DVQFSILNLTGYENVA-RVNFSTNERVNSMVSFSSNNSILVGGSYEID--NCNDLCLYNY 919

Query: 929  GNSTWSSFADASINGTVDHMQLFNESE-LIVSGLFSTKNISSITMASLNLKNNKITALKS 987
                W+SF + SI G +  MQ  +E + L+V GL  T N S+I + S+ + +N  + +KS
Sbjct: 920  QTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKS 979

Query: 988  GESNTFKSFTVADQK---IVAWNNTALSIYEDNVWTVERXXXXXXXXXXDNL--NYVTLA 1042
            G +    SF   D     I+A  N+ +   E   W+             D++   +  L+
Sbjct: 980  G-TEPLLSFVPIDDSTDNIIAQMNSEILRLESGTWS-----SFGPQLNNDSIVSGFKVLS 1033

Query: 1043 SALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSS--WVPYLLIN----SESDSSINA 1096
               SK+    S  +L+ G L  + +G++ ++VYD S+  W PY +I+     ES  S + 
Sbjct: 1034 GTESKKRDEGSHIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSF 1093

Query: 1097 FIDRDMSSFTNTQVALLXXXXXXXXXXXXXXXXXXXXXXXXIPNKTHKRKIDRGFXXXXX 1156
            F + +    +++Q  L                           + T  +KIDRGF     
Sbjct: 1094 FQNVNDLYLSSSQTVL------QSNNSDTSASSTPTPSTTSSSHSTKDKKIDRGFIVLIG 1147

Query: 1157 XXXXXXXXXXXXXXXXIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210
                            ++ Y F ++NG YE + PRI+++EM++TVPPEKLMK+I
Sbjct: 1148 LALALATVAVIGLIGALICYFFINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200

>Ecym_2720 Chr2 (1392398..1394434) [2037 bp, 678 aa] {ON} similar to
           Ashbya gossypii AEL027W
          Length = 678

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 3/71 (4%)

Query: 386 GFVNVVSTTLLQFLALNSYGSNV-ALAGYSLYQD-EYAVFANNSLNGASCTSNNSDYTSS 443
           G + VV   +L  L +    + V +  G+S YQD  Y VF   S +G  C+S +++Y + 
Sbjct: 11  GLIWVVQVIVLGILVICCITAPVISRLGFSKYQDVTYGVFGYCSRDGKECSSASANYHAE 70

Query: 444 TLSDN-DWVFG 453
            LSDN DW FG
Sbjct: 71  RLSDNGDWRFG 81

>KLLA0E00287g Chr5 (15302..16837) [1536 bp, 511 aa] {ON} weakly
           similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011W HXT2 High-affinity glucose transporter of the
           major facilitator superfamily
          Length = 511

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 7/93 (7%)

Query: 490 LYTPGCSDDGTCSTRGLVNVTVYDESD----DSILSTVEIYQNNEALKYDELFSGYLKNS 545
           L   G  ++   S   L N T+Y+       +SI+S+VE  +  E  KY ELF+G   N 
Sbjct: 240 LILKGKKEEAMRSLVRLRNGTIYESEIINEYESIISSVEA-EKQEKSKYTELFTG--TNK 296

Query: 546 VRIVLEYVSGISSDSTGTTVVADRSNIYVTSLD 578
            R ++  ++ I    TG    +    I++ SL+
Sbjct: 297 RRTLIVILANIFQQVTGQAFASQYGTIFIKSLN 329

>KLLA0F08459g Chr6 complement(787966..790479) [2514 bp, 837 aa] {ON}
           similar to uniprot|P12945 Saccharomyces cerevisiae
           YDL040C NAT1 Subunit of the N-terminal acetyltransferase
           NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
           proteins which influences multiple processes such as the
           cell cycle heat-shock resistance mating sporulation and
           telomeric silencing
          Length = 837

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 54/116 (46%), Gaps = 12/116 (10%)

Query: 482 YSGDYVINLYTPGCSDDGTCSTRGLVN-VTVYDESDDSILSTVEIYQNNEALKY--DELF 538
           Y G Y  N  +   + D    T+  +N ++ ++E  +  L   E+Y+NNE + Y  D L+
Sbjct: 156 YRG-YRANWTSLAIAQDLNGRTQDAINTLSTFEELAEGKLGEPEMYENNECIMYKNDLLY 214

Query: 539 --SGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTV 592
             +G  K S+  VLE++  IS D      V DR         IL ++  SK  S V
Sbjct: 215 KKAGNDKESLERVLEHLEKISDD------VYDRYGWLERKASILMKLGRSKEASIV 264

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 40/92 (43%), Gaps = 15/92 (16%)

Query: 50  LQLLGSYDALSLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLD-----DTRIN 104
           ++L+ S   L LY YTGQ +   Q  P+  +   V+     L+Q+ + L+     D    
Sbjct: 846 IKLIFSKSLLKLYDYTGQPDPIKQTEPNRRNKATVFKLRAILVQITEFLNNNWNKDVPKR 905

Query: 105 NIVPIGSDSFI----------LSGSGSLNEYS 126
           N   +G DS +          LS  GSL + S
Sbjct: 906 NSNQVGGDSVLICQLCEDIRSLSKKGSLQKVS 937

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 121,529,723
Number of extensions: 5440134
Number of successful extensions: 13572
Number of sequences better than 10.0: 57
Number of HSP's gapped: 13710
Number of HSP's successfully gapped: 67
Length of query: 1210
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1089
Effective length of database: 39,606,813
Effective search space: 43131819357
Effective search space used: 43131819357
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)