Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B026808.254ON66466430520.0
NDAI0B023708.254ON72265325230.0
NCAS0B049708.254ON66665225010.0
Smik_12.1428.254ON66364924750.0
Suva_10.1678.254ON68467124340.0
YLR083C (EMP70)8.254ON66764924180.0
KNAG0G019908.254ON66765124050.0
Skud_12.1518.254ON66465023710.0
YDR107C (TMN2)8.254ON67265723590.0
Suva_2.2678.254ON67265723190.0
Skud_4.3688.254ON67265722690.0
Smik_4.3538.254ON69065722600.0
ZYRO0C01848g8.254ON64765022160.0
Kpol_543.358.254ON65865222050.0
TBLA0E043708.254ON67666021620.0
CAGL0B01683g8.254ON69169121520.0
KLLA0F18931g8.254ON66564921440.0
SAKL0H17248g8.254ON66064821220.0
KLTH0G13882g8.254ON68767121000.0
NCAS0B038908.254ON66365220930.0
Kwal_56.235778.254ON68366720690.0
TPHA0A018408.254ON68567420310.0
TBLA0H014508.254ON67365419720.0
TDEL0F038108.254ON65665018700.0
AGR097W8.254ON65365118450.0
NDAI0J014208.254ON61962218280.0
Ecym_43178.254ON60565014490.0
YER113C (TMN3)7.411ON7067073242e-30
NCAS0A145207.411ON6706353213e-30
KNAG0C034307.411ON6807043162e-29
NDAI0A015107.411ON6796913125e-29
Smik_5.2587.411ON7067103082e-28
Skud_5.2667.411ON7076562957e-27
Suva_5.2347.411ON7067222949e-27
TDEL0C027107.411ON6786912921e-26
ZYRO0B03784g7.411ON6586272804e-25
KLLA0E20835g7.411ON6766332672e-23
SAKL0F12914g7.411ON7076752573e-22
CAGL0G03487g7.411ON7046572404e-20
KLTH0C06226g7.411ON6947212102e-16
Kwal_27.107467.411ON6902261922e-14
KAFR0K019507.411ON6642751644e-11
Kpol_1045.287.411ON6815641404e-08
TPHA0K007307.411ON7335001404e-08
TBLA0I003307.411ON7132461387e-08
AGL295C7.411ON6572711333e-07
Ecym_71437.411ON6762271324e-07
NDAI0J025704.296ON2002120810.45
Skud_13.4665.35ON13885685.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B02680
         (664 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...  1180   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   976   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   967   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   957   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   942   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   936   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   931   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   917   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   913   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   897   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   878   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   875   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   858   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   853   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   837   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   833   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   830   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   822   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   813   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    810   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   801   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   786   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   764   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   724   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   715   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   708   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   562   0.0  
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   129   2e-30
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   128   3e-30
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...   126   2e-29
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   124   5e-29
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   123   2e-28
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   118   7e-27
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   117   9e-27
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   117   1e-26
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   112   4e-25
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   107   2e-23
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   103   3e-22
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...    97   4e-20
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    86   2e-16
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    79   2e-14
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    68   4e-11
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    59   4e-08
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    59   4e-08
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    58   7e-08
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    56   3e-07
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    55   4e-07
NDAI0J02570 Chr10 complement(632112..638120) [6009 bp, 2002 aa] ...    36   0.45 
Skud_13.466 Chr13 (828310..828331,828415..828809) [417 bp, 138 a...    31   5.5  

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score = 1180 bits (3052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/664 (87%), Positives = 582/664 (87%)

Query: 1   MTRXXXXXXXXXXXTRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXX 60
           MTR           TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDV   
Sbjct: 1   MTRLLLLISLFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSD 60

Query: 61  XXXXXXXXXXXXXRFHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKS 120
                        RFHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKS
Sbjct: 61  KNKYLYSYDYYYDRFHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKS 120

Query: 121 TIPGNDAKFINKLIKNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDE 180
           TIPGNDAKFINKLIKNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDE
Sbjct: 121 TIPGNDAKFINKLIKNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDE 180

Query: 181 TEARTKVAAANQGAELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIV 240
           TEARTKVAAANQGAELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIV
Sbjct: 181 TEARTKVAAANQGAELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIV 240

Query: 241 NPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTI 300
           NPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTI
Sbjct: 241 NPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTI 300

Query: 301 QWFSLVNFXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIP 360
           QWFSLVNF                KALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIP
Sbjct: 301 QWFSLVNFSLIVLLLSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIP 360

Query: 361 HKSMXXXXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSM 420
           HKSM          QLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSM
Sbjct: 361 HKSMLLSVLVGSGVQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSM 420

Query: 421 GVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFV 480
           GVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFV
Sbjct: 421 GVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFV 480

Query: 481 FSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVE 540
           FSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVE
Sbjct: 481 FSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVE 540

Query: 541 IYFIYTSLWYNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGV 600
           IYFIYTSLWYNKIFYMFG                   ITYHSLCLENWNWQWRSFIVGGV
Sbjct: 541 IYFIYTSLWYNKIFYMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGV 600

Query: 601 GCAIYVFIHSILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSS 660
           GCAIYVFIHSILFTKFKLGGFTTVVLYLGY          VTGSIGFLSSMFFVRKIFSS
Sbjct: 601 GCAIYVFIHSILFTKFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSS 660

Query: 661 IKVD 664
           IKVD
Sbjct: 661 IKVD 664

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  976 bits (2523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/653 (71%), Positives = 522/653 (79%), Gaps = 3/653 (0%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
           TRAFYLPGVAPTTYH  DEIPLLVNHL+PSMY+QHKN++GK +                R
Sbjct: 70  TRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERFLYSYDYYYDR 129

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           FHFCQPE IEKQPESLGSI+FGDRIYNSPFQ+NML++K C SLCK+TIPG DAKFINKLI
Sbjct: 130 FHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPGKDAKFINKLI 189

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAV---DETEARTKVAAAN 191
           KNGFFQNWLIDGLPAA + +D+RT T+FYG+GFELG VDVVQ     D      K    N
Sbjct: 190 KNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGTTTGDNANTVAKKPTTN 249

Query: 192 QGAELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPG 251
           +G ELD RDAKNV+ +KN EL YF NH+DI++EYHDRG  +YRVVGVIVNPVSI+RS+PG
Sbjct: 250 EGLELDTRDAKNVQMLKNFELPYFANHFDIQVEYHDRGENNYRVVGVIVNPVSIKRSTPG 309

Query: 252 SCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXX 311
           +CE++G PL L ED+DNDVYFTYSV F+PSET WATRWDKYLH+YDP IQWFSL+NF   
Sbjct: 310 TCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHIYDPAIQWFSLINFSVV 369

Query: 312 XXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXX 371
                        KALK+DFARYNE NLDD+FQE+AGWKL HGDVFRIPH+S+       
Sbjct: 370 VLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGDVFRIPHRSLLLSVLVG 429

Query: 372 XXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYW 431
              QLF+MI  +IFFAALGFLSPSSRG L TVMF+LYALFGFVGSYTSMGVYKFF GPYW
Sbjct: 430 SGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGVYKFFGGPYW 489

Query: 432 KANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSL 491
           K NM+LTPILVPG IF  I+A+N FL++VHSSGVIPA TLFFM+LLWFVFSIP A AGSL
Sbjct: 490 KVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMILLWFVFSIPLALAGSL 549

Query: 492 VANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYN 551
           +A+KKCNW+EHPTKT QIARQIPFQPWYLKT PAT IAGIFPFGSIAVE+YFIY+SLW+N
Sbjct: 550 IAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFGSIAVELYFIYSSLWFN 609

Query: 552 KIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSI 611
           KIFYMFG                   ITYHSLCLENW WQWR FI+GGVGCAIYVFIHSI
Sbjct: 610 KIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGFIIGGVGCAIYVFIHSI 669

Query: 612 LFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           LFTKFKLGGFTT+VLY+GY          VTG+IGFLSSMFF+RKI+SSIKV+
Sbjct: 670 LFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIRKIYSSIKVE 722

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  967 bits (2501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/652 (70%), Positives = 520/652 (79%), Gaps = 4/652 (0%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
           TRAFYLPGVAPTTYHEGDEIPLLVNHL+PS+Y+Q  +  GK                  R
Sbjct: 17  TRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKEHFLYSFDYYFDR 74

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
            HFC+PE IEKQPESLGSI+FGDRIYNSPF+L MLEEK C SLCKSTIPG DAKFINKLI
Sbjct: 75  LHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLI 134

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVD-ETEARTK-VAAANQ 192
           KNGFFQNWLIDGLPAA + +D +T ++FYG+GFELG V+  QA+D +  A TK     N+
Sbjct: 135 KNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNE 194

Query: 193 GAELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGS 252
           G EL+ R+AKNV+ +KN+E+ YFVNHYDI++EYHDRG G YRVVGVIVNPVSI+RS+PG+
Sbjct: 195 GLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGT 254

Query: 253 CESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXX 312
           CE+TG PL L ED DNDVYFTYSV FVPSET WATRWDKYLH YDPTIQWFSLVNF    
Sbjct: 255 CETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFSLVNFSIIV 314

Query: 313 XXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXX 372
                       KALK+DFARYNEFNL+D+FQEDAGWKL HGDVFRIPHKSM        
Sbjct: 315 LLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMLLSVLVGS 374

Query: 373 XXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWK 432
             QLF+MIS +IFFAALGFLSPSSRG L TVMF+LYALFGFVGSYTSM VYKFF+GPYWK
Sbjct: 375 GVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWK 434

Query: 433 ANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLV 492
            NM+LTP ++PG IF+TI+ +NFFLM+ HSSGV+PA TLFFM+LLWF+FSIP AFAGSL+
Sbjct: 435 VNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLI 494

Query: 493 ANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNK 552
           A+KKC W+EHPTKT QIARQIPFQPWYLKT PAT IAGIFPFGSIAVE+YFIYTSLW+NK
Sbjct: 495 AHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNK 554

Query: 553 IFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSIL 612
           IFYMFG                   ITYHSLCLENW WQWR FIVGGVGCAIYVF+HSIL
Sbjct: 555 IFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSIL 614

Query: 613 FTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           FTKFKLGGF T+VLY+GY          VTG+IGFLSS+ FVRKI+S+IKVD
Sbjct: 615 FTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/649 (70%), Positives = 508/649 (78%), Gaps = 2/649 (0%)

Query: 16  RAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRF 75
           +AFYLPGVAPTTY E DEIPLLVNHL+PSMY+QHK++EG +V                RF
Sbjct: 17  KAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRF 76

Query: 76  HFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIK 135
           HFC+PEK+EKQPESLGSI+FGDRIYNSPFQL MLEEK+C SLCK TIPGNDAKFINKLIK
Sbjct: 77  HFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIK 136

Query: 136 NGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAE 195
           NGFFQNWLIDGLPAA    D RT T FYG+GFELG V+V Q              NQG E
Sbjct: 137 NGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVE 196

Query: 196 LDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCES 255
           LD RD  N+  ++  E  YF NHYDIRIEYHDRG G+YRVVGVIVNPVSI+RS P +CE+
Sbjct: 197 LDTRDGHNM--VQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCET 254

Query: 256 TGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXXXXX 315
            G PL L E+ DN+VYFTYSV FV SETSWATRWDKYLHVYDP+IQWFSL+NF       
Sbjct: 255 DGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFSLVVVLL 314

Query: 316 XXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXXXXQ 375
                    +ALK+DFARYNE NLDD+FQED+GWKL HGDVFR P +S+          Q
Sbjct: 315 SSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSGVQ 374

Query: 376 LFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANM 435
           LF M++ +IFFAALGFLSPSSRG L TVMFMLYALFGFVGSYTSMG+YKFF GPYWKAN+
Sbjct: 375 LFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKANL 434

Query: 436 VLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANK 495
           +LTP+LVPG+I I IIA+NFFLM+VHSSGVIPA TLFFMV LWF+FSIP +FAGSLVA K
Sbjct: 435 ILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARK 494

Query: 496 KCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIFY 555
           KC+W+EHPTKT QIARQIPFQPWYLKT+PAT IAG+FPFGSIAVE+YFIYTSLW+NKIFY
Sbjct: 495 KCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKIFY 554

Query: 556 MFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFTK 615
           MFG                   ITYHSLCLENW WQWR FIVGG GCA+YVFIHSILFTK
Sbjct: 555 MFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILFTK 614

Query: 616 FKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           FKLGGFTT+VLY+GY          VTGSIGF+SSMFF+RKI+SSIKVD
Sbjct: 615 FKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  942 bits (2434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/671 (67%), Positives = 520/671 (77%), Gaps = 23/671 (3%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
            RAFYLPGVAPTTY E DEIPLLVNHL+PSMY+QH++++G +V                +
Sbjct: 16  ARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDK 75

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           FHFC+PE +EKQPESLGSI+FGDRIYNSPF+LNML+EK+C SLCK+ IPG+DAKFINKLI
Sbjct: 76  FHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLI 135

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAA----- 189
           KNGFFQNWLIDGLPAA E HD RT TDFYG+GF LG V+V Q VD    + +VA+     
Sbjct: 136 KNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQ 195

Query: 190 ---------------ANQGAELDARD-AKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDY 233
                          +N+G ELDARD  KN+  +K  E  YF NH+DI+IEYHDRG G+Y
Sbjct: 196 TQAADGKTEPEKGKSSNEGMELDARDQGKNM--VKTREFPYFANHFDIKIEYHDRGEGNY 253

Query: 234 RVVGVIVNPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYL 293
           RVVGVIVNP+SI+RSSPG+CE+ G PL L E  DN+VYFTYSV F  S TSWATRWDKYL
Sbjct: 254 RVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWDKYL 313

Query: 294 HVYDPTIQWFSLVNFXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCH 353
           HVYDP+IQWFSL+NF                +ALK+DFARYNE NLDD+FQED+GWKL H
Sbjct: 314 HVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNH 373

Query: 354 GDVFRIPHKSMXXXXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGF 413
           GDVFR P +S+          Q+F+M++ +IFFAALGFLSPSSRG L TVMF+LYALFGF
Sbjct: 374 GDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGF 433

Query: 414 VGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFF 473
           VGSYTSMG+YKFF GPYWKAN+++TP+L+PG+I + IIA+NFFLM+VHSSGVIPA TLFF
Sbjct: 434 VGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLFF 493

Query: 474 MVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFP 533
           MV LWF+FSIP +FAGSLVA KKC+W+EHPTKT QIARQIPFQPWYLKT+PAT IAGIFP
Sbjct: 494 MVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAGIFP 553

Query: 534 FGSIAVEIYFIYTSLWYNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWR 593
           FGSIAVE+YFIYTSLW+NKIFYMFG                   ITYHSLCLENW WQWR
Sbjct: 554 FGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLCLENWKWQWR 613

Query: 594 SFIVGGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFF 653
            F VGGVGCA+YVFIHSILFTKFKLGGFTT+VLYLGY          VTGSIGF+SSMFF
Sbjct: 614 GFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFF 673

Query: 654 VRKIFSSIKVD 664
           +RKI+SSIKVD
Sbjct: 674 IRKIYSSIKVD 684

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  936 bits (2418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/649 (68%), Positives = 507/649 (78%), Gaps = 2/649 (0%)

Query: 16  RAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRF 75
           +AFYLPGVAPTTY E D IPLLVNHL+PSM +QHK+++G +V                RF
Sbjct: 21  KAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFLYSYDYYYNRF 80

Query: 76  HFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIK 135
           HFCQPEK+EKQPESLGS++FGDRIYNSPFQLNML+EK+C SLCK+ IPG+DAKFINKLIK
Sbjct: 81  HFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGDDAKFINKLIK 140

Query: 136 NGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAE 195
           NGFFQNWLIDGLPAA E +D RT T FYG+GF LG V V Q  D           ++  E
Sbjct: 141 NGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTDIEATPKGAETTDKDVE 200

Query: 196 LDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCES 255
           L+ R+ +N+  +K  EL YF NH+DI IEYHDRG G+YRVVGVIV PVSI+RSSPG+CE+
Sbjct: 201 LETRNDRNM--VKTYELPYFANHFDIMIEYHDRGEGNYRVVGVIVEPVSIKRSSPGTCET 258

Query: 256 TGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXXXXX 315
           TG PL L E  DN+VYFTYSV F  S TSWATRWDKYLHVYDP+IQWFSL+NF       
Sbjct: 259 TGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLL 318

Query: 316 XXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXXXXQ 375
                    +ALK+DFARYNE NLDD+FQED+GWKL HGDVFR P +S+          Q
Sbjct: 319 SSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSGVQ 378

Query: 376 LFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANM 435
           LF+M++ +IFFAALGFLSPSSRG L TVMF+LYALFGFVGSYTSMG+YKFF GPYWKAN+
Sbjct: 379 LFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANL 438

Query: 436 VLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANK 495
           +LTP+LVPG+I + IIA+NFFLM+VHSSGVIPA TLFFMV LWF+FSIP +FAGSL+A K
Sbjct: 439 ILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLIARK 498

Query: 496 KCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIFY 555
           +C+W+EHPTKT QIARQIPFQPWYLKTIPAT IAGIFPFGSIAVE+YFIYTSLW+NKIFY
Sbjct: 499 RCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFY 558

Query: 556 MFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFTK 615
           MFG                   ITYHSLCLENW WQWR FI+GG GCA+YVFIHSILFTK
Sbjct: 559 MFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGGAGCALYVFIHSILFTK 618

Query: 616 FKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           FKLGGFTT+VLY+GY          VTGSIGF+SSM FVRKI+SSIKVD
Sbjct: 619 FKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSIKVD 667

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  931 bits (2405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/651 (68%), Positives = 511/651 (78%), Gaps = 3/651 (0%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
             AFYLPGVAPTTY   DEIPLLVNHLSPSMYWQH+ ++G+++                R
Sbjct: 19  VNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYSYDYYYDR 78

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           FHFCQPEKI K+PESLGSI+FGDRIYNSP+Q+ MLEEK C  LC + IPG DA+FINKLI
Sbjct: 79  FHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLI 138

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQG- 193
           KNGFFQNWLIDGLPAA   HD  T +DFYG+GFELG V+VVQAV   +A+T     + G 
Sbjct: 139 KNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAV--AQAKTHPKEDDSGS 196

Query: 194 AELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSC 253
           A+L  RDAKNV+ +KNVEL YF NH+DI +EYHDRG G+ RVVGV V+P+SI+RSSPG+C
Sbjct: 197 AKLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTC 256

Query: 254 ESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXXX 313
           +++G PL L E  DN+VYFTYSV FV S+T WATRWDKYLH YDPTIQWFSLVNF     
Sbjct: 257 QTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWFSLVNFSIVVV 316

Query: 314 XXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXXX 373
                      KAL++DFARYNE NLD+EFQED+GWKL HGDVFRIP KSM         
Sbjct: 317 LLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSG 376

Query: 374 XQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKA 433
            QLF+MIS +IFFAALGFLSPSSRG LGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKA
Sbjct: 377 IQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKA 436

Query: 434 NMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVA 493
           NM+LTP+LVPG + ++I+ +N FL+  HSSG IPAKTLFF+VLLWFV S+PSA AGSL+A
Sbjct: 437 NMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIA 496

Query: 494 NKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKI 553
           +KKC+W+EHPTKT Q+ARQ+PFQPWYLKT+ ATFIAGIFPFGSIAVE+YFIYTSLWYNKI
Sbjct: 497 HKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKI 556

Query: 554 FYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILF 613
           FYMFG                   ITYHSL LENW WQWRSFIVGGVGCAIY+F+HSILF
Sbjct: 557 FYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILF 616

Query: 614 TKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           TK KLGGF T+VLY+GY          VTGSIGFLSSMFFVR+I+SSIKV+
Sbjct: 617 TKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/650 (67%), Positives = 504/650 (77%), Gaps = 1/650 (0%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
           T+AFYLPGVAPTTY E DEIPLLVNHL+PSMY+QH++++G  V                R
Sbjct: 16  TKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDR 75

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           FHFC+P+ +EKQPESLGS++FGDRIYNSPF+LNML+EK+C  LC +TIPGNDAKFINKLI
Sbjct: 76  FHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLI 135

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194
           KNGFFQNWLIDGLPAA E +D RT T+FYG+GFELG V+V Q      A  +    N+G 
Sbjct: 136 KNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGL 195

Query: 195 ELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCE 254
           EL  R A++   ++  E  YF NH+DI IEYHDRG GDYRVVGVIVNP+SI+RS  G+CE
Sbjct: 196 ELGTR-AEDYSIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGVIVNPLSIKRSITGTCE 254

Query: 255 STGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXXXX 314
           +   PL L E+ DN+V FTYSV F  S TSWATRWDKYLHVYDP+IQWFSL+NF      
Sbjct: 255 TDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWFSLINFSLVVVL 314

Query: 315 XXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXXXX 374
                     +ALK+DFARYNE NL+D+FQED+GWKL HGDVFR P  S+          
Sbjct: 315 LSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPSHSLLLSILVGSGV 374

Query: 375 QLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN 434
           QLF+M++ +IFFAALGFLSPSSRG L TVMF+LYALFGFVGSYTSMG+YKFF GPYWKAN
Sbjct: 375 QLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKAN 434

Query: 435 MVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVAN 494
           ++LTP+LVPG+I + I+A+NFFLM VHSSGVIPA+TLFFMV LWF+FSIP +F GSL+A 
Sbjct: 435 LLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIAR 494

Query: 495 KKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIF 554
           KKC W+EHPTKT QIARQIPFQPWYLKTIPAT IAGIFPFGSIAVE+YFIYTSLW+NKIF
Sbjct: 495 KKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIF 554

Query: 555 YMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFT 614
           YMFG                   ITYHSLCLENW WQWR FIVGGVGCA+YVFIHSILFT
Sbjct: 555 YMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILFT 614

Query: 615 KFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           KFKLGGF T+VLY+GY          VTGSIGF+SSMFF+R+I+SSIKVD
Sbjct: 615 KFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/657 (65%), Positives = 511/657 (77%), Gaps = 7/657 (1%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
           T+ F LPG++PTTYH GDEIPLLVN L+PS+Y+QH+++EG DV                R
Sbjct: 16  TKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKR 75

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           FHFC+PE +EKQPESLGS++FGDRIYNSPFQLNMLEEK+C +LCKSTIPG DAKFIN LI
Sbjct: 76  FHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLI 135

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVD-----ETEARTKVAA 189
           K+GFFQNWL+DGLPAA +A+D+RT T++YG+GFELG  DV Q VD      T       A
Sbjct: 136 KSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEA 195

Query: 190 ANQGAELDARDAKNVK--TIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR 247
           +N+   LDAR  KNVK   +K VEL YFVNH+DI +E+HDRGN +YRVVGVIVNPVSI+R
Sbjct: 196 SNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIER 255

Query: 248 SSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVN 307
           SSPG+C +TG+PL L ED+DN+VYFTYSV FV S+T WATRWDKYLH+YDP IQWFSL+N
Sbjct: 256 SSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLIN 315

Query: 308 FXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXX 367
           F                +ALK+D ARYNE NLD+EF ED+GWKL HGDVFR P KSM   
Sbjct: 316 FSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLS 375

Query: 368 XXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFR 427
                  QLF+M+  +IFFAA+G +SP SRG L TVMF+LYALFGFVGSY SMGVYKFFR
Sbjct: 376 ILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFFR 435

Query: 428 GPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAF 487
           GPYWKANM+LTPIL+PG+IF+ I+ MNFFL++ HSSGVIPA++LFF++LLWF+ S+P +F
Sbjct: 436 GPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSF 495

Query: 488 AGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTS 547
           AGS+VA+K+CNW+EHPTKT QIARQIP+QPWYL+T  AT IAGIF FGSIAVE+YFIY+S
Sbjct: 496 AGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSS 555

Query: 548 LWYNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVF 607
           LW+NKIFYMFG                   ITY+SLCLENW WQWRSFI+GG+GC+IY F
Sbjct: 556 LWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFIIGGLGCSIYTF 615

Query: 608 IHSILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           IHSILFTKFKLGG  TVVLYLGY          VTG+IGF SSMFF+RKI+S+IKV+
Sbjct: 616 IHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/657 (64%), Positives = 507/657 (77%), Gaps = 7/657 (1%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
            +AF LPGV+PTTY   DEIPLLVN L+PS+Y+QHK++ GKDV                +
Sbjct: 16  AKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDK 75

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           FHFC+PE +EKQPESLGS++FGDRIYNSPFQL MLE+K+C +LCKSTIPG DAKFIN LI
Sbjct: 76  FHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLI 135

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVD-----ETEARTKVAA 189
           KNGFFQNWL+DGLPAA   +D+RT T++YG+GFELG  DV Q V       T        
Sbjct: 136 KNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSED 195

Query: 190 ANQGAELDARDAKNVK--TIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR 247
           +  GA LDARD KN+K   ++ +EL +FVNH++I++EYHDRGNG+YRVVGV VNP+SI+R
Sbjct: 196 SKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSIER 255

Query: 248 SSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVN 307
           SSPG+C +TG+PLTL ED+DNDVYFTYSV F+ S+T WATRWDKYLHVYDP IQWFSL+N
Sbjct: 256 SSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFSLIN 315

Query: 308 FXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXX 367
           F                +A+++DFARYNE NLD+EF EDAGWKL HGDVFRIP KSM   
Sbjct: 316 FSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSMVLS 375

Query: 368 XXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFR 427
                  QLF+MI  +IFFAALG +SP+SRG L TVMF+LYALFGFVGSYTSMGVYKFF 
Sbjct: 376 VLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGVYKFFH 435

Query: 428 GPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAF 487
           GPYWKAN+++TPIL+PG+IF+ I+AMNFFL++ HSSGVIPA+TLFF++ LWF  SIP +F
Sbjct: 436 GPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSF 495

Query: 488 AGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTS 547
           AGS +A+K+C W+EHPTKT QIARQ P QPWYL+TI AT IAGIF FGSIAVE+YFIY+S
Sbjct: 496 AGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFIYSS 555

Query: 548 LWYNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVF 607
           LW+NKIFYMFG                   ITYHSLCLENW+WQWRSFI+GG+GC++Y+F
Sbjct: 556 LWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQWRSFIIGGLGCSVYMF 615

Query: 608 IHSILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           IH+ILFTKFKLGGF TVVLY+GY          VTG+IGF SSM F+RKI+S IKV+
Sbjct: 616 IHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRIKVE 672

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/657 (62%), Positives = 496/657 (75%), Gaps = 7/657 (1%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
            +AF LPG++PTTYH  DEIPLLVN L+PS+Y+QH+++ G D+                R
Sbjct: 16  AKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNER 75

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           FHFC+PE +EKQPESLGS++FGDRIYNSPFQL MLEEK+C +LCK TIPG DA+FIN+LI
Sbjct: 76  FHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLI 135

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAV-DETEART----KVAA 189
            +GFFQNWL+DGLPAA   +D+RT T++YG+GFELG  DV+Q V DET   T     + A
Sbjct: 136 ISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDA 195

Query: 190 ANQGAELDARDAKNVKT--IKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR 247
           +N GA L  R  KN++   +K VEL YFVNH++I +E+H+RGN  YR+VGV VNPVSI+R
Sbjct: 196 SNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIER 255

Query: 248 SSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVN 307
           SSPGSC  T +PLTL ED DN+VYFTYSV FV S T WATRWDKYLH+YDP IQWFSL+ 
Sbjct: 256 SSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLIG 315

Query: 308 FXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXX 367
           F                +ALK+D  RYNE NL++EF EDAGWKL HGDVFR P KSM   
Sbjct: 316 FSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLLS 375

Query: 368 XXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFR 427
                  QLF+MI  +IFFAA G +SP SRG L TVMF+LYALFGFVGSYTSMGVYKFF 
Sbjct: 376 VLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFFH 435

Query: 428 GPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAF 487
           GPYWKAN+++TPIL+PG+I + I+AMN FL++ HSSGVIPAK+LFF++ LWFV SIP +F
Sbjct: 436 GPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLSF 495

Query: 488 AGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTS 547
            GS++A+K+C+WNEHPTKT QIARQIP QPWYL+T  AT +AGIF FGSIAVE+YFIY+S
Sbjct: 496 VGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYSS 555

Query: 548 LWYNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVF 607
           LW+NKIFYMFG                   ITYHSLCLENW WQWRSFI+GG+GC+IY+F
Sbjct: 556 LWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQWRSFIIGGLGCSIYMF 615

Query: 608 IHSILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           IHSILFTKFKLGGF TVVLYLGY          VTG+IGF SSM F+RKI+ ++KV+
Sbjct: 616 IHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/657 (62%), Positives = 496/657 (75%), Gaps = 7/657 (1%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
           T+AF LPG++PTTYH+ DEIPLLVN L+PS+Y+QH+++ GKD+                R
Sbjct: 34  TKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYLYSYDYYNER 93

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           FHFC+PE +E+QPESLGSI+FGDRIYNSPFQL MLE K+C +LC++TIPG DAKFINKLI
Sbjct: 94  FHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGKDAKFINKLI 153

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVD-----ETEARTKVAA 189
           K+GFFQNWL+DGLPAA +  D+RT T++YG+GFELG+  V   +D      T        
Sbjct: 154 KSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDGKVIPSTMEELDSET 213

Query: 190 ANQGAELDARDAKNVK--TIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR 247
           +N GA LDAR+ KN+K   +K VEL YFVNH+DI +E+HDRG+ +YRVVGV VNP+SI+R
Sbjct: 214 SNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDNYRVVGVTVNPMSIER 273

Query: 248 SSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVN 307
           SSP SC    +PL L E+ DN++YFTYSV FV S+T WATRWDKYLH+YDP IQWFSL+N
Sbjct: 274 SSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLIN 333

Query: 308 FXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXX 367
           F                +AL +D +RYNE NLD+EF ED+GWKL HGDVFR P KSM   
Sbjct: 334 FSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGHGDVFRTPTKSMLLS 393

Query: 368 XXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFR 427
                  QLF+MI  +IF AALG +SP SRG L TVMF+ YALFGFVGSYTSMGVYKFF 
Sbjct: 394 VLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGFVGSYTSMGVYKFFH 453

Query: 428 GPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAF 487
           GPYWKAN++LTPIL+PG IF+ I+AMNFFL++ HSSGVIPA TLFF++ LWF  SIP +F
Sbjct: 454 GPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFFIIFLWFAVSIPLSF 513

Query: 488 AGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTS 547
           AGS++A+K CNW+EHPTKT QIARQ+P+QPWYL+TI AT IAGIF FGSIAVE+YFIY+S
Sbjct: 514 AGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFCFGSIAVELYFIYSS 573

Query: 548 LWYNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVF 607
           LW+NKIFYMFG                   ITYHSLCLENW WQWRSFI+GG+GC++Y+F
Sbjct: 574 LWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWRSFIIGGLGCSVYMF 633

Query: 608 IHSILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           IHSILFTKFKLGGF T+VLY GY          VTG+IGF S M F+RKI+S++K++
Sbjct: 634 IHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLFIRKIYSAVKIE 690

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  858 bits (2216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/650 (62%), Positives = 482/650 (74%), Gaps = 18/650 (2%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
            +AFYLPGVAPTTYH  DEI LLVNHL+PSM +QH++++G  V                +
Sbjct: 16  VKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYLYSYDYYYSK 75

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           FHFC+PE + +QP SLGS++FGDRI+NSPF+LNMLEEK+C  LC S IPG DAKF+NKLI
Sbjct: 76  FHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLI 135

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194
           KNGF QNWLIDGLPA  E HD+RT ++FYG+GF+LG VDV +   ++    K        
Sbjct: 136 KNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEEK-------- 187

Query: 195 ELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCE 254
                     K +K +E+ Y  NHYDI IEYHDRGN +YRVVGV V+PVSI+RSS  SC+
Sbjct: 188 ----------KIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQ 237

Query: 255 STGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXXXX 314
                LTL E E+N+V+FTYSV F+ S+T WATRWDKYLHVYDPTIQWFSL+N       
Sbjct: 238 YNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCSVIVVA 297

Query: 315 XXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXXXX 374
                     +ALKND +RYNEFNLD+EF ED+GWKL HGDVFRIP +S+          
Sbjct: 298 LSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILVGSGV 357

Query: 375 QLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN 434
           QLF+MI+ +I FAALGFLSPSSRG L TVMF+LYALFGFVGSYTSM +YKFF+GP WK N
Sbjct: 358 QLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVN 417

Query: 435 MVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVAN 494
           ++LTP+LVPG IF+TII +NFFL++V SSG IPA TLF ++LLWFVFSIP +FAGSL+A+
Sbjct: 418 LLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAH 477

Query: 495 KKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIF 554
           K+C  + HPTKT QIARQIP QPWYLKTIP + IAG+FPF SIAVE+YFIYTSLW+NKIF
Sbjct: 478 KRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIF 537

Query: 555 YMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFT 614
           YMFG                    TYHSLCLENW WQWRSFI+GG GCAIYVFIHSILFT
Sbjct: 538 YMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFT 597

Query: 615 KFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           KFKLGGFTTVVLYLGY          VTGSIGF+SSMFF+RKI+SS+KVD
Sbjct: 598 KFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/652 (63%), Positives = 487/652 (74%), Gaps = 12/652 (1%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
           T AFYLPGVAPTTY +GDEIPLLVNHL+PS+ +QHK+D+G D+                +
Sbjct: 17  TSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPK 76

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
            HFC+PE +EKQPESLGSI+FGDRIYNSPF + MLE ++C SLCK TIP +DAKFINKLI
Sbjct: 77  LHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLI 136

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194
           KNGFFQNWLIDGLPAA + HD +T +DFYG+GF LG V V QAV        +A++    
Sbjct: 137 KNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG------GLASSKLNL 190

Query: 195 ELDARDAKNVKT-IKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGS- 252
           E  AR+AKNV   + NVE+ +  NHYDI +EYHDRG G+YRVVGV V+P    +SS G  
Sbjct: 191 ENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP----KSSTGDI 246

Query: 253 CESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXX 312
           C      L L E EDN+V F+YSV F+PSET WATRWDKYLHVYDPTIQWFSL+NF    
Sbjct: 247 CTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFSVVV 306

Query: 313 XXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXX 372
                       +ALK+DFARY EFNLDD FQ+D+GWKL HGDVFRIP KSM        
Sbjct: 307 ILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGS 366

Query: 373 XXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWK 432
             QLF+M++ +IFFAA+G LSPSSRG L + MF+LYALFGF GSY SMGVYKFF GPYWK
Sbjct: 367 GTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWK 426

Query: 433 ANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLV 492
           ANM+LTPILVPG +FI+I+ +NFFL++  SSG IP   L F+++LWF+ SIP + AGSL+
Sbjct: 427 ANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLI 486

Query: 493 ANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNK 552
           ANKKCNW EHPTKT +IARQIPFQPWYLKT+PAT IAG+FPFGSIAVE+YFIY+SLW+NK
Sbjct: 487 ANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNK 546

Query: 553 IFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSIL 612
           IFYMFG                   ITY+SL LENW WQWRSFIVGGVGCA Y+F+HSI+
Sbjct: 547 IFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRSFIVGGVGCAFYIFVHSII 606

Query: 613 FTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           FTKFKLGGFTT+VLY+GY          VTG+IGF+SSM FV+KI+SS+KVD
Sbjct: 607 FTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/660 (60%), Positives = 480/660 (72%), Gaps = 11/660 (1%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
           T  FYLPGVAPTTYHE D IPLLVNHL+PSM+++HK+ +G ++                +
Sbjct: 18  TNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSK 77

Query: 75  FHFCQP--EKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINK 132
            HFC+P   +I+KQPESLGSI+FGDRIYNSPF+L ML ++ C  LC + IPG+DAKFIN 
Sbjct: 78  LHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFIND 137

Query: 133 LIKNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTK----VA 188
           LIK+GF QNWLIDGLPAA + +D  T + FYGSGFELG V+++Q VDE  + T     + 
Sbjct: 138 LIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIV 197

Query: 189 AANQGAELDARDA----KNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVS 244
                 ELD   A     N   + +VE  YF NH+DI IEYHDRGN +YR+VGV VNP+S
Sbjct: 198 EDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPIS 257

Query: 245 IQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFS 304
           ++R S   C++    L L E  D DV FTYSVTF  S+T WATRWDKYLH+YDPTIQWFS
Sbjct: 258 MKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQWFS 316

Query: 305 LVNFXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSM 364
           L+NF                KALKNDF RYNEFNL+D F ED+GWKL HGDVFRIP KSM
Sbjct: 317 LINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKSM 376

Query: 365 XXXXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYK 424
                     QLF MIS+ +  AALGFLSPS+RG L T+MF+LYA+FGFVGSYTSMGVY+
Sbjct: 377 LLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGVYR 436

Query: 425 FFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIP 484
           FF GPYWKANM+LTP++VPG IF+ II+MN FL++VHSS V+P  TL  MVLLW V S+P
Sbjct: 437 FFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLP 496

Query: 485 SAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFI 544
            +FAGSL++ K+C W +HPTKT ++ RQIPFQPWYLKT+PAT I GIFPFGSIAVE+YFI
Sbjct: 497 LSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVELYFI 556

Query: 545 YTSLWYNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAI 604
           Y+SLW+NKIFYMFG                   +TYHSLCLENW WQWRSFI+GG+GC+I
Sbjct: 557 YSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIGCSI 616

Query: 605 YVFIHSILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           Y+FIHSILFT+FKLGGF T+VLY+GY          VTG+IGF+S+MFFV+KI+SSIKV+
Sbjct: 617 YIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSIKVE 676

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/691 (57%), Positives = 481/691 (69%), Gaps = 27/691 (3%)

Query: 1   MTRXXXXXXXXXXXTRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXX 60
           M R           T  FYLPG AP TY +GD IPLLVNHL+PS+ +QH +D+G ++   
Sbjct: 1   MVRQLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGD 60

Query: 61  XXXXXXXXXXXXXRFHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKS 120
                        + HFCQPEKIEKQPESLGS++FG++IYNSPF + MLE+ +C  LC +
Sbjct: 61  KARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCST 120

Query: 121 TIPGNDAKFINKLIKNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAV-- 178
           TIPG DAKFINKLIKNGF QNWLIDGLPAA + HD+RT T+FYG GFELG V+V QAV  
Sbjct: 121 TIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGG 180

Query: 179 ---DETEARTKVAAANQG-------------------AELDARDAKNV--KTIKNVELVY 214
               E+E   +++  +                     + L+ R+AKNV    + NVE+  
Sbjct: 181 KIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPV 240

Query: 215 FVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCESTGQ-PLTLQEDEDNDVYFT 273
           F NH+DI +EYHDRGNGD+RVVGVIVNPVS+      SC    Q  L L E++DN+V FT
Sbjct: 241 FANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFT 300

Query: 274 YSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXXXXXXXXXXXXXXKALKNDFAR 333
           YSV F PS+T WATRWDKYLH+YDP IQWFSL+NF                +ALK+D +R
Sbjct: 301 YSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISR 360

Query: 334 YNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXXXXQLFIMISTTIFFAALGFLS 393
           YNEFNL DEF+ED+GWKL HGDVFR P  SM          QLF+MI  +I  +ALG LS
Sbjct: 361 YNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILS 420

Query: 394 PSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAM 453
           PSSRG L T MFM YA+FGFVGSYTSMG+YKFF+GPYWKANM+LTP+L+PG IF+T+I M
Sbjct: 421 PSSRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFM 480

Query: 454 NFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIARQI 513
           N  L +V SS VIP  TL FMV LW +FSIP AFAGSL++ KKCNW+EHPTKT +I RQI
Sbjct: 481 NVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQI 540

Query: 514 PFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIFYMFGXXXXXXXXXXXXXXX 573
           PFQPW+LKT+PAT I G+  FGSIAVE+YFIY+SLW+NKIFYMFG               
Sbjct: 541 PFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGL 600

Query: 574 XXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGYXXX 633
               ITY +LC ENW WQWRSF +GG+GC+IY+FIHSILFT+FKLGGF T+VLY+GY   
Sbjct: 601 INVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFL 660

Query: 634 XXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
                  VTG+IGF+ SMFFVR+IF+SIKVD
Sbjct: 661 ISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/649 (60%), Positives = 472/649 (72%), Gaps = 4/649 (0%)

Query: 16  RAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRF 75
            AFYLPGVAPTTYHEGD++PLLVNHL+PS +++H + +  D                 +F
Sbjct: 21  EAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHDTGDKEGFLYSYDYYYK-KF 79

Query: 76  HFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIK 135
           HFCQP +++KQPESLGSI+FGDRIYNSPF+L +L+  +C SLCKS IPG DAKFINKLI 
Sbjct: 80  HFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKLIL 139

Query: 136 NGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAE 195
           NGFFQNW+IDGLPAA +  DT+T   FYG+GFELGLVDV+    + E  T+        +
Sbjct: 140 NGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVLS---DYEPDTRSLHDELELQ 196

Query: 196 LDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCES 255
           L+A+        K  E+ YFVNHYDI+IEYHDRG  +YR+VGV VNP SI+R SP SCES
Sbjct: 197 LNAKKNVLSPGDKVTEIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDSCES 256

Query: 256 TGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXXXXX 315
           TG+ L L E EDN+VYFTYSV F+ S+T WATRWDKYLHVYDP IQWFSL+NF       
Sbjct: 257 TGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIVVLL 316

Query: 316 XXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXXXXQ 375
                     ALKND ARYNE NLD +F+E+ GWKL HGDVFR P+K++          Q
Sbjct: 317 SSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGSGGQ 376

Query: 376 LFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANM 435
           L +M++TTI FA LGFLSPSSRG L TVMF+LYA+FG  GS+TSM  YKFF G  W+ N+
Sbjct: 377 LALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWRLNL 436

Query: 436 VLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANK 495
           VLTP+LVPGSI   ++ +NFFL++VHSSG IP +T+  +VLLWFV SIP +  GS++A K
Sbjct: 437 VLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVIAWK 496

Query: 496 KCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIFY 555
           KCNWNEHPTKT QIARQIPFQPWYLKTIP   +AGIFPFGSIAVE+YFIY+SLW+NKI+Y
Sbjct: 497 KCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNKIYY 556

Query: 556 MFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFTK 615
           MFG                   +TYHSLC+ENW WQWRSF++GG GCA YVF HSILFTK
Sbjct: 557 MFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSILFTK 616

Query: 616 FKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           F+LGG TT+VLYLGY          VTG+IGFLSS+  VRKI+S +KVD
Sbjct: 617 FRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/648 (60%), Positives = 472/648 (72%), Gaps = 2/648 (0%)

Query: 17  AFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFH 76
           AFYLPGVAPTTYH+GDEIPLLVNHL+PS Y+QH + EG  +                +FH
Sbjct: 15  AFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFH 74

Query: 77  FCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKN 136
           FC+PE + KQPESLGSI+FGDRIYNSPF+LNMLE K C  LCKS IP +DAKFINKLI+N
Sbjct: 75  FCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRN 134

Query: 137 GFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAEL 196
           GFF NWL+DGLPAA E HD RT + FYG+GFELG VDVV  +++ + + KV+ ++     
Sbjct: 135 GFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTK-KVSESDYIEIA 193

Query: 197 DARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCEST 256
           DA      ++ K  EL YF+NH+DI+IEYHDRG  +YRVVGV V P SI+R S  SC++ 
Sbjct: 194 DADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDTE 253

Query: 257 GQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXXXXXX 316
           G+PL L ED DN V+FTYSV+FVPS+T WATRWDKYLHVYDP IQWFSL++F        
Sbjct: 254 GEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIVILLS 313

Query: 317 XXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXXXXQL 376
                   +ALKND +RYNE NLDDEFQE+ GWKL HGDVFR P ++M          QL
Sbjct: 314 SVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQL 373

Query: 377 FIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMV 436
           F+M   TI FA LG LSPSSRG L TVMF+LYALFG  GSYTSM VYKFF G  WK NM+
Sbjct: 374 FLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLNMI 433

Query: 437 LTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANKK 496
           LTPIL+P  IFI+++ +N FL++VHSSG IP  T+  +V+LWFVFSIP + AGS+++ KK
Sbjct: 434 LTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRKK 493

Query: 497 CNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIFYM 556
             W + PT T QIARQIPFQPWYLKT+PA+ IAG FPFGSI VE+YFIY+SLW+NKIFYM
Sbjct: 494 SQW-DRPTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFYM 552

Query: 557 FGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFTKF 616
           FG                   +TY+SLC+ENW WQWR F +GG GCA YVF+H+ILFTKF
Sbjct: 553 FGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAILFTKF 612

Query: 617 KLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           KLGG TTVVLYLGY          +TG++GFLSS++FVRKI+ SIKVD
Sbjct: 613 KLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/671 (58%), Positives = 478/671 (71%), Gaps = 24/671 (3%)

Query: 17  AFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFH 76
            FYLPGVAPTTYHEGD IPLLVNHL+P+MY+QH +++G D+                +FH
Sbjct: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYP-KFH 76

Query: 77  FCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKN 136
           FC+PEK+EKQ ESLGSI+FGDRIYNSPFQ+ ML+ K+CASLC  +IP +DAKFINKLI N
Sbjct: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136

Query: 137 GFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDV------------VQAVDETEAR 184
           GFFQNWL+DGLPAA +  D RT ++FY  GFELG V +             Q  D++ + 
Sbjct: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNGQGGSQDGDDSGSH 196

Query: 185 TKVAAANQGAELDARDAK----------NVKT-IKNVELVYFVNHYDIRIEYHDRGNGDY 233
                 ++   LDA  AK          N K  +K +E  YF NH++I ++YHDRGNG+Y
Sbjct: 197 GSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGNY 256

Query: 234 RVVGVIVNPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYL 293
           RVVGVIVNP SI+R SP +C+ TG+ L L E E  +V+F+YSV F PSET WATRWDKYL
Sbjct: 257 RVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDKYL 316

Query: 294 HVYDPTIQWFSLVNFXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCH 353
           HVYDP IQWFSL+NF                  L +D +RYN+ NLDD+FQE+ GWKL H
Sbjct: 317 HVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKLIH 376

Query: 354 GDVFRIPHKSMXXXXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGF 413
           GDVFR P +S+          QLF+M + TI FA LG LSPSSRG L TVMF+LYALFG 
Sbjct: 377 GDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSSRGSLTTVMFILYALFGS 436

Query: 414 VGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFF 473
            GSYTSM  YKFF GPYWK NM+LTPILVPG +F  ++A+NFFL+ V S+G IP  T+  
Sbjct: 437 FGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCV 496

Query: 474 MVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFP 533
           +VLLWF+FSIP + AGSL+A KKC W+EHPTKT+QI RQIPFQPWYLKT+PA+ IAGIFP
Sbjct: 497 IVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGIFP 556

Query: 534 FGSIAVEIYFIYTSLWYNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWR 593
           FGSIAVE+YFIY+SLW+NKIFYMFG                   +TY+SLCLENW WQWR
Sbjct: 557 FGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITVLLTYYSLCLENWKWQWR 616

Query: 594 SFIVGGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFF 653
            F +GG GCA+Y+FIH+ILFTKF+LGGFTT+VLY+GY          +TG++GFLSS++F
Sbjct: 617 GFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSLWF 676

Query: 654 VRKIFSSIKVD 664
           VR+I+SS+KVD
Sbjct: 677 VRRIYSSVKVD 687

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/652 (58%), Positives = 465/652 (71%), Gaps = 5/652 (0%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
             AF LPG+ P TY +GD+IPLLVNHL+PSM++ HKN+EGKD+                +
Sbjct: 15  VEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVVHSYDYYYEK 74

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           FHFCQP  IEK   S+GSI+FGDRIYNSPFQLNMLE K C  LC+S IPG DA+FINKLI
Sbjct: 75  FHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGKDAEFINKLI 134

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194
           KNG++QNW IDGLPAA E +D RT + FYG+GFELGLV++ Q    T  +    + +  +
Sbjct: 135 KNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQT---TGDKLLPDSVHDIS 191

Query: 195 ELDARDAKNV--KTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGS 252
           +L  RDAKN+    IK VE+ YFVNH+DI IEYH+RGNG+YRVVG  VNPVSI R S G 
Sbjct: 192 DLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGATVNPVSIARKSAGD 251

Query: 253 CESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXX 312
           C  TG+ LTL E+EDN+V+ TYSVTFVPS+TSW TRWDKYLHVYDP IQWFSL+NF    
Sbjct: 252 CTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDPKIQWFSLINFSLIV 311

Query: 313 XXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXX 372
                       KALK+DFARYN  NLDD+ +E++GWKL HG VFRIP   M        
Sbjct: 312 ILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFRIPKNPMILSILVGS 371

Query: 373 XXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWK 432
             QLF++I  T+F AA+  LSP  RG L T M +LY LFGF+ SY SMGVYKFF+GPYWK
Sbjct: 372 GFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYVSMGVYKFFKGPYWK 431

Query: 433 ANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLV 492
            NM+LTPILVPG I IT +A+N FLM+  SS V+PAKT+  ++LLWF  SIP + AGSL+
Sbjct: 432 VNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLWFAVSIPLSVAGSLM 491

Query: 493 ANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNK 552
           A KKC+W+EHPT T QIA+ IP Q WYLKTIPA+ I G+F FGSI+V++YFIYTSLW+N 
Sbjct: 492 AQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSISVQLYFIYTSLWFNN 551

Query: 553 IFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSIL 612
           IFYM+G                    TYHSLC ENW WQWR F +GG+GC+IYV +HS+ 
Sbjct: 552 IFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIGGLGCSIYVLLHSLF 611

Query: 613 FTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           F + KLGGFT ++LY+GY          VTGS+GFLSSMFF+++IFSS+KVD
Sbjct: 612 FIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIFSSVKVD 663

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/667 (58%), Positives = 476/667 (71%), Gaps = 19/667 (2%)

Query: 16  RAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRF 75
             FYLPGVAPTTYHEGD IPLLVNHL+PSMY++H +D+GKD                 +F
Sbjct: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYD-KF 76

Query: 76  HFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIK 135
           HFC+PEK+EKQ ESLGSI+FGDRIYNSPF+L ML++K+C +LC S IP NDAKFINKLI 
Sbjct: 77  HFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIA 136

Query: 136 NGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAE 195
           NGFFQNWL+DGLPAA +  D RT ++FY  GFELG +DV  A    + + +  A  +GA 
Sbjct: 137 NGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGAT 196

Query: 196 --------LD-ARDAKNVKT---------IKNVELVYFVNHYDIRIEYHDRGNGDYRVVG 237
                   LD    +KN K          +K +E  YF NH++I ++YHDRGNGDYRVVG
Sbjct: 197 KPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVVG 256

Query: 238 VIVNPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYD 297
           VIVNP SI+R S  SC +TG+ L L E+E+  V+F+YSV F PS+T WATRWDKYLHVYD
Sbjct: 257 VIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYLHVYD 316

Query: 298 PTIQWFSLVNFXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVF 357
           P IQW+SL+NF                + L++D +RYN+ NLDD+FQE+ GWKL HGDVF
Sbjct: 317 PKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDVF 376

Query: 358 RIPHKSMXXXXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSY 417
           R P KS+          QLF+M + TI FA LG LSPSSRG L TVMF+LYALFG +GSY
Sbjct: 377 RTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGSLGSY 436

Query: 418 TSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLL 477
           TSM  YKFF G YWK NM+LTPILVPG +F  ++ +NFFL+ V S+G IP  T+  +VLL
Sbjct: 437 TSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVLL 496

Query: 478 WFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSI 537
           WFVFSIP + AGSL+A KKC WNEHPTKT QI RQIPFQPWYLKT PA  IAGIFPFGSI
Sbjct: 497 WFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGSI 556

Query: 538 AVEIYFIYTSLWYNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIV 597
           AVE+YF+Y+SLW+NKIFYMFG                   +TY+SLCLENW WQWR F +
Sbjct: 557 AVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWRGFWI 616

Query: 598 GGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKI 657
           GG GCA+YVF+H+ILFTKFKLGGF T+VLY+GY          +TG++GF+SS++FVR+I
Sbjct: 617 GGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRRI 676

Query: 658 FSSIKVD 664
           +SSIKVD
Sbjct: 677 YSSIKVD 683

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/674 (57%), Positives = 469/674 (69%), Gaps = 29/674 (4%)

Query: 16  RAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRF 75
            AFYLPGVAP+TY+EGDE+PLLVNHL+PS+ +Q K+D GK V                + 
Sbjct: 16  NAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFP-KL 74

Query: 76  HFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIK 135
           HFC+PEKI KQP+SLGSI+FGDRIYNSPF + ML+ +    LC  TIPG+DAKFINKLIK
Sbjct: 75  HFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIK 134

Query: 136 NGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVD----ETEARTKVAAA- 190
           NGFFQNWLIDGLPAA + +D+ T T+FY  GF LG V++ + V       +A+TK +   
Sbjct: 135 NGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAKTKDSGKK 194

Query: 191 -------------------NQGAELDARDAKNV-KTIKNVELVYFVNHYDIRIEYHDRGN 230
                                  + + R+ K + K + NVE  Y  NHY I +E HDRG 
Sbjct: 195 NSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHNVEFPYLANHYVINVEVHDRGE 254

Query: 231 GDYRVVGVIVNPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWD 290
           G+YRVVGV V+P S   S+       G  L L E +DN+V F+YSV F+ SET WATRWD
Sbjct: 255 GNYRVVGVTVDPYSTTDSA---NPEKGNKLFLDEKKDNEVTFSYSVNFIESETVWATRWD 311

Query: 291 KYLHVYDPTIQWFSLVNFXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWK 350
           KYLH Y+PTIQWFSLVNF                KALK+DFARY EFNLD+ F ED+GWK
Sbjct: 312 KYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNLDNSFNEDSGWK 371

Query: 351 LCHGDVFRIPHKSMXXXXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYAL 410
           L HGDVFRIP +SM          QLF+MI ++IF AA+G +SPSSRG L + MF  YAL
Sbjct: 372 LGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFYAL 431

Query: 411 FGFVGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKT 470
           FGF GSY SM VYKFF+GPYWKANM+LTP+LVPG I ++I+ +NFFL++VHSSG IP   
Sbjct: 432 FGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTA 491

Query: 471 LFFMVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAG 530
           L  +V++WFV S+P +F GSL+ANK+ NW EHPTKT QIARQIPFQ WYLKTIPA  IAG
Sbjct: 492 LLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPAILIAG 551

Query: 531 IFPFGSIAVEIYFIYTSLWYNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNW 590
           IFPFG+IAVE+YFIYTSLW+NKIFYMFG                   ITY SLC+ENWNW
Sbjct: 552 IFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLITYQSLCMENWNW 611

Query: 591 QWRSFIVGGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSS 650
           QWRSF +GGVGC++Y+FIHSILFTKFKLGGFTT++LY+GY          VTG++GF+SS
Sbjct: 612 QWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGFISS 671

Query: 651 MFFVRKIFSSIKVD 664
           M FVRKI+S+++VD
Sbjct: 672 MIFVRKIYSNVRVD 685

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/654 (54%), Positives = 455/654 (69%), Gaps = 5/654 (0%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
           + AFY+PG++  TYH GD I L VN L+PSMY++H ++ G+ V                +
Sbjct: 19  SNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDK 78

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           FHFC+PEK+E++ ESLGS++FGDRIYNSPF+L MLE K+C  LCK+TIP +DAKFINKLI
Sbjct: 79  FHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLI 138

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194
           KNGFF NWLIDGLP+A + +D++T + FY SGF LG V V      ++      +     
Sbjct: 139 KNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNE 198

Query: 195 ELDA---RDAKNVKT--IKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSS 249
            + A   R+AKNV    I   E+ YF NH++I IEYHDRGN +YRVVGV V+P+SI+R  
Sbjct: 199 AVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDD 258

Query: 250 PGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFX 309
             SC  TG  L L E+ +N V FTYSV F+ SET+WATRWDKYLH YDP+IQWFSL+NF 
Sbjct: 259 FESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFT 318

Query: 310 XXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXX 369
                          +ALK D +RY + NLD+ F ED+GWKL HGDVFR+P K+M     
Sbjct: 319 IVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIY 378

Query: 370 XXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGP 429
                QLF+MI   +  AALGF+SPS RG L T MF+LYA+FGFVGSYTSMGVYKFF GP
Sbjct: 379 VGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGP 438

Query: 430 YWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAG 489
           YWKANM+LTP+LVPGS+ + II +NFFL+ VHSSG IPA T+  M+ LW + S+P +F G
Sbjct: 439 YWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILMICLWLLVSVPLSFLG 498

Query: 490 SLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLW 549
           S VA KKCNWN++PT   +I R+IP QPWY+++IP   ++GI PFG+IAVE+YFIY+SLW
Sbjct: 499 SFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLW 558

Query: 550 YNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIH 609
           YNKIFYMFG                   + YHSLCLENW WQWRSF+ GG+GCA Y+F++
Sbjct: 559 YNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLY 618

Query: 610 SILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKV 663
           SI FT+FK  GF +++LY+GY          +TG++ F+ +MFFV++IF+SIKV
Sbjct: 619 SIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/650 (53%), Positives = 438/650 (67%), Gaps = 8/650 (1%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
           +RA +LPG++PT Y    EI L VNHL+PS ++QHK+ +G ++                +
Sbjct: 15  SRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSK 74

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
            HFC+PE + +Q ESLGS++FGDR+YNSPF+LNMLE+K C SLCKS IPG DA FINKLI
Sbjct: 75  LHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLI 134

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194
           KNGF  NWL+DGLPA    ++ R  +    +GF LG V+++Q V      T         
Sbjct: 135 KNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATP-------R 187

Query: 195 ELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCE 254
           E     A     + N+EL +  NHYDI I+YH+   G YR+VGV V P SI+++S  SCE
Sbjct: 188 EETGISAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTS-NSCE 246

Query: 255 STGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXXXX 314
            TG+ ++L ED+DN+V +TYSV +V    +WATRWD Y   YD T+QWFSL++       
Sbjct: 247 FTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLISCVIVVIG 306

Query: 315 XXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXXXX 374
                     +ALK+DFARYNE NLDDEF E++GWKL HGDVFR+P+KS+          
Sbjct: 307 LSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLLSVLVGSGV 366

Query: 375 QLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN 434
           QL ++    I  AA+ F +  SR +L T+ F+LYALFGFVGSY SMGVY+FF+GPY K N
Sbjct: 367 QLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVN 426

Query: 435 MVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVAN 494
           M+LTP L+PG I +TII++NFFL+  HSS  IP   LF +VLLW + S+P + AGSL A 
Sbjct: 427 MILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAI 486

Query: 495 KKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIF 554
           K C+W++HPTKT QIARQIPFQPWYLKT+PA  +AGIFPF SIAVE+YFIY SLW+++ F
Sbjct: 487 KTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFF 546

Query: 555 YMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFT 614
           YMFG                   ITYHSLCLENW WQWRSFIVGG+G A+Y+FIHSI FT
Sbjct: 547 YMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFT 606

Query: 615 KFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           +FKL GFTT+VLY+GY           TG++GF SSMF VRKIFSS+KVD
Sbjct: 607 EFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/651 (54%), Positives = 444/651 (68%), Gaps = 12/651 (1%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
            + FYLPG APTTY  GD IPLLVNH++P+++    +  G D                 R
Sbjct: 14  AQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYLYAYDYYYPR 71

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
            H C+P+KIEK  ESLGSI+FGDR++NSPF+L MLEEK C +LC+ T+P  DAKFIN+LI
Sbjct: 72  LHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLI 131

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194
           ++GFF NWL+DGLPA  E HD RT T FYG+GFELG V     +  TE R +     +  
Sbjct: 132 RSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV-----IRGTEDRNQ----EEPG 182

Query: 195 ELDARDAKNVKTIKNVELV-YFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSC 253
           E++ +  + ++  ++V  V YF+NH++I ++YH R   + RVVGV V P S+Q      C
Sbjct: 183 EIELQTRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKC 242

Query: 254 ESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXXX 313
            ++G  L L E  D  V FTYSV F  S+ SWATRW KYLHVYDP +QW+SL+NF     
Sbjct: 243 ANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLINFSLVVL 302

Query: 314 XXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXXX 373
                      +ALK D  RYN+FNLD+EFQED GWKL H DVFR P K++         
Sbjct: 303 LLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSG 362

Query: 374 XQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKA 433
            QLF+M + T+F A LGFLSPSSRG LGT+MF+LYA+FG  GSY SM  YK F G  WK 
Sbjct: 363 GQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKV 422

Query: 434 NMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVA 493
           NMVLTP+LVPG IF T++ MNFFL+ V SSG +P  T+  +V+LWFV SIP +  GSL A
Sbjct: 423 NMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFA 482

Query: 494 NKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKI 553
            KK  W++HPTKT QIA+QIP QPWYL+T PA +IAG+FPFG+IAVE+YFIYTS+W+N +
Sbjct: 483 RKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWFNTM 542

Query: 554 FYMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILF 613
           FYMFG                   +TY+SLC+ENW+WQWRSFI+GG+GC+ YVFI+SILF
Sbjct: 543 FYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILF 602

Query: 614 TKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           TKF+LGGF T+VLY+GY          VTG+IGF+SS++FVRKI+SSIKVD
Sbjct: 603 TKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/622 (54%), Positives = 430/622 (69%), Gaps = 5/622 (0%)

Query: 45  MYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFHFCQPEKIEKQPESLGSIMFGDRIYNSPF 104
           M++ HKN EG+D+                + HFC+PE +EK   S+GS++FGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 105 QLNMLEEKQCASLCKSTIPGNDAKFINKLIKNGFFQNWLIDGLPAAHEAHDTRTGTDFYG 164
           QLNML+ K C  LC STI G DAKFINKLIKNG++QNWLIDGLPAA E +DTRT ++FYG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 165 SGFELGLVDVVQAVDETEARTKVAAANQGAELDARDAKNV--KTIKNVELVYFVNHYDIR 222
           +GFELGLV++ Q   E   +    +A+   +L  RDAKN+    ++++E+ YFVNH+DIR
Sbjct: 121 NGFELGLVEIRQTTGE---KLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIR 177

Query: 223 IEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSE 282
           IEYHDRGN +YRVVGV VNPVSI RS  G C+ TG+ L+L E E N ++FTYSV F+PSE
Sbjct: 178 IEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSE 237

Query: 283 TSWATRWDKYLHVYDPTIQWFSLVNFXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDE 342
           T+W TRWDKYLHVYDPTIQW S+VNF                +ALK+DF+RY E NLD+ 
Sbjct: 238 TAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGELNLDET 297

Query: 343 FQEDAGWKLCHGDVFRIPHKSMXXXXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGT 402
            +EDA WKL HGDVFR P   M          QLF+MI  TIF  A+G ++P SRG L T
Sbjct: 298 IKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPT 357

Query: 403 VMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHS 462
           VMF+LY  F F+ S+ SMGVYKFF G  W  N +LTP LVPG + + II +N FL++VHS
Sbjct: 358 VMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFLIFVHS 417

Query: 463 SGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKT 522
           SGVIP  T   ++LLWF   +P +  GSL+A K C+W+ HPTKT  +++ IP Q WYL+T
Sbjct: 418 SGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQT 477

Query: 523 IPATFIAGIFPFGSIAVEIYFIYTSLWYNKIFYMFGXXXXXXXXXXXXXXXXXXXITYHS 582
           IPA+ I G+F FGS++VE+YF+YTSLW+NKIFYM+G                    TY+S
Sbjct: 478 IPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVLFTYYS 537

Query: 583 LCLENWNWQWRSFIVGGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVT 642
           L  ENW WQWRSF++ G+GC+ YVF+HS+LFT+ KLGGFT  +LY+GY          VT
Sbjct: 538 LSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVT 597

Query: 643 GSIGFLSSMFFVRKIFSSIKVD 664
           G++GFLSSM FVR I+S++KVD
Sbjct: 598 GALGFLSSMLFVRTIYSAVKVD 619

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/650 (44%), Positives = 388/650 (59%), Gaps = 58/650 (8%)

Query: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXR 74
           +  FY PGV+P TYH GDEIPLLVN+LS    W    D   D                  
Sbjct: 14  SYGFYFPGVSPVTYHIGDEIPLLVNYLSSDFLWNI--DYYSD-----------------S 54

Query: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
              C+P  I++Q ESLGS++FGDR+YNSPF+++ML+  +C  LC +TI   D    N   
Sbjct: 55  IGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWNTFF 111

Query: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194
              +  NWL+DGLP      D  +  + Y +  EL +                     G 
Sbjct: 112 GYRYSYNWLVDGLPVL--GIDGTSDANGYHNNSELFM---------------------GY 148

Query: 195 ELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCE 254
           + D +              Y  NH+DI I Y+DRG G+YRVV     P+S+ R+    C 
Sbjct: 149 QADEQK-------------YIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCS 195

Query: 255 STGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFXXXXXX 314
              +P+ +      ++ FTYSV F  S+ SW+TRWD+YLHVYD  IQ   L++F      
Sbjct: 196 KDAKPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLL 255

Query: 315 XXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXXXXXXX 374
                     + LK D A Y+EFNLDDEFQ+D  WK+ HG+VFR P K++          
Sbjct: 256 LSSVLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGS 315

Query: 375 QLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN 434
           QLF M   T+   + GFLSPS+RG LGTVMF+LYALFG VGSYTSM +YKFF G  WK N
Sbjct: 316 QLFFMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLN 375

Query: 435 MVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVAN 494
           ++LTP+L+P  +F+T + +NFFL+Y  SSG +P  T+  +++LWF+ S+P +  GSL++ 
Sbjct: 376 LILTPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSW 435

Query: 495 KKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIF 554
           K   W+EHP KT QIARQ+P QPWY+KT  ATF+AG+FPFG++AVE+Y+IY S+W   IF
Sbjct: 436 KLNRWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIF 495

Query: 555 YMFGXXXXXXXXXXXXXXXXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFT 614
           +M+G                   +TY+SLC+ENW WQWRSFI+GGVGC++YVF+HS+ F 
Sbjct: 496 FMYGFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFI 555

Query: 615 KFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           KFK  GF ++VLYLGY          VTGSIGFL++++FVRKI+S+IKVD
Sbjct: 556 KFKFPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  129 bits (324), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 153/707 (21%), Positives = 264/707 (37%), Gaps = 129/707 (18%)

Query: 23  VAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFHFCQPEK 82
           + P  Y +GD + L+VN +   +                               F  P  
Sbjct: 52  ITPNFYRKGDPLELIVNKVESDL--------------------TQLPYAYYDLPFTCPPT 91

Query: 83  IEKQPE--SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKNGFFQ 140
           + K+P   SL  I+ GDR + S ++L   E+  C +LC         + ++KL++ G+  
Sbjct: 92  MHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVV 151

Query: 141 NWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAELDAR 199
            WLID  LPAA     T     +Y SGF LG +D                          
Sbjct: 152 QWLIDDELPAATTFISTTDHKKYYASGFPLGFID-------------------------- 185

Query: 200 DAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR-SSPGSCESTGQ 258
                    + +  Y  NH  + I +H   N    +VG  V P S+     PG+ ++  Q
Sbjct: 186 --------PDTDKTYLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPGASKNYEQ 237

Query: 259 -PLTLQEDEDNDVY--FTYSVTFVPS-ETSWATRWDKYLHV----YDPTIQ--WFSLVNF 308
             + + EDE+   Y  FTYSV +    E  W  RWD +L+      + +IQ  W SL N 
Sbjct: 238 YEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFHWMSLANS 297

Query: 309 XXXXXXXXXXXXXXXXKALKNDFARYNE---------FNLDDEFQEDAGWKLCHGDVFRI 359
                           + +  D +                +D+  +D   K     V + 
Sbjct: 298 VGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGKYSVYTVAKD 357

Query: 360 PHKSMXXXXXXXXXXQLFIMISTTIFFAALGFLSPSS--------RGLLGTVMFMLYALF 411
             ++            L +       F  +G L+ S         R  + T+  + + L 
Sbjct: 358 WIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILFFVLG 417

Query: 412 GFVGSYTSMGVYKFFRGPYWKANMV-----------LTPIL-------VPGSIFITIIAM 453
            F+ S+    +    +    KAN +            +PI        +PG + ++   +
Sbjct: 418 AFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGIVMVSTFLL 477

Query: 454 NFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANK---KCNWNEHPTKTEQIA 510
           N  +    S+  +P KT+ F + ++F+  IP +  G +VAN       W    TK E  +
Sbjct: 478 NSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLSGITKDESNS 537

Query: 511 ---------RQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNK--IFYMFGX 559
                     +  F P     I   ++ GIFP   I VE+ ++Y SLW  K   +Y +G 
Sbjct: 538 DGNGLFVPKSRAKFNPLVYCGI---YLCGIFPLLVIYVEMQYVYKSLWLEKTTFYYFYGF 594

Query: 560 XXXXXXXXXXXXXXXXXXITY--HSLCLENW----NWQWRSFIVGGVGCAIYVFIHSI-- 611
                              +Y     C E+     NW+W+ F +G  G  +Y+ ++S+  
Sbjct: 595 LFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYY 653

Query: 612 LFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIF 658
           +F    + GF+++++ + Y            G++ +L++ +F+ KI+
Sbjct: 654 IFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  128 bits (321), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 150/635 (23%), Positives = 247/635 (38%), Gaps = 99/635 (15%)

Query: 77  FCQPEKIEKQPE--SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           F  P  + K+P   SL  I+ GDR + S + LN  E+ QC  LC         K   +L+
Sbjct: 76  FTCPPTMHKKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELV 135

Query: 135 KNGFFQNWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQG 193
           KNG+   WLID  LPA      T     +Y SGF LG VD                    
Sbjct: 136 KNGYVVQWLIDDELPAVTTFISTTDHKKYYASGFPLGFVD-------------------- 175

Query: 194 AELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVS-IQRSSPGS 252
                   +  KT       Y   H  I I Y+      + + G  + P S +    PG+
Sbjct: 176 -------PETGKT-------YLNTHVMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCPGA 221

Query: 253 CESTGQ-PLTLQEDEDNDVY--FTYSVTFVPSE-TSWATRWDKYLHVYDPT------IQW 302
            +   Q  L + E++D+  +  FTYSV +       W  RWD YL+  + +        W
Sbjct: 222 SKDYEQYELVVPENDDDLTFIPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFHW 281

Query: 303 FSLVNFXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHK 362
            SL N                 +  K     +++ + +++ +         G ++ +  K
Sbjct: 282 ISLANSFGIVFLISSITAVILYRTFKISRRSFSDISKEEDDK---------GSIYVVARK 332

Query: 363 -SMXXXXXXXXXXQLFIMISTTIFFAALGFLSPSS--------RGLLGTVMFMLYALFGF 413
             +           +F+ +     F  LG L  S         R  + T+  + +    F
Sbjct: 333 WLLNEQTPLANVLIIFVSMGVQFLFTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVTGAF 392

Query: 414 VGSYTSMGVYKFFR----------GPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSS 463
           + S+T   + K               Y+    +L   L+P  + +  + +N  +    S+
Sbjct: 393 MASFTGAHLLKSREEMCSESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDST 452

Query: 464 GVIPAKTLFFMVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIA---------RQIP 514
             +P  T+ F++ ++FV  IP +  G  +A K    N  P+ +  I          + I 
Sbjct: 453 HALPFGTVLFLISVYFVVCIPLSLLGGYIAVKST--NSKPSFSFSIGNYSDRIFVYKTIT 510

Query: 515 FQPWYLKTIPATFIA----GIFPFGSIAVEIYFIYTSLWYNK--IFYMFGXXXXXXXXXX 568
             P  L   P + +A    G+FPF  I VE+ ++Y SLW  K   +Y +G          
Sbjct: 511 MSPSVLINRPLSSLAILAGGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLC 570

Query: 569 XXXXXXXXXITY---HSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFTKFKLG--GFTT 623
                     T+   +S    + NW+W SF +G   CA Y+ ++S+ +  F L   GF++
Sbjct: 571 IVICEISIIGTFILLNSADKNSNNWRWTSFQIGA-SCAFYMEVYSLYYVFFILNIRGFSS 629

Query: 624 VVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIF 658
           + + + Y           TGSI  L+S +FV+KI+
Sbjct: 630 IFISVCYGTLFNIMCGCATGSIACLTSHWFVQKIY 664

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score =  126 bits (316), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 156/704 (22%), Positives = 275/704 (39%), Gaps = 126/704 (17%)

Query: 23  VAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFHFCQPEK 82
           + PT Y  GD + ++VN +        ++D  +                     F  P  
Sbjct: 33  LTPTIYRHGDPVEIIVNKI--------ESDATQ------------LPYGYYDLPFTCPPT 72

Query: 83  IEKQPE--SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKNGFFQ 140
           ++K+P   SL  ++ GDR + S ++L   ++ +C  LC      +  + ++K IK  +  
Sbjct: 73  VDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVV 132

Query: 141 NWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAELDAR 199
            W ID  LPAA     T     +YGSGF LG VD     +ET                  
Sbjct: 133 QWFIDKELPAATTFISTVDQKKYYGSGFPLGFVD-----EETGK---------------- 171

Query: 200 DAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR-SSPGSCESTGQ 258
                        VY  NH  + I YH   + ++ +VG  + P S+     PG+ +   Q
Sbjct: 172 -------------VYVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGASKDYDQ 218

Query: 259 -PLTLQE--DEDNDVYFTYSVTFVPS-ETSWATRWDKYLHVYDPT------IQWFSLVNF 308
             + + E  +ED  + FTYSV +    +  W  R++ +    + +        W SL N 
Sbjct: 219 YEVVVPEIANEDTFIPFTYSVYWREEFDVEWKDRYNLFFDSGELSGSVSRKFHWISLANS 278

Query: 309 XXXXXXXXXXXXXXXXK--ALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXX 366
                           K   + N      E      F     W   + D   +PH  +  
Sbjct: 279 ASIAFLMTFIVSLIFIKITGIPNRLETKKESPKASIFVIARNW--FYDDRPVMPH--LFI 334

Query: 367 XXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYK-- 424
                    LF +I +     +L  L      +L T+  + + L  F+ S+    +    
Sbjct: 335 CIVSMGVHFLFTVIGSLTISCSLNSLHTIRNSVL-TMALLFFVLGAFMASFVGGTLLIEN 393

Query: 425 ----FFRGPYWK--ANMVLTPI----LVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFM 474
                 RG      +N++L  +    L+PG + +T I +N  +    S+ V+P  T+  +
Sbjct: 394 NKLIMRRGSLKNVFSNILLFSVVCGSLLPGMVILTAIILNCIIWLHTSTNVLPFATIMKL 453

Query: 475 VLLWFVFSIP-SAFAGSLVANKKCN---------------------WNEHPTKTEQIARQ 512
           + ++F+  IP S   GS+ ANK                         +E      +  R+
Sbjct: 454 LFIYFIVCIPLSVLGGSIAANKDSEEYSRLRSDSIKRISRTRANKIMDEDQGTDVRTTRK 513

Query: 513 IPFQ-PWYLK-------TIPATFIAGIFPFGSIAVEIYFIYTSLWYNK--IFYMFGXXXX 562
           + ++  W LK       T+ +   +GIFPF  I VE+ F+Y S+WY K   +Y +G    
Sbjct: 514 LKYKVRWQLKKMMLDTVTVVSLLASGIFPFIMIYVELQFVYKSVWYEKTTFYYYYGFLLA 573

Query: 563 XXXXXXXXXXXXXXXITYHSLCLENWN----WQWRSFIVGGVGCAIYVFIHSI--LFTKF 616
                           +Y  + + + +    W+W++F +    CA Y+  +SI  +F   
Sbjct: 574 NIILLCLVICDIAIICSYLMMTVSSKDNSDSWKWKTFQLSS-SCAWYMEAYSIYYVFKVL 632

Query: 617 KLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSS 660
            +  F+++++ + Y            GSIG+L+S++FV++++ S
Sbjct: 633 NMRDFSSILISVCYSLLFNALCGLAMGSIGYLASLWFVKRVYRS 676

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  124 bits (312), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 155/691 (22%), Positives = 258/691 (37%), Gaps = 116/691 (16%)

Query: 23  VAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFHFCQPEK 82
           + P  Y +GDE+ L+VN +   +                               F  P  
Sbjct: 41  LQPNFYFQGDEVELIVNKVESDL--------------------TQLPYAYYDLPFTCPPT 80

Query: 83  IEKQPE--SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKNGFFQ 140
           + K+P   SL  I+ GDR + S + L   ++  C  LC         K   KL+++G+  
Sbjct: 81  MHKKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVV 140

Query: 141 NWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAELDAR 199
            WLID  LPAA     T     +Y SGF LG VD                          
Sbjct: 141 QWLIDEELPAATTFISTIDQKKYYASGFPLGFVD-------------------------- 174

Query: 200 DAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR-SSPGSCESTGQ 258
                    +   VY   H  + I Y+      + +VG  V P S+     PG+ ++  +
Sbjct: 175 --------PDTGKVYLNTHVMLVIRYNTVDVNKHTIVGFEVYPKSVSDFHCPGASKNY-E 225

Query: 259 PLTLQEDEDND----VYFTYSVTFVPSE-TSWATRWDKYLHVYDPT------IQWFSLVN 307
           P  +   E++D    + FTYSV +       W  RWD YL+  + +        W SL N
Sbjct: 226 PYEIVIPENDDDLTFIPFTYSVYWREEYLVDWDHRWDLYLNSGELSENKTTQFHWISLAN 285

Query: 308 FXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVF--RIPHKSMX 365
                            ++ K+      + N  +E +    +++    +   R P  ++ 
Sbjct: 286 SAGIVFLMSFVVSVILLRSFKSSRDISTDINKSEEHRNGLVYEVARNWIINERTPLANLL 345

Query: 366 XXXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKF 425
                     LF ++ +     +L  L      +L T+  + + L  F+ SY    + + 
Sbjct: 346 ILFVSMGVQFLFTVLGSLTISCSLNKLHDIGDSVL-TMAVLCFVLGAFMSSYIGSVLLRL 404

Query: 426 FRGPYWKANMVLTPI--------------LVPGSIFITIIAMNFFLMYVHSSGVIPAKTL 471
                 KA M   PI               +PG + I  + +N  +    S+  +P KT+
Sbjct: 405 KN----KATMKKQPIKKGFHLFFAILCGSFLPGIVMIVTLLLNSIVWAHDSTHALPFKTV 460

Query: 472 FFMVLLWFVFSIPSAFAGSLVANKKCNWNE------HPTKTE--------QIARQIPFQP 517
              + ++F+  IP +  G  +AN             H ++ E        +  + I    
Sbjct: 461 VMFITVYFIVCIPLSILGGYMANSSKTKGSLTDPKFHTSRPELELFANKLKPKKHIFLFG 520

Query: 518 WYLKTIPATF---IAGIFPFGSIAVEIYFIYTSLWYNK--IFYMFGXXXXXXXXXXXXXX 572
             LK+I       ++GIFPF  I VE+ ++Y S+W  K   +Y +G              
Sbjct: 521 ARLKSIKIALPILLSGIFPFVIIYVELQYVYKSVWLEKTAFYYFYGFLFANILLLCIVVG 580

Query: 573 XXXXXITYHSLCL---ENWNWQWRSFIVGGVGCAIYVFIHSILFTKFKLG--GFTTVVLY 627
                 TY  L +    N +W+W SF +G   CA Y+ ++S+ +  F L   GF+++ + 
Sbjct: 581 EIAIIGTYTMLHMADRNNTDWRWISFFMGS-SCAWYMELYSLYYVFFILNIRGFSSIFIS 639

Query: 628 LGYXXXXXXXXXXVTGSIGFLSSMFFVRKIF 658
           + Y            GSI  L+S FFV K++
Sbjct: 640 VCYGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  123 bits (308), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 158/710 (22%), Positives = 270/710 (38%), Gaps = 124/710 (17%)

Query: 23  VAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFHFCQPEK 82
           + P  Y  GD + L+VN +   +                               F  P  
Sbjct: 52  ITPNFYKNGDPLELIVNKVESDL--------------------TQLPYAYYDLPFTCPPT 91

Query: 83  IEKQPE--SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKNGFFQ 140
           + K P   SL  I+ GDR + S ++L   E+  C  LC         + ++KLI+ G+  
Sbjct: 92  MHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKLIREGYVV 151

Query: 141 NWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAELDAR 199
            WLID  LPAA     T     +Y SGF LG +D                          
Sbjct: 152 QWLIDDELPAATTFISTTDHKKYYASGFPLGFMD-------------------------- 185

Query: 200 DAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR-SSPGSCESTGQ 258
                    +    Y  NH  + I +H   NG   +VG  V P S+     PG+ ++  Q
Sbjct: 186 --------PDTGKTYLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPGASKTYEQ 237

Query: 259 -PLTLQEDEDNDVY--FTYSVTFVPS-ETSWATRWDKYLHVYDPT------IQWFSLVNF 308
             +T+ EDE+   Y  FTYSV +    E  W  RWD +L+  + +        W S  N 
Sbjct: 238 YEITIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFHWMSFANS 297

Query: 309 XXXXXXXXXXXXXXXXKALKND--FARYNEF--NLDDEFQEDA--GWKLCHGDVFRIPHK 362
                             +  D      N+F  N++    ED     K     V+ +   
Sbjct: 298 VIIVLSISLITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDVLNNDKYSKNSVYMVAKD 357

Query: 363 SMXXXXXXXXXXQ-LFIMIS--TTIFFAALGFLSPSS--------RGLLGTVMFMLYALF 411
            +          + L +++S      F  +G L+ S         R  + T+  + + + 
Sbjct: 358 WIQNGKPDLFSLKGLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVLTMAILCFVIG 417

Query: 412 GFVGSY--TSMGVY---KFFRGPYW------KANMVLTPIL-------VPGSIFITIIAM 453
            F+ S+  T + +    + F   Y+      K     +PI        +PG I I+   +
Sbjct: 418 AFMASFVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSSLPGMIMISTFLL 477

Query: 454 NFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANK---KCNWNEHPTKTEQIA 510
           N  +    S+  +P KT+ F + ++F+  IP +  G +VAN       W    T  E  +
Sbjct: 478 NSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQYWLSGITIDESDS 537

Query: 511 RQ----IPFQPWYLKTI--PATFIAGIFPFGSIAVEIYFIYTSLWYNK--IFYMFGXXXX 562
           +     +P  P     +     ++ G+FP   I VE+ ++Y SLW  K   +Y +G    
Sbjct: 538 KNNKLFLPKSPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFL 597

Query: 563 XXXXXXXXXXXXXXXITY--HSLCLENW----NWQWRSFIVGGVGCAIYVFIHSI--LFT 614
                           +Y     C E+     NW+W+ F +G  G  +Y+ ++S+  +F 
Sbjct: 598 SIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYIFA 656

Query: 615 KFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
              + GF+++++ + Y            G++ +L++ +F+ KI+  +KV+
Sbjct: 657 VLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIY-HVKVN 705

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  118 bits (295), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 143/656 (21%), Positives = 250/656 (38%), Gaps = 115/656 (17%)

Query: 77  FCQPEKIEKQPE--SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           F  P  + K+P   SL  I+ GDR + S ++L   E+  C +LC         + ++KL+
Sbjct: 87  FTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQTLDKLV 146

Query: 135 KNGFFQNWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQG 193
           + G+   WLID  LPAA     T     +Y SGF LG VD                    
Sbjct: 147 REGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFVD-------------------- 186

Query: 194 AELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR-SSPGS 252
                          + +  Y  NH  + I +H  G+    VVG  V P S+     PG+
Sbjct: 187 --------------PDTDKTYLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVSDYHCPGA 232

Query: 253 CESTGQ-PLTLQEDEDNDVY--FTYSVTFVPS-ETSWATRWDKYLHVYD------PTIQW 302
            ++  Q  + + EDE +  Y  FTYSV +    E  W  RW+ +L+  +          W
Sbjct: 233 SKNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQSAQFHW 292

Query: 303 FSLVNFXXXXXXXXXXXXXXXXKALKNDFARYNE---------FNLDDEFQEDAGWKLCH 353
            SL N                 + ++ D    +             +D   +D   K   
Sbjct: 293 MSLANSLGIVLSISFITFVIYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDD---KYGK 349

Query: 354 GDVFRIPHKSMXXXXXXXXXXQLFIMIST---TIFFAALGFLSPSS--------RGLLGT 402
             V+ +    +          ++ I++ +      F  +G L+ S         R  + T
Sbjct: 350 NSVYMVTKDWIQNGKPDLFGLKVLIVLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLT 409

Query: 403 VMFMLYALFGFVGSY--TSMGVYKFFRG---------PYWKANMVLTPIL-------VPG 444
           +  + + L  F+ S+  T +G+    R            +K     +PI        +PG
Sbjct: 410 MAILCFVLGAFMASFVGTRLGIVTKRRNINVNYLDHNKSFKNCREFSPIFAVICGSSLPG 469

Query: 445 SIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANK--------- 495
            + I    +N  +    S+  +P +T+ F + ++FV  IP +  G +VAN          
Sbjct: 470 MVMIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKYWLS 529

Query: 496 ---KCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNK 552
              K   + + +K  +   +  F P         ++ GIFP   I VE+ ++Y SLW  K
Sbjct: 530 GITKDETDGNGSKLFKPKSRTRFNPL---VHCGVYLCGIFPLLVIYVEMQYVYKSLWLEK 586

Query: 553 IFYMFGXXXXXXXXXXXXXXXXXXXITYHSL----CLENW----NWQWRSFIVGGVGCAI 604
             + F                    I    L    C ++     NW+WR F +G  G  +
Sbjct: 587 TTFYFFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG-GV 645

Query: 605 YVFIHSI--LFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIF 658
           Y+ ++S+  +F    + GF+++++ + Y            G++  L++ +F+ +I+
Sbjct: 646 YMELYSLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWFINRIY 701

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  117 bits (294), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 154/722 (21%), Positives = 264/722 (36%), Gaps = 143/722 (19%)

Query: 17  AFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFH 76
            +Y   + P  Y +GD + L+VN +   +                               
Sbjct: 46  TYYDGWITPNFYKKGDPLELIVNKVESDL--------------------TQLPYAYYDLP 85

Query: 77  FCQPEKIEKQPE--SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           F  P  + K+P   SL  I+ GDR + S + L   E+  C +LC         + ++KL+
Sbjct: 86  FTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKLV 145

Query: 135 KNGFFQNWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQG 193
           + G+   WLID  LPAA     T     +Y SGF LG VD                    
Sbjct: 146 REGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD-------------------- 185

Query: 194 AELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR-SSPGS 252
                          +    Y  NH  + I +H   N    +VG  V P S+     PG+
Sbjct: 186 --------------PDTGKTYLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCPGA 231

Query: 253 CESTGQ-PLTLQEDEDNDVY--FTYSVTFVPS-ETSWATRWDKYLHVYD------PTIQW 302
            ++  Q  + + EDE+   Y  FTYSV +    E  W  RWD +L+  +          W
Sbjct: 232 SKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQFHW 291

Query: 303 FSLVNFXXXXXXXXXXXXXXXXKALKNDFARYN-------------EFNLDDEFQEDAGW 349
            S  N                 + +  D    +             E NLDD+       
Sbjct: 292 MSFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDD------- 344

Query: 350 KLCHGDVFRIPHKSMXXXXXXXXXXQLFIMIST---TIFFAALGFLSPSS--------RG 398
           K     V+ +    +          ++ I++ +      F  +G L+ S         R 
Sbjct: 345 KYGKNSVYMVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRN 404

Query: 399 LLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMV-----------LTPIL------ 441
            + T+  + + L  F+ S+    +    +    + N +            +P+       
Sbjct: 405 SVITMAILCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGS 464

Query: 442 -VPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANK---KC 497
            +PG + ++   +N  +    S+  +P +T+ F + ++F+  IP +  G  VAN      
Sbjct: 465 SLPGLVMVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPR 524

Query: 498 NWNEHPTKTEQIAR---------QIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSL 548
           +W    TK E             +  F P     I   ++ G+FPF  I VE+ ++Y S+
Sbjct: 525 HWLSGITKDETCGNSSRLFVPRSRTKFNPLVYCGI---YLCGLFPFLVIYVELQYVYKSV 581

Query: 549 WYNK-IFYMFGXXXXXXXXXXXXXXXXXXXITYHSL---CLENW----NWQWRSFIVGGV 600
           W  K  FY F                    I  +SL   C E+     NW+W+ F +G  
Sbjct: 582 WLEKTTFYYFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFS 641

Query: 601 GCAIYVFIHSI--LFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIF 658
           G  +Y+ ++S+  +F    + GF++ ++ + Y            G + +L++ +F+ KI+
Sbjct: 642 G-GVYMELYSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIY 700

Query: 659 SS 660
            S
Sbjct: 701 HS 702

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  117 bits (292), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 155/691 (22%), Positives = 257/691 (37%), Gaps = 111/691 (16%)

Query: 23  VAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFHFCQPEK 82
           + P  Y  GD + LLVN +   +                               F  P  
Sbjct: 41  LQPNVYRWGDHVELLVNKVESDL--------------------TQFPYGYYDLPFTCPPT 80

Query: 83  IEKQPE--SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKNGFFQ 140
            +K+P   SL  I+ GDR + S ++L   ++  C +LC         +   +L++ G+  
Sbjct: 81  EDKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVV 140

Query: 141 NWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAELDAR 199
            WLID  LPAA     T     +Y SGF LG VD                          
Sbjct: 141 QWLIDQELPAATTFISTIDHKKYYVSGFPLGFVD-------------------------- 174

Query: 200 DAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR-SSPGSCESTGQ 258
                    + E  Y   H  + I Y+      + +VG  V P S+     PG+ +   Q
Sbjct: 175 --------PDTEKTYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPGASKGYEQ 226

Query: 259 -PLTLQEDEDNDVY--FTYSVTFVPS-ETSWATRWDKYLHVYDPT------IQWFSLVNF 308
             L + E+ED   Y  FTYSV +    +  W+ RW+ +L+  + +        W +L N 
Sbjct: 227 YELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWMTLGNS 286

Query: 309 XXXXXXXXXXXXXXXXKALKNDFARYNE---FNLDDEFQEDAGWK-----LCHGDVFRIP 360
                           + ++      +E   F  D+  + D+ +      L   D   I 
Sbjct: 287 VGISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQTDSSSIS 346

Query: 361 HKSMXXXXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFML----YALFGFVGS 416
            K +           LF +I +  F  +L  L      +L    F L    Y    FVG+
Sbjct: 347 FKILTIFVSIGVQF-LFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHLFVGT 405

Query: 417 YTSMGVYKFFRGPYWKANM--VLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFM 474
           +  +       G   +     +L    +PG + I+   +N+ +    SS  +P +T+   
Sbjct: 406 WLHIDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPFRTIVLF 465

Query: 475 VLLWFVFSIPSAFAGSLVANK--KCNWNEHPTKTEQIARQIPFQPWYLKTIPA------- 525
           V ++FV  IP +  G  V+++  +      P  +   AR I  +P    T  A       
Sbjct: 466 VSIYFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSI--KPCRAPTTLAPRKISER 523

Query: 526 -TF------IAGIFPFGSIAVEIYFIYTSLWYNK--IFYMFGXXXXXXXXXXXXXXXXXX 576
            TF      I G  PF  I VE+ +IY S+W  K   +Y++G                  
Sbjct: 524 LTFDFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVSF 583

Query: 577 XITY-----HSLCLENWNWQWRSFIVGGVGCAIYVFIHSI--LFTKFKLGGFTTVVLYLG 629
              Y     H       +W+W+ F++ G  CA Y+ ++S+  +F   K+ GF ++ + + 
Sbjct: 584 LGCYVMMRKHKRVATFDSWRWKCFMM-GTSCAWYMELYSLYYIFHTLKMTGFPSIFISVS 642

Query: 630 YXXXXXXXXXXVTGSIGFLSSMFFVRKIFSS 660
           Y            GS+G+L+S + V ++F +
Sbjct: 643 YSLIFNIMCGCGMGSLGYLTSCWLVNRVFCT 673

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  112 bits (280), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 143/627 (22%), Positives = 242/627 (38%), Gaps = 97/627 (15%)

Query: 77  FCQPEKIEKQPE--SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           F  P   EK+P   SL  I+ GDR + S ++L + ++  C  LC         +    LI
Sbjct: 75  FTCPPTPEKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLI 134

Query: 135 KNGFFQNWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQG 193
           K+G+   W+ID  LPAA     T     +Y  GF LG      +VD   +R         
Sbjct: 135 KSGYMVQWMIDDDLPAATTYISTTDNLKYYAPGFPLG------SVDPRSSR--------- 179

Query: 194 AELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSC 253
                              V+F NH  + I Y+   +    +VG    P S+        
Sbjct: 180 -------------------VFFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCPGA 220

Query: 254 ESTGQPLTLQEDEDNDVYF---TYSVTFVP-SETSWATRWDKYLH------VYDPTIQWF 303
               +P  + +    ++ +   TYSV +   +E  W+ RW  Y++          T  W 
Sbjct: 221 SKDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFHWM 280

Query: 304 SLVNFXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKS 363
           +L N                    +N     NE  L+ +  ED+       D+F + +  
Sbjct: 281 ALANSVGIVLFVTFIVIVNLIMIFRNP----NE-QLESKENEDSS------DIFNVANNW 329

Query: 364 MXXXXXXXXXXQLFIMISTTI--FFAALGFLSPS-----------SRGLLGTVMFMLYAL 410
           +          +L + +S  I   F  LG L+ S           S   +  + F+  A 
Sbjct: 330 LRARQGFQLN-RLIVCVSMGIQVMFMILGPLAISLSLTRLHNIKNSVLTIAALCFVAGAF 388

Query: 411 FG-FVGSYTSM----GVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGV 465
              FVG++  M      Y F+   +     VL    +PGSI +  +++N  +    S+  
Sbjct: 389 MASFVGTWLKMDQNISAYTFYNPVF----AVLCGSALPGSIMVLTLSLNCIIWIWDSTKA 444

Query: 466 IPAKTLFFMVLLWFVFSIPSAFAGSLVA---NKKCNWNEHPTKT---EQIARQIPFQPWY 519
           +P  T+   V  +FV  I  +  G  VA   ++    +  P  T    ++ R+       
Sbjct: 445 LPFGTMVVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGK 504

Query: 520 LKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNK--IFYMFG-----XXXXXXXXXXXXXX 572
           L    A  I+G  PF  I VE+ ++Y S+W  K  ++Y++                    
Sbjct: 505 LVVFLAGLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLL 564

Query: 573 XXXXXITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFTKF--KLGGFTTVVLYLGY 630
                +  +   + + NW+WR F++   GC+ Y+ I+S+ +  F   + G + V + + Y
Sbjct: 565 GCLVLMKLNHKFINDQNWRWRCFVIS-TGCSWYMEIYSLYYIFFIIHMTGDSAVFISVCY 623

Query: 631 XXXXXXXXXXVTGSIGFLSSMFFVRKI 657
                      TGS+G+L+S +FV+KI
Sbjct: 624 SFIFNVLCGLATGSLGYLTSSWFVKKI 650

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 140/633 (22%), Positives = 237/633 (37%), Gaps = 102/633 (16%)

Query: 75  FHF-CQP-EKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINK 132
            HF C P + ++  P +   I++G++ + S +QL   +++ C  LC     G   K   +
Sbjct: 89  LHFTCPPSQDMKPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYE 148

Query: 133 LIKNGFFQNWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAAN 191
           LIK  +   WL D  LP A    +T+    +Y SGF LG  D      ET+         
Sbjct: 149 LIKQNYVVQWLADDDLPGATTYLNTKDKKKYYSSGFPLGQYD-----PETDE-------- 195

Query: 192 QGAELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQ-RSSP 250
                                 Y  NH  I I YH    G   +VG  V P S+     P
Sbjct: 196 ---------------------AYINNHVMIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCP 234

Query: 251 GSCESTGQPLTLQEDEDND-VYFTYSVTFVPS-ETSWATRWDKYLH---VYDPTIQWFSL 305
           G+ +          +ED + + FTY+V +    +  W  RW+ +++   + + T   F  
Sbjct: 235 GASKDYTPYKIDPTNEDIEFISFTYAVYWREDFKVDWKNRWNFFINGGELKESTSNQFHW 294

Query: 306 VNFXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMX 365
           + F                        +  E +     Q  A W        R+P     
Sbjct: 295 ITFANGIIVTSCLLLIVIA------ILKRQETDGSITTQLAAEWSKA-----RVPLFFQL 343

Query: 366 XXXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKF 425
                     LF  + T I   +L         +L   +F+  +     GS+TS  +   
Sbjct: 344 NLLVSMGIHFLFTTLGTLIISCSLNHTHRIGSSVLTCAVFLFIS-----GSFTSSFIGAL 398

Query: 426 FRGPYWKANMVLTPIL---VPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFS 482
             G   +  +V + I    +PG   + ++ +N+ L   +++  +P  T+  +   +F+  
Sbjct: 399 LEGQMSQHKLVNSIIFGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAYFIVC 458

Query: 483 IPSAFAGSLVANK--KCNW-------------NEHPTKTEQIARQIPFQPWYLKT-IPAT 526
           +P +  G   A++  K N              N+H T+   +  +    P+ LK  I  T
Sbjct: 459 VPISIIGGKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYVESKNSI-PFVLKNPIAIT 517

Query: 527 FIAGIFPFGSIAVEIYFIYTSLWYNK--IFYMFGXXXXXXXXXXXXXXXXXXXITYHSLC 584
              G+ PF  I VE+ F Y SLW  K  ++Y++G                     Y  L 
Sbjct: 518 LTFGLIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYIHLN 577

Query: 585 LEN------WN------------WQWRSFIVGGVGCAIYVFIHSILFTKF--KLGGFTTV 624
             N      W+            W+W++F +GG   A Y+  +SIL+  F  +   F + 
Sbjct: 578 YGNDSLNFKWDNVIGRVLEACHSWRWKAFHMGG-AVAWYMEAYSILYLIFVARYRDFISS 636

Query: 625 VLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKI 657
            L++ Y            GS+ +LSS++F+ K+
Sbjct: 637 FLFVCYSTLFNILCWTAFGSLSYLSSLWFIGKL 669

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 147/675 (21%), Positives = 254/675 (37%), Gaps = 151/675 (22%)

Query: 78  CQPEKIEKQPE-SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKN 136
           C P  ++K    SL  I+ GDR + S + L+  +++ C  LC      +  +  ++LIK 
Sbjct: 92  CPPTNVKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQ 151

Query: 137 GFFQNWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAE 195
           G+   WLID  LPAA     T+    +Y SGF LG +D                      
Sbjct: 152 GYVVQWLIDDELPAATTFISTKDHKKYYASGFPLGFMD---------------------- 189

Query: 196 LDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR-SSPGSCE 254
                       K+    Y  NH  + I YH      + +VG+ V P S+     PG+ +
Sbjct: 190 ------------KDTGKTYLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYHCPGASK 237

Query: 255 STGQ-PLTLQEDEDNDVYFTYSVTFVPS-ETSWATRWDKYLHVYDPT------IQWFSLV 306
           +     +  +E E   + FTYS+ +       W  RW+ +++  + +        W SL 
Sbjct: 238 NFDHYEVNTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWISLA 297

Query: 307 NFXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXX 366
           N                 K++  D     E       Q  + W + H   + + H ++  
Sbjct: 298 NSVVIVTLMTLVVALILAKSVSTD-----ETVSTSTSQVASQWVVQHS--YLLNHLNVFT 350

Query: 367 XXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFV-GSYTSMGVYKF 425
                    LF ++ + I   ++  L      +  +V+ M  AL  F+ G+YTS      
Sbjct: 351 AMGVQF---LFTILGSLIISCSMNKL----HNIRNSVLTM--ALMCFISGAYTSS----- 396

Query: 426 FRGPYWKANMVLTPIL-------VPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLW 478
           F G    AN   T  +       +PG     ++ +N  +    S+  +P  T+  ++ ++
Sbjct: 397 FVGALLSANHNTTIKISIACGSALPGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVY 456

Query: 479 FVFSIPSAFAGSLVAN---KKC-----------------NWNEHPTKTEQI-------AR 511
           F+  IP +  G + A    +KC                 ++++ P    ++         
Sbjct: 457 FIVCIPLSILGGVSATYTRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISGNS 516

Query: 512 QIPF---QPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKI--FYMFGXXXXXXXX 566
           ++P    QP  L     T I+GI PF  I VE+ F+Y SLW  K   +Y++G        
Sbjct: 517 KLPLMLRQPVLL-----TVISGIVPFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANIVL 571

Query: 567 XXXXXXXXXXXITYHSL----------------------------------C---LENWN 589
                        Y +L                                  C   L    
Sbjct: 572 LCVVVCEISIIGCYLTLIHVSPDEFIPIATPEQAMHSPMLKQVRVQAMNFVCAIGLAMTQ 631

Query: 590 WQWRSFIVGGVGCAIYVFIHSILF--TKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGF 647
           W+W+SF +GG   A Y+  +S+ +  T  K+  F++++L+  Y            G++G+
Sbjct: 632 WRWKSFQIGG-SVAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALGY 690

Query: 648 LSSMFFVRKIFSSIK 662
           LS  +FV +I ++ K
Sbjct: 691 LSCCWFVNRIHTNSK 705

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score = 97.1 bits (240), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 150/657 (22%), Positives = 252/657 (38%), Gaps = 112/657 (17%)

Query: 78  CQPEKIEKQPE--SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIK 135
           C P K EK+P   SL  I  GDR + S ++L+   +  C  LC             +L++
Sbjct: 87  CPPTK-EKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQ 145

Query: 136 NGFFQNWLID-GLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194
            G+   WLID  LPAA     +     +Y +GF +G VD     D T             
Sbjct: 146 QGYVTQWLIDESLPAATTFISSTNHNKYYAAGFPVGYVD-----DRTG------------ 188

Query: 195 ELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR-SSPGSC 253
                     KT  N       NH  + I YH     ++ +VG  V P S+     PG+ 
Sbjct: 189 ----------KTFLN-------NHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYHCPGAN 231

Query: 254 ESTGQPLTLQEDEDNDVYF---TYSVTFVPS-ETSWATRWDKYLHVYDPT------IQWF 303
           ++  +   +  ++D+++ F   TYSV +    E  W  RW+ +L+  + +        W 
Sbjct: 232 KNHDKYEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFHWM 291

Query: 304 SLVNFXXXXXXXXXXXXXXXXKAL-KNDFARYN---EFNLDDEFQEDAGWKLCHGDVF-- 357
           S +N                 K   K +    N     NL  + ++D   K+  G VF  
Sbjct: 292 SFLNSVGIASMTTTIVSIILLKIFSKKERESRNINTSTNLGQDNEDDNDDKI-SGSVFVN 350

Query: 358 --------RIPHKSMXXXXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLY- 408
                   +IP+               F ++ + I   +L  L      +L   +     
Sbjct: 351 AKTWITVGKIPYWKALICLTSMGIQFSFTILGSLIISCSLSKLHNIRFTVLTMSLICFIC 410

Query: 409 --ALFGFVGS--YTSMGVYKFF------RGPYWKANMVLTPILVPGSIFITIIAMNFFLM 458
             A+ G++GS  Y    + K +      R   +K ++V    L PG + +   ++N  ++
Sbjct: 411 GAAISGYIGSRLYIEYQILKGYLRNEVNRTKVYKFSVVCGSSL-PGLLMVISFSLNCIIL 469

Query: 459 YVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANKKCNWNEHPT-------KTEQIAR 511
              S+  +P KT  F+V ++FV  IP +  G ++A   C  + + T       +   I+R
Sbjct: 470 AHDSTNALPFKTEVFLVSIYFVTCIPLSLLGGVLA-LNCKVDSYNTLKRITSLRRNTISR 528

Query: 512 QIP---------FQPWYLK------TIPATFIAGIFPFGSIAVEIYFIYTSLWYNKI--F 554
           +           +Q           T       G F F  I VE+ ++Y S+W  K   +
Sbjct: 529 KSRSDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVWLEKTSFY 588

Query: 555 YMFGXXXXXXXXXXXXXXXXXXXITYHSLCLEN-----WNWQWRSFIVGGVGCAIYVFIH 609
           Y +G                     Y  L  +N       W W+SF++G   CA Y+ ++
Sbjct: 589 YYYGFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLMGS-SCAWYMELY 647

Query: 610 SILFTKFKLG--GFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIFSSIKVD 664
           S+ +  F L   GF+++ + + Y            GS+ +L+S   V +I+   KVD
Sbjct: 648 SLYYIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY---KVD 701

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 153/721 (21%), Positives = 253/721 (35%), Gaps = 169/721 (23%)

Query: 23  VAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFHFCQPEK 82
           + P  Y  GD++ L VN +   +                            RF  C P +
Sbjct: 44  IKPNVYKRGDKVDLTVNKVESEI------------------TNLPYGYYDLRF-VCPPSE 84

Query: 83  IEKQPE-SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKNGFFQN 141
            +K    SL  ++ GDR + S + L     + C  LC      +  +  ++LI+  +  +
Sbjct: 85  TKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVH 144

Query: 142 WLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAELDARD 200
           WLIDG LPAA     TR+G  FY +GF LG VD     D+T                   
Sbjct: 145 WLIDGDLPAATTFASTRSGKKFYTAGFPLGRVD--HETDKTHLH---------------- 186

Query: 201 AKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR-SSPGSCESTGQP 259
                           NH  + I Y       Y +VG  V P S+     PG+ +S  +P
Sbjct: 187 ----------------NHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGASKSF-EP 229

Query: 260 LTLQEDEDNDVY--FTYSVTFV-PSETSWATRWDKYLH----VYDPTIQ---WFSLVNFX 309
             +  +E    Y  FTYSV +   S   W+ RW+ +      + +  +    W SL N  
Sbjct: 230 YVINTEETEVTYIPFTYSVYWREESNIDWSHRWNLFFDGGSMLPNGNVSFFYWISLANSA 289

Query: 310 XXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXXXXX 369
                          K   +DF     F    +             V+ +   ++     
Sbjct: 290 IVVALMTLFIALIFLKIRADDFVGTLAFEWASQ------------PVYYLTQLNLAASMG 337

Query: 370 XXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGP 429
                 LF +I ++    +L  +       L T      A+   +G+YTS  V      P
Sbjct: 338 IQF---LFSIIGSSTISCSLCKVHNIRSWELSTA-----AICFVLGAYTSSLVGSLL-AP 388

Query: 430 YWKANM---VLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSA 486
             K N+   VL    +P    + +   N  +    SS  +P  TL  ++  +FV  +P +
Sbjct: 389 GPKMNLGTSVLCGCTLPALALVVVAVFNSVVWIKDSSAALPFGTLLALLTSYFVICLPLS 448

Query: 487 FAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYL----------------KTIPA----- 525
           F G   A K  +   +    EQ   ++PF   +L                K IPA     
Sbjct: 449 FLGGFSARKLRSAPANGLNYEQ--SKVPFS--FLLSIEYHEYNLLPAGQEKEIPAILSNP 504

Query: 526 ---TFIAGIFPFGSIAVEIYFIYTSLWYNK--IFYMFGXXXXXXXXXXXXXXXXXXXITY 580
              T + G  PF     E+ F+Y SLW  K  ++ ++G                   + Y
Sbjct: 505 FLLTIVTGFPPFVVTCTELLFVYRSLWLQKTNLYSLYGFLLVNFIFLCITVCEVSLVVCY 564

Query: 581 -----------------------HSLC---------LENW-------------NWQWRSF 595
                                   S+C         L+N+             +W+W++F
Sbjct: 565 VLMIYTQPGSTDRQASNEGPDIRWSICRSPMTIVKSLKNYMASTARRWKASFSSWRWKAF 624

Query: 596 IVGGVGCAIYVFIHSILFTKF--KLGGFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFF 653
           +  G   A Y  ++S+ +  F   L  F++++L++ Y            G++G+L+ ++F
Sbjct: 625 M-AGASVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALGYLTCLWF 683

Query: 654 V 654
           +
Sbjct: 684 L 684

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 90/226 (39%), Gaps = 40/226 (17%)

Query: 75  FHFCQPEKIEKQPE--SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINK 132
             F  P   +K+P   SL  I+ GDR + S + L   E   C  LC         K  + 
Sbjct: 72  LQFVCPPSDKKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADA 131

Query: 133 LIKNGFFQNWLI-DGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAAN 191
           LI+ G+  +WLI D LPAA     T++G  FY +GF LG VD V        +T++    
Sbjct: 132 LIRQGYVAHWLIDDDLPAATTFAKTKSGKKFYTAGFPLGEVDAVT------GKTRL---- 181

Query: 192 QGAELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPG 251
                                    NH  + + Y       + ++G  V P S+  +   
Sbjct: 182 ------------------------YNHLMLVVRYQTVDVNKHTIIGFEVYPKSVSDAHCP 217

Query: 252 SCESTGQPLTLQEDEDNDVY--FTYSVTFV-PSETSWATRWDKYLH 294
                 QP  +  +E    Y  FTYS+ +   S   W+ RW+ ++H
Sbjct: 218 GANKDYQPYEINTEESEITYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 62/145 (42%), Gaps = 22/145 (15%)

Query: 436 VLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANK 495
           V++   +PG +  T++ +N  +    SS  IP  T+   V  +F+ S P +  G   A K
Sbjct: 394 VISGSALPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARK 453

Query: 496 KCNWNE-------------------HPTKT-EQIARQIPFQPWYLKTIPATFIAGIFPFG 535
             N  +                   + T++    A   PF       I  T +AGI PF 
Sbjct: 454 MKNAAKLAPANAISKSPFSFLLTLSYDTRSWPATALGKPFPIALSNPILLTILAGIAPFV 513

Query: 536 SIAVEIYFIYTSLWYN--KIFYMFG 558
            I VE++++Y S+W      +Y++G
Sbjct: 514 VICVELFYVYKSMWLQTTNFYYLYG 538

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 589 NWQWRSFIVGG-VGCAIYVFIHSILFTKFKLGGFTTVVLYLGYXXXXXXXXXXVTGSIGF 647
           +W+W+SF+ GG V   + ++    L     L   ++++L++ Y            G++G+
Sbjct: 614 SWRWKSFVAGGSVAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGY 673

Query: 648 LSSMFFVRKIFSSIK 662
           LS ++F+  I SS K
Sbjct: 674 LSCLWFLSHISSSSK 688

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 102/275 (37%), Gaps = 63/275 (22%)

Query: 23  VAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFHFCQPEK 82
           + P  Y +GD++ L+VN +   +                               F  P  
Sbjct: 37  LTPNIYRKGDDVELIVNKIESDL--------------------TKLPYGYYDLPFICPPT 76

Query: 83  IEKQP--ESLGSIMFGDRIYNSPFQLNMLEEKQCASLC-KSTIPGNDAKFINKLIKNGFF 139
            +++P   SL  I+ GDR + S + L   ++  CA LC + T P    K IN L+K  + 
Sbjct: 77  NQRKPLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN-LVKKDYI 135

Query: 140 QNWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAELDA 198
             W ID  LPA+     T     +Y  GF LG VD                         
Sbjct: 136 VQWSIDNDLPASTTFISTSENRKYYIPGFSLGFVD------------------------- 170

Query: 199 RDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR-SSPGSCESTG 257
                     + E  Y  NH  + I YH   +  + +VG+ V P S+     PG+  +  
Sbjct: 171 ---------PDTETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYE 221

Query: 258 QPLTLQEDEDNDVY--FTYSVTFVPS-ETSWATRW 289
           Q   +  D++   Y  FTYSV +    +  W  R+
Sbjct: 222 QFELVANDDEEVTYIPFTYSVYWREEFDVEWKDRY 256

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 106/238 (44%), Gaps = 22/238 (9%)

Query: 441 LVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANKKCNWN 500
           L+P  I I  I +N  +    SS  +P KT+ F++ ++F+  IP +  G   A+  C   
Sbjct: 421 LLPAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIYFIVCIPLSLLGGSYASDICQKR 480

Query: 501 EHPTKTEQIARQIPFQPWYL-KTIPATF----------IAGIFPFGSIAVEIYFIYTSLW 549
                +    +++      L +TI + F          I G+FPF  I VE+  +Y  +W
Sbjct: 481 TLRAFSSPAQQKLAVTNSNLARTIKSIFDDPFSGLLASIGGLFPFFIIYVELQHVYKFVW 540

Query: 550 YNKI------FYMFGXXXXXXXXXXXXXXXXXXXITYHSL-CLENWNWQWRSFIVGGVGC 602
             K       +++F                    + + S   LEN +W+WRSF +    C
Sbjct: 541 LEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSFQISS-SC 598

Query: 603 AIYVFIHSILFTKFKLG--GFTTVVLYLGYXXXXXXXXXXVTGSIGFLSSMFFVRKIF 658
           A Y+ ++S+ +  + L   GF++++L +              GSIG+L++ +FV +++
Sbjct: 599 AWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLCGCALGSIGYLATCWFVGRVY 656

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 112/564 (19%), Positives = 200/564 (35%), Gaps = 88/564 (15%)

Query: 23  VAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFHFCQPEK 82
           + P  Y  GD + LLVN    ++    K     D+                    C P  
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTLNADLKPYIYHDLPFV-----------------CPPTS 89

Query: 83  IEKQPE-SLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKNGFFQN 141
           + K       S+  GD +  S ++L   ++ +C  LC      N       +IK  +   
Sbjct: 90  VRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQIL 149

Query: 142 WLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAELDARD 200
           W ID  LP +     T T    Y  GF LG  D                           
Sbjct: 150 WSIDDELPISMPYISTITQRKKYIPGFPLGRFD--------------------------- 182

Query: 201 AKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR-SSPGSCESTGQ- 258
                  K+   VY  NH  + I Y+   +  + +VG  V   S+     PG+ ++  + 
Sbjct: 183 -------KDKNKVYLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGASKNYEEY 235

Query: 259 PLTLQEDEDNDVY--FTYSVTFVPS-ETSWATRW---DKYLHVYDPTIQWFSLVNFXXXX 312
            L + E++D+  +  FTYSV +    +  W +RW   D  +   DP +   S+++     
Sbjct: 236 ELVIPENDDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDPKLINKSMLSNIMQP 295

Query: 313 XXX------XXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMXX 366
                             K ++N     N+F  + +       +  + ++      S+  
Sbjct: 296 TRTGLFLLPLIIFSIIIVKVVEN--GEKNKFTTEAQLASKCWIESNNINLKSSFSASILT 353

Query: 367 XXXXXXXXQLFIMISTTIFFAALGFLSP-SSRGLLGTVMFMLYALFG--FVGSYTSMGVY 423
                    +F +I   I   ++  L   S+  LL   ++ +  +    F+G++  M + 
Sbjct: 354 LVISMGVQSIFSLIGIIILKLSIYKLHDISNIVLLNIFIWFIEGILASSFLGTWLRMNIL 413

Query: 424 KFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSI 483
                 Y     +L   L+P  + I +  ++  +  + SS   P KTL  M+  +++  +
Sbjct: 414 NKKSINYNPKFSILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTLTMMISFFYIICV 473

Query: 484 PSAFAGSLVANK----------------KCNWNEHPTKTEQIARQIPFQPWYLKTIPATF 527
           P +  G  +A K                + N N+   + +   R        L T+  + 
Sbjct: 474 PFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSINKNKLGTLVYSL 533

Query: 528 IAGIFPFGSIAVEIYFIYTSLWYN 551
           I  I PF  I  E+Y+I+T+ W N
Sbjct: 534 ITAIVPFFIIKSELYWIFTNKWLN 557

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 103/500 (20%), Positives = 178/500 (35%), Gaps = 79/500 (15%)

Query: 23  VAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFH----FC 78
           V P TY  GD + ++VN +         ++EG                   ++H     C
Sbjct: 46  VHPNTYTFGDPVEVIVNKMVQEKDMLGDSNEG----------------VSYKYHDLPYIC 89

Query: 79  QPEKIEKQ-PESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKNG 137
            P   +K    SL  +  GD    S + L    +  C +LC         +   ++I   
Sbjct: 90  PPTNTKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDED 149

Query: 138 FFQNWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAEL 196
           +  NW ID  LPAA     + T    Y  GF LG  D      ET +             
Sbjct: 150 YIVNWFIDDYLPAATTYISSVTRKKKYFEGFSLGWKD-----PETGS------------- 191

Query: 197 DARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSI-QRSSPGSCES 255
                            Y  NH  + I Y+   +  + +VG  V P SI     PG+   
Sbjct: 192 ----------------YYINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARRG 235

Query: 256 TGQPLTLQEDEDNDVY----FTYSVTFVPS-ETSWATRWDKY-------LHVYDPTIQWF 303
            G    L++ E+ND +    F+YSV +    E  W TRW  +       L   D ++Q  
Sbjct: 236 HGH-YELKDLENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVRPNYMDLDAEDESLQLG 294

Query: 304 SLVN----FXXXXXXXXXXXXXXXXKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRI 359
            + N    +                  L  D   +    + +  +    W      + + 
Sbjct: 295 FISNLLHWYSPYTTVIIFTILLFLVSLLVLDINSHKLVFMSNP-KTVIAWATTANKLNKT 353

Query: 360 PHKSMXXXXXXXXXXQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYA--LFG-FVGS 416
               +           LFI +   +  ++L  L   S  ++  ++  + A  L G FVG+
Sbjct: 354 WKNILLNILVSMGCQALFIFMPVIVIQSSLWSLHNISNYVMLQIICWISASLLVGSFVGT 413

Query: 417 YTSMGVYKFFRGPYWKANM-VLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMV 475
           +  M +++    P +   M ++   ++PG     +   N    ++  +   P + L +++
Sbjct: 414 WLRMYMFQKKMTPNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRKLSWLI 473

Query: 476 LLWFVFSIPSAFAGSLVANK 495
            ++F+FSIP +  G  +A K
Sbjct: 474 FVYFIFSIPMSLIGGSLAVK 493

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 91/246 (36%), Gaps = 50/246 (20%)

Query: 77  FCQPEKIEKQP--ESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134
           F  P    K+P   SL  +  GD +  S + L   +++ C  LC         +    LI
Sbjct: 97  FVCPPSDTKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLI 156

Query: 135 KNGFFQNWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQG 193
           KN +   W +D  LP        +     Y  GF LG  D                 NQ 
Sbjct: 157 KNDYIVQWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYFD-----------------NQT 199

Query: 194 AELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSI-QRSSPGS 252
            +                  Y   H    + YH   +  + +VG+ V P SI   + PG+
Sbjct: 200 GQ-----------------AYLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPGA 242

Query: 253 CESTGQPLTLQEDEDND----VYFTYSVTFVPS-ETSWATRWDKY------LHVYDPTIQ 301
            +    PL ++  E+ND    + F+YSV +    +  W  RWD +      L   D +  
Sbjct: 243 SKD-FIPLEVKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSFH 301

Query: 302 WFSLVN 307
           W+SL+N
Sbjct: 302 WYSLIN 307

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 98/271 (36%), Gaps = 58/271 (21%)

Query: 25  PTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVXXXXXXXXXXXXXXXXRFHFCQPEKIE 84
           P+ Y  G+ + LLV+++     W  +   G                    F    P +  
Sbjct: 39  PSAYTRGERVQLLVDNI-----WTDREVWG---------------YYETLFTCPPPAEAR 78

Query: 85  KQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKNGFFQNWLI 144
               SLG +   +  + S + L++  E QC  LC   +  +  + + ++I++G    W +
Sbjct: 79  AIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWTL 138

Query: 145 DGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAELDARDAKNV 204
           DGLPAA    D R  +  Y +GF+LG                        E+DA      
Sbjct: 139 DGLPAATTYPD-RQSSYRYEAGFKLG------------------------EVDAETGH-- 171

Query: 205 KTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCESTGQPLTLQE 264
                   V   NH  + + Y    +G Y +VG    P S+        ++  +   L  
Sbjct: 172 --------VRLHNHVMLVVRYRILDDGRYVIVGFEAYPRSVAGEGCTGGQTEYEHFWLNP 223

Query: 265 DEDNDVY--FTYSVTF-VPSETSWATRWDKY 292
           D    +   FTY+V +   S   W  RW  Y
Sbjct: 224 DAQAMIMVPFTYAVYWRYQSAVKWNERWRLY 254

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 87/227 (38%), Gaps = 43/227 (18%)

Query: 78  CQPEKIEKQPE-SLGSIMFGDRIYNSPFQLNMLEEKQCASLC-KSTIPGNDAKFINKLIK 135
           C P K  +    SL  +  GDR + S ++L    E +C++LC + T P    +  + LI+
Sbjct: 76  CTPTKSRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIE-ADSLIR 134

Query: 136 NGFFQNWLIDG-LPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194
             +    LID  +PA+      R    +Y  GF LG VD                     
Sbjct: 135 QNYTVQLLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVD--------------------- 173

Query: 195 ELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRS-SPGSC 253
                           ++ Y  NH+ + I Y+      Y +VG  V P S+     PGS 
Sbjct: 174 -------------PETDVTYLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHCPGSS 220

Query: 254 ESTGQPLTLQEDEDNDVY--FTYSVTFVPS-ETSWATRWDKYLHVYD 297
           +   +   +   E + V+   TYSV +       W  RW+ YL   D
Sbjct: 221 KDY-ENYAVNPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGD 266

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 85/206 (41%), Gaps = 31/206 (15%)

Query: 480 VFSIPSAFAGSLVANKK----CNWNEHPTKTEQIA-RQIPFQPWYLKTIPATFIAGIFPF 534
           ++S+ + + G+ V+  K     N+      T   A  QIP   W  K    T I GI PF
Sbjct: 466 LYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHEQIPM--WLSKPFLITSIIGIIPF 523

Query: 535 GSIAVEIYFIYTSLWYNK--IFYMFGXXXXXXXXXXXXXXXXXXXITY--------HSLC 584
            +I +++ FI+  LW +   +F ++                    I Y           C
Sbjct: 524 LAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDSECC 583

Query: 585 LENW-----------NWQWRSFIVGGVGCAIYVFIHSILFTKF--KLGGFTTVVLYLGYX 631
            ++            +W+W++F +GG   A Y   +S+ +  F  +L  F +++LYL Y 
Sbjct: 584 FDDTCVTGRISNAVSSWRWKAFYMGGAA-AWYWEAYSLYYMIFILRLRNFGSILLYLSYG 642

Query: 632 XXXXXXXXXVTGSIGFLSSMFFVRKI 657
                      GSIG+L+  +F+ K+
Sbjct: 643 TLLNVFYFYSFGSIGYLACCWFLNKL 668

>NDAI0J02570 Chr10 complement(632112..638120) [6009 bp, 2002 aa] {ON}
            Anc_4.296 YLR422W
          Length = 2002

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 48/120 (40%), Gaps = 7/120 (5%)

Query: 93   IMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINK--LIKNGFFQNWLIDGLPAA 150
            I F + ++NS       E++   S     I  ND +++    L+      N  I+     
Sbjct: 971  IKFTEDLFNS-----CQEKENELSFATKKITMNDKEYLTTKFLLLRRILDNDKINSFLFT 1025

Query: 151  HEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAELDARDAKNVKTIKNV 210
             EAH T+  +DF     EL L   +   DE  A   +  AN        + KN + +KN+
Sbjct: 1026 EEAHTTQLQSDFLSRCLELPLQPYLLDNDEDLAEISIRLANSVTIKLIENIKNERVLKNI 1085

>Skud_13.466 Chr13 (828310..828331,828415..828809) [417 bp, 138 aa]
           {ON} YMR292W (REAL)
          Length = 138

 Score = 30.8 bits (68), Expect = 5.5,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 8/85 (9%)

Query: 400 LGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMY 459
           LG ++F++  +F  +GS  +   Y FF  P  +   +L    V GS+ I ++   FF   
Sbjct: 36  LGNILFLI-GVFLIIGSQKT---YVFFTRPNKRRGSLL---FVVGSLLI-LLKWTFFGFI 87

Query: 460 VHSSGVIPAKTLFFMVLLWFVFSIP 484
           + S G+I     FF V++ F+ S+P
Sbjct: 88  IESLGIIGLFGDFFGVIVQFLRSMP 112

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,311,323
Number of extensions: 2626146
Number of successful extensions: 7303
Number of sequences better than 10.0: 51
Number of HSP's gapped: 7221
Number of HSP's successfully gapped: 91
Length of query: 664
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 548
Effective length of database: 40,180,143
Effective search space: 22018718364
Effective search space used: 22018718364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)