Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B008807.350ON38138119440.0
CAGL0L01111g7.350ON38137815290.0
Ecym_47237.350ON38138115260.0
TPHA0F029707.350ON38137715240.0
KLLA0D12342g7.350ON38438015130.0
Kpol_530.317.350ON38037915120.0
YDL168W (SFA1)7.350ON38637915100.0
Suva_4.787.350ON38538015100.0
KLTH0H01254g7.350ON38137815060.0
TBLA0E00390singletonON38338115030.0
Kwal_56.246427.350ON38137814980.0
Skud_4.897.350ON38538114950.0
Smik_4.707.350ON38638014950.0
NCAS0A141607.350ON45137914960.0
ACL148C7.350ON38138114590.0
SAKL0F11374g7.350ON38338114500.0
TDEL0C019807.350ON38537814300.0
ZYRO0F11704g7.350ON38237914200.0
KNAG0C037907.350ON38238413061e-180
NDAI0A018907.350ON42237912531e-172
SAKL0A00880gsingletonON38838010641e-143
KLTH0G18986g8.16ON3543802222e-19
YBR145W (ADH5)3.118ON3513452186e-19
Suva_4.3943.118ON3513792187e-19
NCAS0I023503.118ON3513542161e-18
TBLA0I011402.480ON3773412171e-18
SAKL0C10164g3.118ON3513742142e-18
Suva_15.813.118ON3483632115e-18
KLLA0B00451gsingletonON3863732126e-18
Skud_2.2723.118ON3513452091e-17
CAGL0I07843g3.118ON3523622091e-17
YOL086C (ADH1)3.118ON3483622081e-17
Smik_15.713.118ON3483632082e-17
CAGL0J01441g2.480ON3723412082e-17
KLTH0G15686g3.118ON3513682072e-17
Smik_2.2843.118ON3513542063e-17
SAKL0F06270gna 1ON3513742054e-17
TBLA0E03430singletonON3513632054e-17
TBLA0E034403.118ON3513622045e-17
ABR229C8.16ON3533762036e-17
Ecym_53313.118ON3483592037e-17
SAKL0B00814g8.16ON3543432029e-17
AER032W3.118ON3513622029e-17
KNAG0K020003.118ON3503502011e-16
KLTH0D05588g2.480ON3893412002e-16
KLLA0D19929gsingletonON3863431993e-16
Suva_13.494na 2ON3483631974e-16
KAFR0A007902.480ON3773631984e-16
YMR303C (ADH2)na 2ON3483641965e-16
YMR083W (ADH3)2.480ON3753711975e-16
ZYRO0C12562gna 1ON3483681957e-16
Smik_13.2662.480ON3753711967e-16
KLLA0F21010g3.118ON3503711958e-16
NDAI0A069303.118ON3513441949e-16
Skud_15.683.118ON3483631949e-16
NCAS0I01720singletonON3513701941e-15
KAFR0G014203.118ON3513671941e-15
Kpol_1036.193.118ON3533631931e-15
Skud_13.2402.480ON3753711932e-15
Skud_13.477na 2ON3483641922e-15
Smik_13.520na 2ON3483621912e-15
Suva_13.2612.480ON3753411913e-15
TPHA0M007303.118ON3503741903e-15
Kwal_26.77992.480ON3873441904e-15
KLTH0D00616g7.3ON3823931895e-15
ZYRO0B05940g3.118ON3793711896e-15
NCAS0A077802.480ON3733441879e-15
Kwal_56.231983.118ON3513681879e-15
TDEL0D050503.118ON3513601861e-14
KLTH0E05588gna 1ON3483711851e-14
TPHA0G032102.480ON3773401852e-14
KLLA0F18260gsingletonON3483601842e-14
NDAI0H021602.480ON3813631843e-14
YJR159W (SOR1)na 3ON3573611823e-14
KLLA0B09064gna 4ON3742611824e-14
CAGL0D00198g7.3ON3833911816e-14
YDL246C (SOR2)singletonON3573611807e-14
Kwal_55.19574singletonON3563571807e-14
Smik_48.1singletonON3573951781e-13
SAKL0B08184gna 4ON3733711772e-13
TDEL0F03190na 1ON3513531762e-13
Suva_12.260singletonON3573651762e-13
Suva_10.1548.16ON3563711762e-13
ZYRO0G03410gsingletonON3733621735e-13
KNAG0K01040singletonON3913261745e-13
Kwal_26.6684singletonON3563451736e-13
TDEL0C003908.16ON3533011727e-13
AAR084WsingletonON3853331728e-13
KAFR0L02010singletonON3513621719e-13
YAL060W (BDH1)7.3ON3822391711e-12
KLLA0F13530g2.480ON3753681711e-12
Smik_1.67.3ON3822441701e-12
SAKL0E02838g2.480ON3773711701e-12
KLTH0A00418gsingletonON3563311692e-12
Skud_20.2singletonON3573621692e-12
Skud_4.2singletonON3573621692e-12
Skud_1.37.3ON3822411692e-12
ZYRO0G03388g2.480ON3703511682e-12
TBLA0A042907.3ON3952401683e-12
Kpol_1058.118.16ON3533621664e-12
Kpol_431.82.480ON3803431664e-12
Suva_1.77.3ON3822301656e-12
TDEL0A025602.480ON3733411656e-12
KLLA0F00506g7.3ON3853291657e-12
Ecym_73912.480ON3753781622e-11
ZYRO0F02552g8.16ON3513771612e-11
YLR070C (XYL2)8.16ON3563631603e-11
KNAG0E025902.480ON3743441593e-11
KAFR0I001607.2ON3853231568e-11
NCAS0A076707.2ON4392431569e-11
NCAS0J003008.16ON3573751541e-10
Kpol_1049.187.2ON3862421523e-10
Kwal_26.67397.3ON3822341505e-10
SAKL0D14872g7.3ON3831411505e-10
TDEL0H044607.3ON3822801497e-10
Kwal_55.20564singletonON2162161431e-09
KLLA0D05511g8.16ON3543861452e-09
ABL033C2.480ON3733731443e-09
KAFR0L02000singletonON3613601433e-09
SAKL0D14894g7.2ON3852411425e-09
NDAI0H020507.3ON3851421416e-09
Smik_2.1703.253ON3341551407e-09
Kwal_56.229853.253ON3462441381e-08
Suva_1.67.2ON4172421354e-08
YAL061W (BDH2)7.2ON4172421337e-08
YBR046C (ZTA1)3.253ON3341631328e-08
KNAG0I00120singletonON3813221311e-07
KAFR0I001707.3ON3812221311e-07
KLLA0A10549g3.253ON3531441274e-07
Smik_1.57.2ON4172421248e-07
Skud_1.27.2ON4172421249e-07
KAFR0C005803.253ON3341441221e-06
TDEL0D037203.253ON3352261212e-06
KLLA0F00528g7.2ON3812701212e-06
NCAS0A076607.3ON3862401193e-06
KNAG0D00110singletonON3622831193e-06
KLLA0F00638gna 5ON3821361151e-05
NDAI0H020607.2ON3992431132e-05
Kwal_47.17532na 6ON3733021033e-04
KLTH0C07854g3.253ON3582571024e-04
TPHA0H03100singletonON392296980.001
NDAI0H02950singletonON363316970.002
KNAG0E042007.2ON385398960.002
KLTH0C10538gsingletonON273150930.004
NCAS0D01220na 7ON362156900.011
TDEL0A00140singletonON405152900.011
SAKL0H00374gsingletonON428311880.024
Suva_6.13singletonON6859790.027
Ecym_1093singletonON383320850.050
KAFR0A08730singletonON360212840.075
NCAS0C03020singletonON362156780.31
NDAI0G04880singletonON361343780.34
KLTH0B04972gna 8ON360311770.45
Suva_13.513na 9ON360156760.59
KLTH0E07964gna 6ON374255760.72
SAKL0H22088gna 6ON376297750.84
Kwal_33.12956na 5ON411158750.97
CAGL0H06853gsingletonON360309722.1
Suva_14.2042.133ON376133712.5
Skud_13.494na 9ON360156712.5
Skud_86.1singletonON8959662.6
KLLA0E19889gna 8ON366175712.8
CAGL0M14047gna 9ON359319693.9
Smik_13.535na 9ON360156685.5
KLTH0B00506gna 5ON398190679.0
TPHA0F02090singletonON360295669.1
KAFR0J020602.165ON63850679.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B00880
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   753   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   593   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   592   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   591   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   587   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   587   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   586   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   586   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   584   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      583   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   581   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   580   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   580   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   580   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   566   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   563   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   555   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   551   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   507   e-180
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    487   e-172
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   414   e-143
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    90   2e-19
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    89   6e-19
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    89   7e-19
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     88   1e-18
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...    88   1e-18
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...    87   2e-18
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    86   5e-18
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...    86   6e-18
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    85   1e-17
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    85   1e-17
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    85   1e-17
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    85   2e-17
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...    85   2e-17
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    84   2e-17
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    84   3e-17
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    84   4e-17
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               84   4e-17
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    83   5e-17
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    83   6e-17
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...    83   7e-17
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    82   9e-17
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    82   9e-17
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    82   1e-16
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    82   2e-16
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...    81   3e-16
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    80   4e-16
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    81   4e-16
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    80   5e-16
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    80   5e-16
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    80   7e-16
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    80   7e-16
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    80   8e-16
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    79   9e-16
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    79   9e-16
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               79   1e-15
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    79   1e-15
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    79   1e-15
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    79   2e-15
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    79   2e-15
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    78   2e-15
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    78   3e-15
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    78   3e-15
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    78   4e-15
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    77   5e-15
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    77   6e-15
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    77   9e-15
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    77   9e-15
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    76   1e-14
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    76   1e-14
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    76   2e-14
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    75   2e-14
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     75   3e-14
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    75   3e-14
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    75   4e-14
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    74   6e-14
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    74   7e-14
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    74   7e-14
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    73   1e-13
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    73   2e-13
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    72   2e-13
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    72   2e-13
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    72   2e-13
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    71   5e-13
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    72   5e-13
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    71   6e-13
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    71   7e-13
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    71   8e-13
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              70   9e-13
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    70   1e-12
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    70   1e-12
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     70   1e-12
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    70   1e-12
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    70   2e-12
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     70   2e-12
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    70   2e-12
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     70   2e-12
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    69   2e-12
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    69   3e-12
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    69   4e-12
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    69   4e-12
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     68   6e-12
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    68   6e-12
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    68   7e-12
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    67   2e-11
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    67   2e-11
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    66   3e-11
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    66   3e-11
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    65   8e-11
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    65   9e-11
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       64   1e-10
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    63   3e-10
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    62   5e-10
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    62   5e-10
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    62   7e-10
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    60   1e-09
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    60   2e-09
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    60   3e-09
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              60   3e-09
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    59   5e-09
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    59   6e-09
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    59   7e-09
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    58   1e-08
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     57   4e-08
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    56   7e-08
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    55   8e-08
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  55   1e-07
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    55   1e-07
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    54   4e-07
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     52   8e-07
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      52   9e-07
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    52   1e-06
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    51   2e-06
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    51   2e-06
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    50   3e-06
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   50   3e-06
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    49   1e-05
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    48   2e-05
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    44   3e-04
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    44   4e-04
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    42   0.001
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    42   0.002
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    42   0.002
KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...    40   0.004
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               39   0.011
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 39   0.011
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    39   0.024
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    35   0.027
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    37   0.050
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    37   0.075
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    35   0.31 
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    35   0.34 
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    34   0.45 
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    34   0.59 
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    34   0.72 
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    33   0.84 
Kwal_33.12956 s33 complement(14925..16160) [1236 bp, 411 aa] {ON...    33   0.97 
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    32   2.1  
Suva_14.204 Chr14 complement(368893..370023) [1131 bp, 376 aa] {...    32   2.5  
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    32   2.5  
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    30   2.6  
KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} simi...    32   2.8  
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    31   3.9  
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    31   5.5  
KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON...    30   9.0  
TPHA0F02090 Chr6 (465913..466995) [1083 bp, 360 aa] {ON}               30   9.1  
KAFR0J02060 Chr10 (393802..395718) [1917 bp, 638 aa] {ON} Anc_2....    30   9.6  

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/381 (96%), Positives = 368/381 (96%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP
Sbjct: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60

Query: 61  EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120
           EGLFPCILGH             TSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET
Sbjct: 61  EGLFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120

Query: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180
           QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV
Sbjct: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180

Query: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240
           TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG
Sbjct: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240

Query: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300
           ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG
Sbjct: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360
           VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360

Query: 361 EINDGFEDLHMGTCLRTVLKF 381
           EINDGFEDLHMGTCLRTVLKF
Sbjct: 361 EINDGFEDLHMGTCLRTVLKF 381

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/378 (74%), Positives = 318/378 (84%)

Query: 4   TQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL 63
           T+GK I+C AAVAYEA KP VV+ ++VD PKAHEVRIKI+NTA+CHTDAYTLSG DPEGL
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGK 123
           FPC+LGH             T+VK GDHVI LYTAECQKCKFC SGKTNLCGAVR TQGK
Sbjct: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121

Query: 124 GVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTG 183
           GVMPDGTSRFH  +G+ ++HFMGCSTFSEYTVVADVSVVAID+   LE   LLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181

Query: 184 FGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATD 243
           +GAAVK ANVQKGDTVAVFG GTVGLSV+QGA  RG S++I +D ND+KK F   FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241

Query: 244 FVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAA 303
           F+NP  DLK+ ETIV KLI MTDGGLD+TFDCTGNV+VMR+ALEACHKGWGQS IIGVAA
Sbjct: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301

Query: 304 AGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIN 363
           AGQEISTRPFQLVTGRVW+G+AFG +KGR++M  L++ Y+KG LK+DEFITHRR F+EIN
Sbjct: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361

Query: 364 DGFEDLHMGTCLRTVLKF 381
           + F+DLH G CLRTVL F
Sbjct: 362 EAFDDLHNGLCLRTVLSF 379

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/381 (74%), Positives = 320/381 (83%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           MS T GK IQCKAA+AY A  PL ++ + VD PKAHEVRIKI +TA+CHTDAYTLSGVDP
Sbjct: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60

Query: 61  EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120
           EG+FP ILGH             T+VKVGDHVIPLYTAECQ+CKFC SGKTNLCG+VR T
Sbjct: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120

Query: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180
           QGKG+MPDGTSRF   +G+ I+HFMGCSTFSEYTVVADVSVVAID+K  L+   LLGCGV
Sbjct: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180

Query: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240
           TTG+GAAVK A+VQKGDTVAVFGAGTVGLSVVQGA+ RG SK+IVVDIND+KK++S+DFG
Sbjct: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240

Query: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300
           ATDF+NP  DL DGETIV+KLI MTDGGLD+TFDCTGN  VMR+ALEACHKGWGQS IIG
Sbjct: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360
           VAAAGQEISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY  G LK+DEF+TH R F 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360

Query: 361 EINDGFEDLHMGTCLRTVLKF 381
           EINDG  DLH G CLRTVL F
Sbjct: 361 EINDGLTDLHHGDCLRTVLNF 381

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/377 (74%), Positives = 321/377 (85%), Gaps = 1/377 (0%)

Query: 3   STQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEG 62
           S  GK I C AA+AYEA KPL V +++VD PKAHEVRIKI+ TA+CHTDAY+LSGVDPEG
Sbjct: 2   SAVGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEG 61

Query: 63  LFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQG 122
           LFPC+LGH             T+VKVGDHVI LYTAEC KCKFC SGKTNLCG+VR TQG
Sbjct: 62  LFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 123 KGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTT 182
           KGVMPDGT+RFH  +GK I+HFMGCSTFS+YTVVADVS+VA DK VS EP +LLGCGVTT
Sbjct: 122 KGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTT 181

Query: 183 GFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGAT 242
           G+GAA+K AN+QKGDTVAVFGAGTVGLSVVQGA+ RG SK+IVVD+N++KK +S++FGAT
Sbjct: 182 GYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGAT 241

Query: 243 DFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVA 302
           DFVNP  +LKD E IV+KLI MTDGGLD+TFDCTGNV+VMRNALEACHKGWGQS IIGVA
Sbjct: 242 DFVNP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVA 300

Query: 303 AAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEI 362
           AAGQEI+TRPFQLVTGRVWRG+AFG IKGR++M  L+ DY+ G LK+DEFIT RR F EI
Sbjct: 301 AAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEI 360

Query: 363 NDGFEDLHMGTCLRTVL 379
           N  FEDLH G+CLRTVL
Sbjct: 361 NAAFEDLHNGSCLRTVL 377

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/380 (73%), Positives = 321/380 (84%)

Query: 2   SSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPE 61
           S+T GK I+C AAVAYEA KPL V+ +IVDAPKAHEVR+++ +TA+CHTDAYTLSGVDPE
Sbjct: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62

Query: 62  GLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQ 121
           G FP ILGH             T+VKVGDHV+ LYTAEC KCKFCKS KTNLCG+VR TQ
Sbjct: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122

Query: 122 GKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVT 181
           GKGVMPDGT+RFH L+G+ + HFMGCSTFS+YTVVADVS+V ID    L    LLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182

Query: 182 TGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGA 241
           TG+GAAVK ANVQ+GDTVAVFGAGTVGLSVVQGA+ RG SK+IVVD+ND+KKQ+S DFGA
Sbjct: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242

Query: 242 TDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGV 301
           T FVNP+ DLK+GETIV+KLI MTDGGLD+TFDCTGNV VMR+ALEACHKGWGQS IIGV
Sbjct: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDE 361
           AAAG+EISTRPFQL+TGRVW+G+AFG IKGR++M QL+  Y+KG LK+D+FITH+R F E
Sbjct: 303 AAAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362

Query: 362 INDGFEDLHMGTCLRTVLKF 381
           IN+ FEDLH G CLRTVL  
Sbjct: 363 INNAFEDLHHGDCLRTVLDL 382

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/379 (73%), Positives = 324/379 (85%), Gaps = 1/379 (0%)

Query: 3   STQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEG 62
           ST GK I C+AAVAYEA KPLVV++++VD PKAHEVRIKI+NTA+CHTDAYTLSGVDPEG
Sbjct: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61

Query: 63  LFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQG 122
           LFPC+LGH             T+VK GDHV+ LYTAEC KCKFC SGKTNLCG+VR TQG
Sbjct: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 123 KGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTT 182
           KGVMPDGT RFH  +G+ ++HFMGCSTFSEYTVVADVSVVAID    L+   LLGCGVTT
Sbjct: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181

Query: 183 GFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGAT 242
           G+GAA+K ANVQKGDTVAVFGAGTVGLSVVQGA+ RG SK+IVVDIN++KK++S +FGAT
Sbjct: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241

Query: 243 DFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVA 302
           DFVNP ++L +G+ IV+KL+ MTDGGLD+TFDCTGNV+VMR+ALEACHKGWGQS IIGVA
Sbjct: 242 DFVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300

Query: 303 AAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEI 362
           AAG+EISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+ G LK+DEFIT+RR F EI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360

Query: 363 NDGFEDLHMGTCLRTVLKF 381
           ND FE+LH G CLRTVL F
Sbjct: 361 NDAFEELHHGNCLRTVLSF 379

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/379 (73%), Positives = 317/379 (83%)

Query: 2   SSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPE 61
           ++T GK I+C AAVAY+AKKPL V+++ VDAPKAHEVRIKI  TA+CHTDAYTLSG DPE
Sbjct: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 62  GLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQ 121
           GLFPC+LGH              +VK GDHVI LYTAEC KCKFC SGKTNLCGAVR TQ
Sbjct: 63  GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQ 122

Query: 122 GKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVT 181
           GKGVMPDGT+RFH  +G+DI+HFMGCSTFSEYTVVADVSVVAID K  L+ A LLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182

Query: 182 TGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGA 241
           TGFGAA+K ANVQKGDTVAVFG GTVGLSV+QGA++RG SK+I +DIN++KKQ+   FGA
Sbjct: 183 TGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQFGA 242

Query: 242 TDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGV 301
           TDFVNP  DL   +TIV KLI MTDGGLD+TFDCTGN  +MR+ALEACHKGWGQS IIGV
Sbjct: 243 TDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDE 361
           AAAG+EISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+KG LK++EFITHRR F E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKE 362

Query: 362 INDGFEDLHMGTCLRTVLK 380
           IN  FEDLH G CLRTVLK
Sbjct: 363 INQAFEDLHNGDCLRTVLK 381

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/380 (73%), Positives = 317/380 (83%)

Query: 2   SSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPE 61
           +ST GK IQC AA+AY+AKKPL V+++ VD PKAHEVRIKI  TA+CHTDAYTLSG DPE
Sbjct: 3   ASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 62  GLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQ 121
           GLFPCILGH             T+VK GDHVI LYTAEC KCKFC SGKTNLC AVR TQ
Sbjct: 63  GLFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122

Query: 122 GKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVT 181
           G+G+MPD T+RFH  +G+DI+HFMGCSTFSEYTVVADVSVVAID K  L+ ASLLGCGVT
Sbjct: 123 GRGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCGVT 182

Query: 182 TGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGA 241
           TG+GAAVK ANVQKGDTVAVFG GTVGLSV+QGA+ RG SK+I +DIN++KKQ+ +DFGA
Sbjct: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDFGA 242

Query: 242 TDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGV 301
           TDF+NP  DL  G+TIV KLI  TDGGLD+TFDCTGN  +MR+ALEACHKGWGQS IIGV
Sbjct: 243 TDFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDE 361
           AAAG+EISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+ G LK++EFITHRR F E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPFKE 362

Query: 362 INDGFEDLHMGTCLRTVLKF 381
           IN  FEDLH G CLRTVLKF
Sbjct: 363 INQAFEDLHQGDCLRTVLKF 382

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/378 (74%), Positives = 317/378 (83%)

Query: 4   TQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL 63
           ++GK I C AAVAYEA KPL V++++VD PKAHEVRIK+  TA+CHTDAYTLSGVDPEG 
Sbjct: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGK 123
           FP ILGH             T+VK GDHVI LYTAEC++CKFCKSGKTNLCG+VR TQGK
Sbjct: 62  FPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 124 GVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTG 183
           GVMPDGTSRFH  +G+D+ HFMGCSTFS+YTVVADVSVVAID K  L+   LLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 184 FGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATD 243
           +GAAVK A+VQKGDTVA+FGAGTVGLSVVQGA +RG SK+IVVDIND+KKQ+S DFGATD
Sbjct: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241

Query: 244 FVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAA 303
           FVNP   LKDG+TIV+KL+ MTDGGLD+TFDCTGN  VMR+ALEACHKGWGQS IIGVAA
Sbjct: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301

Query: 304 AGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIN 363
           AG+EISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY  G LK+DEFITHRR F +IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361

Query: 364 DGFEDLHMGTCLRTVLKF 381
             FEDLH G CLRTVL  
Sbjct: 362 SAFEDLHHGDCLRTVLDL 379

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/381 (72%), Positives = 321/381 (84%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           MS TQGK I+C AAVAY+A +PL V+++IV+ P+AHEVRIKI +TA+CHTDAYTLSGVDP
Sbjct: 1   MSETQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDP 60

Query: 61  EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120
           EG FPC+LGH             +SVKVGDHVI LYTAEC  CKFCKSGKTNLCG+VRET
Sbjct: 61  EGAFPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRET 120

Query: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180
           QGKGVMPDGTSRF  L+G+ + HFMGCSTFS+YTVVADVSVVAI+K   L+   LLGCGV
Sbjct: 121 QGKGVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGV 180

Query: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240
           TTG+GAA+K ANVQK DTVAVFGAGTVGLSVVQGA+ RG SK+I+VD+N +K+ +S  FG
Sbjct: 181 TTGYGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFG 240

Query: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300
           ATDF+NPMTDLK GETIV+KL+ MTDGGLD+TFDCTGNV VMR+ALE CHKGWGQS IIG
Sbjct: 241 ATDFINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360
           VAAAGQEISTRPFQLVTGRVW+G+AFG +KGR++M  L++ Y+KG LK+D+FIT++R F 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFT 360

Query: 361 EINDGFEDLHMGTCLRTVLKF 381
           EIN  FEDLH G CLRTVL  
Sbjct: 361 EINAAFEDLHHGDCLRTVLDL 381

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/378 (73%), Positives = 318/378 (84%)

Query: 4   TQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL 63
           ++GK I C AAVAYEA KPL +++++VD PKAHEVR+KI  TA+CHTDAYTLSGVDPEG 
Sbjct: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGK 123
           FP ILGH             T+VK GDHVI LYTAEC++CKFCKSGKTNLCG+VR TQGK
Sbjct: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 124 GVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTG 183
           GVMPDGT+RFH  +G+DI HFMGCSTFS+YTV+ADVSVVAID K  L+   LLGCGVTTG
Sbjct: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 184 FGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATD 243
           +GAAVK ANVQKGDTVAVFGAGTVGLSVVQGA++RG S++IVVDIND+KKQ++ +FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241

Query: 244 FVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAA 303
           FVNP  DLKDG+TIV+ L+ MTDGGLDYTFDCTGN  VMR+ALEACHKGWG+S IIGVAA
Sbjct: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301

Query: 304 AGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIN 363
           AG+EISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY  G LK+DEFITHRR F +IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361

Query: 364 DGFEDLHMGTCLRTVLKF 381
             FEDLH G CLRTVL  
Sbjct: 362 SAFEDLHHGDCLRTVLDL 379

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/381 (72%), Positives = 317/381 (83%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           +++T GK IQC AAVAY AKK L V+++ VD PKAHEVRIKI  TA+CHTDAYTLSG DP
Sbjct: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61

Query: 61  EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120
           EGLFPCILGH              +VK GDHVI LYTAEC KCKFC SGKTNLC AVR T
Sbjct: 62  EGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRAT 121

Query: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180
           QGKGVMPDGT+RFH  +G+DI+HFMGCSTFSEYTVVADVSVVAID K  L+ A LLGCGV
Sbjct: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181

Query: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240
           TTG+GAA+K ANVQ+GDTVAVFG GTVGLSV+QGA+ RG SK+I VDIN++K+Q+S +FG
Sbjct: 182 TTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241

Query: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300
           ATDF+NP  DL + +TIV KLI MTDGGLD+TFDCTGN ++MR+ALEACHKGWGQS IIG
Sbjct: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIIIG 301

Query: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360
           VAAAG+EISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+ G LK++EFITHRR F 
Sbjct: 302 VAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFK 361

Query: 361 EINDGFEDLHMGTCLRTVLKF 381
           EIN  FEDLH G CLRTVL+F
Sbjct: 362 EINQAFEDLHNGDCLRTVLRF 382

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/380 (72%), Positives = 315/380 (82%)

Query: 2   SSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPE 61
           ++T GK I+C AAVAY+AKKP  V+++ VDAPKAHEVRIKI  TA+CHTDAYTLSG DPE
Sbjct: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 62  GLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQ 121
           GLFPCILGH              +VK GDHVI LYTAEC KCKFC SGKTNLC AVR TQ
Sbjct: 63  GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122

Query: 122 GKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVT 181
           GKGVMPDGT+RFH  +GKDI+HFMGCSTFSEYTVVADVSVVAID K  L+ + LLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVT 182

Query: 182 TGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGA 241
           TG+GAAVK ANVQKGDTVAVFG GTVGLSV+QGA++RG SK+I VDIN+ KK++   FGA
Sbjct: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGA 242

Query: 242 TDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGV 301
           TDF+NP  DL   +TIV KL+ MTDGGLD+TFDCTGN  +MR+ALEACHKGWGQS IIGV
Sbjct: 243 TDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDE 361
           AAAG+EISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+ G+LK++EFITHRR F E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKE 362

Query: 362 INDGFEDLHMGTCLRTVLKF 381
           IN  FEDLH G CLRTVLKF
Sbjct: 363 INHAFEDLHNGDCLRTVLKF 382

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/379 (75%), Positives = 322/379 (84%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           MSSTQGK I C AAVAY A KPL V+ ++VD PKAHEVRIKI  TA+CHTDAYTLSG+DP
Sbjct: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128

Query: 61  EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120
           EG FP ILGH             T+VKVGDHVI LYTAEC KCKFCKSGKTNLCG+VR T
Sbjct: 129 EGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188

Query: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180
           QGKGVMPDGTSRFH  +G+ + HFMGCSTFS+YTVVADVSVVA+D K  L+  SLLGCGV
Sbjct: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGV 248

Query: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240
           TTG+GAA+K ANVQKGDTVAVFGAGTVGLSVVQGA+ RG SK+IVVDIN++KKQ+S+DFG
Sbjct: 249 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308

Query: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300
           ATDFVNP  DLK+GETIV KLI MTDGGL+YTFDCTGNV VMR+ALEACHKGWG+S IIG
Sbjct: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIG 368

Query: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360
           VA AG+EISTRPFQLVTGRVW+G+AFG IKGR++M  L++DY+ G LK+DEFITHRR F 
Sbjct: 369 VAGAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFT 428

Query: 361 EINDGFEDLHMGTCLRTVL 379
           EIND FEDLH G CLRTVL
Sbjct: 429 EINDAFEDLHHGDCLRTVL 447

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/381 (73%), Positives = 319/381 (83%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           MS TQGK IQC AAVAY A +PL ++ V VD PKAHEVRIKI+N+AICHTDAYTLSG DP
Sbjct: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60

Query: 61  EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120
           EGLFPCILGH             T+VK GDHV+PLYTAECQ+CKFC SGKTNLCGAVR T
Sbjct: 61  EGLFPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120

Query: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180
           QGKGVMPDGTSRF   +G+ ++HFMGCSTFSEYTVVADVSVVA+D++  LE   LLGCGV
Sbjct: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGV 180

Query: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240
           TTG+GAAVK A+VQ+GDTVAVFGAGTVGLSVVQGA+ R  S++IVVDIND K++++  FG
Sbjct: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240

Query: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300
           ATDF+NP TDLK+GETIV +LI MTDGGLD+TFDCTGN  VMR+ALEACHKGWGQS IIG
Sbjct: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360
           VAAAGQEISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY  G LK+ EF+TH+R F+
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360

Query: 361 EINDGFEDLHMGTCLRTVLKF 381
           EIN GFEDLH G CLRTVL  
Sbjct: 361 EINSGFEDLHHGDCLRTVLSL 381

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/381 (74%), Positives = 316/381 (82%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           MS T GK I C AAVAYEA KPL V+++IV+ PKAHEVRI+I  TA+CHTDAYTLSGVDP
Sbjct: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60

Query: 61  EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120
           EG FP ILGH             T+VK GDHV+ LYTAECQKCKFC SGKTNLCG+VR T
Sbjct: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120

Query: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180
           QGKGVMPDGTSRF T  G+ I HFMGCSTFS+YTVVADVSVVA+D +  L+   LLGCGV
Sbjct: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGV 180

Query: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240
           TTG+GAA+K ANVQKGDTVAVFGAGTVGLSVVQGA+ RG S++IVVDIND+KKQ++ DFG
Sbjct: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240

Query: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300
           ATDFVNP  DLK+GETIV+KLI +TDGGLD+TFDCTGN  VMR+ALEACHKGWGQS IIG
Sbjct: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360
           VAAAGQEISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY  G LK+DEFITHRR F 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360

Query: 361 EINDGFEDLHMGTCLRTVLKF 381
           EIN  F+DLH G CLRTVL  
Sbjct: 361 EINAAFDDLHHGDCLRTVLDL 381

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/378 (72%), Positives = 317/378 (83%)

Query: 2   SSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPE 61
           ++T+GK+I C AAVAYEA KPL V+++ V+AP+AHEVRIKI  TA+CHTDAYTLSGVDPE
Sbjct: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63

Query: 62  GLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQ 121
           G FP ILGH             T+VK GDHVI LYTAECQKCKFCKSGKTNLC +VR TQ
Sbjct: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123

Query: 122 GKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVT 181
           GKGVMPDGTSRF   +G+++ HFMGCSTFS+YTVVADVSVVA+D    LE   LLGCGVT
Sbjct: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVT 183

Query: 182 TGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGA 241
           TG+GAA K ANVQKGDTVAVFGAGTVGLSV+QGA++RG S++I+VDIND+K+++  +FGA
Sbjct: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243

Query: 242 TDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGV 301
           TDF+NP +DLKDG+TIV KLI MTDGGLDYTFDCTGN  VMR+ALEACHKGWG S IIGV
Sbjct: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303

Query: 302 AAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDE 361
           AAA +EISTRPFQLVTGRVW+G+AFG IKGR++M  L++DY+KG LK+DEFIT+ R F E
Sbjct: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363

Query: 362 INDGFEDLHMGTCLRTVL 379
           IN  FEDLH G CLRTVL
Sbjct: 364 INKAFEDLHAGDCLRTVL 381

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/379 (71%), Positives = 314/379 (82%)

Query: 3   STQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEG 62
           ST+GK +   AAVAYEA KPL V+++ VD PKAHEVRI++  TA+CHTDAYTLSG DPEG
Sbjct: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61

Query: 63  LFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQG 122
            FP ILGH             TSVK GDHV+ LYTAEC KCKFCKSGKTNLCG+VR TQG
Sbjct: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121

Query: 123 KGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTT 182
           KGVMPDGTSRF   +G+ + HFMGCSTFSEYTVVADVSVVA+D K  LE A LLGCGVTT
Sbjct: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTT 181

Query: 183 GFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGAT 242
           G+GAAVK ANVQKGDTVA+FGAGTVGLSV QGA+ RG S++I+VDIND KK++ ++FGAT
Sbjct: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241

Query: 243 DFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVA 302
           DF+NP TDL++G+TIV KLI MTDGGLD+TFDCTGNV VMR+ALEACHKGWG S +IGVA
Sbjct: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVA 301

Query: 303 AAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEI 362
           A+GQEISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+ G LK+DEFIT+RR F +I
Sbjct: 302 ASGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361

Query: 363 NDGFEDLHMGTCLRTVLKF 381
           N+ FEDLH G  LRTVL +
Sbjct: 362 NEAFEDLHAGDSLRTVLNY 380

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  507 bits (1306), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 254/384 (66%), Positives = 296/384 (77%), Gaps = 5/384 (1%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           M++T+G+ I C AAVAY A KPL V+ + V+AP     R    +   C+     +  V  
Sbjct: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTG--ARGAYQDHQHCYLPHGCVHSVWF 58

Query: 61  EGLFPCI---LGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAV 117
                C+    G              TSVKVGDHVI LYTAEC++CK CKSGKTNLC AV
Sbjct: 59  GSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAV 118

Query: 118 RETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLG 177
           R TQGKGVMPDGTSRF   +G+ + HFMGCSTF+EYTVVADVSVVAID+   LE   LLG
Sbjct: 119 RATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLG 178

Query: 178 CGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSY 237
           CGVTTG+GAA+K ANVQKGDTVAVFGAGT+GLSVVQGA+ R  SK+IVVDIND KK+F++
Sbjct: 179 CGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAF 238

Query: 238 DFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSF 297
           DFGATDFVNP TDLKDG+TIV KL+ MTDGGLD+TFD TGNV VMR+ALEACHKGWGQS 
Sbjct: 239 DFGATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSI 298

Query: 298 IIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRR 357
           IIGVAAAG+EISTRPFQLVTGRVW+G+AFG +KGR++M  L++DY KG LKIDEFIT++R
Sbjct: 299 IIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKR 358

Query: 358 QFDEINDGFEDLHMGTCLRTVLKF 381
            F EIN+GFEDLH G CLRTVL +
Sbjct: 359 PFKEINEGFEDLHHGDCLRTVLNY 382

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  487 bits (1253), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 243/379 (64%), Positives = 275/379 (72%), Gaps = 46/379 (12%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           MS+TQGK I C AAVAYEA KPL V+D++VD PKAHEVRIKI  TA+CHTDAYTLSGVDP
Sbjct: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145

Query: 61  EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120
           EG FP ILGH             T+VKVGDHVI LYTAEC +CKFCKSG           
Sbjct: 146 EGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGECKFCKSGXXX-------- 197

Query: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180
                                                     A+DK   ++   LLGCGV
Sbjct: 198 --------------------------------------XXXXAVDKNAPMDSICLLGCGV 219

Query: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240
           TTG+GAA+K ANVQKGDTVAVFGAGTVGLSVVQGA+ RG SK+IVVD+ND+KKQ+S DFG
Sbjct: 220 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFG 279

Query: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300
           ATDF+NP TDLK+GETIV+KLI MTDGGL+YTFDCTGN  VMR+ALEACHKGWG+S IIG
Sbjct: 280 ATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIIIG 339

Query: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360
           VAAAG+EISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+ G LK+DEFITHRR F 
Sbjct: 340 VAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFT 399

Query: 361 EINDGFEDLHMGTCLRTVL 379
           EIN+ FEDLH G CLRTVL
Sbjct: 400 EINNAFEDLHHGDCLRTVL 418

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  414 bits (1064), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 197/380 (51%), Positives = 263/380 (69%), Gaps = 3/380 (0%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           M   +G+ I+C AAVAY   KPLV++ +IVD P+ HEVR+K+ NTA+C TD +TL G++P
Sbjct: 1   MFYKEGEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNP 60

Query: 61  EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120
           EG FPC+LGH              +VK GDHV+ LY  EC  C  CKS K+NLC  ++ T
Sbjct: 61  EGKFPCVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKAT 120

Query: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180
           Q +GVMP G+SR H LE K ++HFMGCS+FS+Y VV+D+S V I     L+   LLGCGV
Sbjct: 121 QAQGVMPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGV 180

Query: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240
           TTGFGA + A  V+ GD VAVFG+GTVGLSVVQ      C +VIVVD+ D K++++  FG
Sbjct: 181 TTGFGAPI-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFG 239

Query: 241 ATDFVNPMTDLKDGETIVNKLISMTDG-GLDYTFDCTGNVHVMRNALEACHKGWGQSFII 299
           ATDF+NP    K+ ++++  LI  + G G D+TFDCTG+  VMR ALE+C KGWG S II
Sbjct: 240 ATDFINPQKIPKN-KSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVII 298

Query: 300 GVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQF 359
           G+A AG+EIST P+ L+ GR W G AFG +KGR+++P L++ Y    +K+DE+IT++R  
Sbjct: 299 GLAGAGEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPL 358

Query: 360 DEINDGFEDLHMGTCLRTVL 379
            EIN+  ++L  G  L+TVL
Sbjct: 359 KEINEALKELEDGLVLKTVL 378

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 102/380 (26%), Positives = 161/380 (42%), Gaps = 57/380 (15%)

Query: 1   MSSTQGKAIQC-KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDA-YTLSGV 58
           M+ TQ   +   K  +A E+K    + D        H V+++I  T IC +D  Y ++G 
Sbjct: 1   MNETQEAIVLVQKGEIAVESKPVPEITD-------PHYVKLQIKKTGICGSDVHYYVAGA 53

Query: 59  DPEGLF--PCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGA 116
             + +   P ILGH             + V+VGD V        +     K+G+ NLC  
Sbjct: 54  IGDFVVKKPMILGHESSGLVVEVGSEVSRVRVGDRVAIEPGVPSRYSDETKAGRYNLC-- 111

Query: 117 VRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASL- 175
               Q     P        ++G  + +++    F          +V +   VS E  +L 
Sbjct: 112 -PHMQFAATPP--------IDGTLVKYYLAPEDF----------LVKLPDHVSYEEGALV 152

Query: 176 --LGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKK 233
             L  GV      A K A V     VAVFGAG VGL     AR  G S+V+ +D+ + K 
Sbjct: 153 EPLSVGVH-----ANKLAGVAFNQRVAVFGAGPVGLLTGAVARAFGASEVVYIDVFEHKL 207

Query: 234 QFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGL-DYTFDCTGNVHVMRNALEACHKG 292
             S +FG T FVN   ++KD + +V ++  +  G   D  FDCTG    +R  ++ C+ G
Sbjct: 208 SLSSNFGGTQFVN-SANIKDEDDLVKEIERVLGGARPDVVFDCTGAEICIRTGIKVCNSG 266

Query: 293 WGQSFIIGVAAAGQEISTRPFQLVTGRVWR-----GTAFGDIKGRTDMPQLLDDYEKGLL 347
            G    +G+   G +    P   +  +  +       AFGD +   D  QL+     G +
Sbjct: 267 -GTYVQVGM---GHDDVNFPIGAIGAKELKVLGCFRYAFGDYR---DAVQLI---ASGDV 316

Query: 348 KIDEFITHRRQFDEINDGFE 367
            +   +THR +F++    +E
Sbjct: 317 NVKPLVTHRFKFEDAEAAYE 336

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 88.6 bits (218), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 101/345 (29%), Positives = 143/345 (41%), Gaps = 45/345 (13%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           KA V YE    L  +DV V  PK +E+ + +  + +CH+D +   G  P  L FP I GH
Sbjct: 11  KAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGH 70

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           KVGD   I      C  C++C+ G  + C  +          DG
Sbjct: 71  EGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL----------DG 120

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
           T   H              TF EY     V    I   V+L E A +L  G+T     A+
Sbjct: 121 TGFTHD------------GTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITV--YKAL 166

Query: 189 KAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K ANV  G  V + GA G +G   +Q A   G  +VI +D  + K++     G   F++ 
Sbjct: 167 KRANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIFID- 224

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEA----CHKGWGQSFIIGVAA 303
            T+ KD   IV  +I  T+GG         NV V   A+EA    C    G   ++G+ A
Sbjct: 225 FTEEKD---IVGAIIKATNGGSHGVI----NVSVSEAAIEASTRYCRPN-GTVVLVGMPA 276

Query: 304 AGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
                S    Q+V      G+  G+   R D  + LD + +GL+K
Sbjct: 277 HAYCNSDVFNQVVKSISIVGSCVGN---RADTREALDFFARGLIK 318

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 109/379 (28%), Positives = 152/379 (40%), Gaps = 48/379 (12%)

Query: 3   STQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEG 62
           S+Q      KA V YE    L  +D+ V  PKA+E+ + +  + +CH+D +   G  P  
Sbjct: 2   SSQAIPESQKAIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPFQ 61

Query: 63  L-FPCILGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRET 120
           L FP I GH                KVGD   I      C  C++C+ G  + C      
Sbjct: 62  LKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQC---PHL 118

Query: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCG 179
            G G   DG                   TF EY     V    + + V L E A +L  G
Sbjct: 119 DGTGFTHDG-------------------TFQEYATADAVQAAHLPENVDLAEVAPILCAG 159

Query: 180 VTTGFGAAVKAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYD 238
           VT     A+K AN+  G  V + GA G +G   +Q A   G  +VI +D  + KKQ    
Sbjct: 160 VTV--YKALKRANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEG 216

Query: 239 FGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEA----CHKGWG 294
            G   F++  T  KD   IV  +I  TDGG         NV V   A+EA    C    G
Sbjct: 217 LGGEVFID-FTKEKD---IVGAVIKATDGGSHGVI----NVSVSEAAIEASTRYCRPN-G 267

Query: 295 QSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFIT 354
              ++G+ A     S    Q+V      G+  G+   R D  + LD + + L+K    + 
Sbjct: 268 TVVLVGMPAHAYCKSDVFNQVVKSISIVGSCVGN---RADTREALDFFARHLVKSPIRLA 324

Query: 355 HRRQFDEINDGFEDLHMGT 373
                 EI   FE +  G+
Sbjct: 325 GLSDVPEI---FEKMENGS 340

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 89/354 (25%), Positives = 151/354 (42%), Gaps = 40/354 (11%)

Query: 23  LVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGHXXXXXXXXXXX 81
           L  +D+ V  PK++E+ I +  + +CHTD +   G  P     P + GH           
Sbjct: 22  LEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGD 81

Query: 82  XXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKD 140
                K+GD+  I      C  C++C+ G  + C            P      +T +G  
Sbjct: 82  AVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNC------------PHADLSGYTHDG-- 127

Query: 141 IFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAVKAANVQKGDTV 199
                   +F +Y     V    I     L E A +L  G+T     A+K+AN++ G+ V
Sbjct: 128 --------SFQQYATADAVQAARIAPGSDLAEVAPVLCAGITV--YKALKSANLRAGEWV 177

Query: 200 AVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIV 258
           A+ GA G +G   +Q A+  G  +V+ +D  DEK +   D G   F++  T  KD   IV
Sbjct: 178 AISGACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKDLGGEVFID-FTKTKD---IV 232

Query: 259 NKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTG 318
             +I  T+GG     + + +   +  +++ C    G + ++G+    Q  S    Q+V  
Sbjct: 233 GDIIKATNGGAHGVINVSVSEQAIDASVKYCRAN-GTAVLVGMPGGAQVKSDVFNQVVKS 291

Query: 319 RVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFEDLHMG 372
               G+  G+   R D  + LD + +GL+K      H  +  ++ + FE +  G
Sbjct: 292 ISIVGSYVGN---RADTREALDFFSRGLVKSP---IHIAKLSDVPEIFEKMEKG 339

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 89/341 (26%), Positives = 141/341 (41%), Gaps = 37/341 (10%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           KA V YE   PL    + V  PK +E+ I +  + +CHTD +   G  P  +  P + GH
Sbjct: 37  KAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGH 96

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                         + ++GD+  I      C  C+ C+ G  + C               
Sbjct: 97  EGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNC--------------- 141

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
                  E  D+  +    +F +Y     V    I K V L E A +L  GVT     A+
Sbjct: 142 -------EQADLSGYTHDGSFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTV--YKAL 192

Query: 189 KAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K A+V+ G  VA+ GA G +G   VQ A+  G  +V+ +D  DEKK+  +  G   FV  
Sbjct: 193 KTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIFV-- 249

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQE 307
             D     +IV  +  +T+GG     + + +      + E      G   ++G+ A    
Sbjct: 250 --DFTKTHSIVKDIQDVTNGGPHGVINVSVSELATSMSTEYVRPA-GTVVLVGLPANSYV 306

Query: 308 ISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
            S     +V     +G+  G+   R D  + LD +++GL+K
Sbjct: 307 KSEVFSHVVKSINIKGSYVGN---RADTREALDFFQRGLVK 344

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score = 87.0 bits (214), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 97/374 (25%), Positives = 155/374 (41%), Gaps = 44/374 (11%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           MS+ Q    Q KA + YE    L  +D+ V  PK++E+ I I  + +CHTD +   G  P
Sbjct: 1   MSAPQIPETQ-KAVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWP 59

Query: 61  -EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVR 118
                P + GH                K+GD+  I      C  C++C+    + C    
Sbjct: 60  LPTKLPLVGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC---- 115

Query: 119 ETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLG 177
                   PD     +T +G          +F +Y     V    I     L E A +L 
Sbjct: 116 --------PDADLSGYTHDG----------SFQQYATADAVQAARIAPGTDLAEVAPVLC 157

Query: 178 CGVTTGFGAAVKAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFS 236
            G+T     A+K+AN++ G+ VA+ GA G +G   +Q A+  G  +V+ +D  DEK    
Sbjct: 158 AGITV--YKALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALF 214

Query: 237 YDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGW 293
            + G   F++  T  KD   +V  ++  T+GG         NV V   A+EA     +  
Sbjct: 215 KELGGEVFID-FTKTKD---VVKAVVDATNGGAHGVI----NVSVSEAAIEASTVYCRAN 266

Query: 294 GQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFI 353
           G   ++G+    +  S    Q+V      G+  G+   R D  + LD + +GL+K    +
Sbjct: 267 GTVVLVGLPGGAKCKSDVFNQVVKSISIVGSYVGN---RADTREALDFFSRGLVKSPIMV 323

Query: 354 THRRQFDEINDGFE 367
               +   I +  E
Sbjct: 324 VGLSELPSIYEKME 337

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 85.9 bits (211), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 96/363 (26%), Positives = 151/363 (41%), Gaps = 43/363 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE+   L  +D+ V  PKA+E+ I +  + +CHTD +   G  P  +  P + GH
Sbjct: 8   KGVIFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGH 67

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                            +GD   I      C  C++C+ G  + C            P  
Sbjct: 68  EGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNC------------PHA 115

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I K   L E A +L  G+T     A+
Sbjct: 116 DLSGYTHDG----------SFQQYATADSVQAAHIPKGTDLAECAPVLCAGITV--YKAL 163

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+AN+  G  VA+ G AG +G   VQ A+  G  +V+ +D  + K++     G   F++ 
Sbjct: 164 KSANLSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVFIDF 222

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
            T+ KD   IV  +I  TDGG         NV V   A+EA     +  G + ++G+ A 
Sbjct: 223 TTE-KD---IVGAVIKATDGGAHGII----NVSVSEAAIEASTRYCRANGTTVLVGMPAG 274

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
            +  S    Q+V      G+  G+   R D  + LD + +GL+K    +       EI +
Sbjct: 275 AKCCSDVFNQVVKSISIVGSYVGN---RADTREALDFFARGLVKSPIKVVGLSTLPEIYE 331

Query: 365 GFE 367
             E
Sbjct: 332 KME 334

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 95/373 (25%), Positives = 154/373 (41%), Gaps = 55/373 (14%)

Query: 14  AVAYEAKKPLVVQDVIVDAPKAHEVR---IKIMNTAICHTDAYTLSGVDPE--------- 61
           A+ Y     L  +D  +  PK  + R   IK+ NT+IC TD     G  PE         
Sbjct: 33  AMVYYGANDLRFEDRAI--PKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVKNE 90

Query: 62  GLFPC-ILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120
           G F   +LGH              ++K GD VI      C  C+ C  G    C      
Sbjct: 91  GSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC------ 144

Query: 121 QGKGVMPDGTSRF-HTLEGKDIFHFMGCSTFSEY--TVVADVSVVAIDKKVSLEPASLLG 177
                M DG     ++++G          T +EY  T  AD S+ A+ + +S E A LL 
Sbjct: 145 -----MNDGGWALGYSIDG----------TQAEYVRTPFADTSLYALPEGLSDENAVLLS 189

Query: 178 CGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSY 237
             + T     V+  NV+ GD+VA+ GAG VG+  V  +++   S +IVVD++D + + + 
Sbjct: 190 DALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMAK 249

Query: 238 DFGATDFVNPMTDLKDGETIVNKLISMTDG-GLDYTFDCTGNVHVMRNALEACHKGWGQS 296
           + GAT  +N        E  V K++ +T+G G+D   +  G     +   + C     Q 
Sbjct: 250 EMGATHTIN-----SGKEDAVAKILEITNGRGVDCAMEAVG----AQPTWDICQ----QI 296

Query: 297 FIIGVAAAGQEISTRPFQLVTGRVW--RGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFIT 354
              G   A   +  +P      ++W    T    +        L+ +   G L+ D+ ++
Sbjct: 297 IKEGGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVS 356

Query: 355 HRRQFDEINDGFE 367
           H   F ++ + + 
Sbjct: 357 HHCNFKDMANNYN 369

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 100/345 (28%), Positives = 141/345 (40%), Gaps = 45/345 (13%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           KA V YE    L  +DV V  PK +E+ + +  + +CH+D +   G  P  L FP I GH
Sbjct: 11  KAIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGH 70

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           KVGD   I      C  C++C+ G  + C       G G   DG
Sbjct: 71  EGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQC---PHLDGTGFTHDG 127

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
                              TF EY     V    I + V L E A +L  G+T     A+
Sbjct: 128 -------------------TFQEYATADAVQAAHIPQNVDLAEVAPILCAGITV--YKAL 166

Query: 189 KAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K AN+  G  V + GA G +G   VQ A   G  +VI +D  + K++   +     F++ 
Sbjct: 167 KRANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEELHGEIFID- 224

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEA----CHKGWGQSFIIGVAA 303
            T  KD   +V  +I  TDGG         NV V   A+EA    C    G   ++G+ A
Sbjct: 225 FTKEKD---VVGAVIKATDGGSHGVI----NVSVSEAAIEASTRYCRPN-GTVVLVGMPA 276

Query: 304 AGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
                S    Q+V      G+  G+   R D  + LD + +GL+K
Sbjct: 277 HAYCKSDVFNQVVKSISIVGSCVGN---RADTREALDFFARGLIK 318

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 88/362 (24%), Positives = 147/362 (40%), Gaps = 41/362 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE    L  +D+ V  PKA+E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 12  KGVIFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPLVGGH 71

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD+  I      C  C++C+    + C            P+ 
Sbjct: 72  EGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNC------------PEA 119

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
               +T +G          +F +Y     V    I +   L   + + C   T +  A+K
Sbjct: 120 DLSGYTHDG----------SFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY-KALK 168

Query: 190 AANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
           +AN+  G+ VA+ G AG +G   VQ A+  G  +++ +D  DEKK   ++ G   FV   
Sbjct: 169 SANLNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIFV--- 224

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAAG 305
            D    + +   ++  T+GG         NV V   A+E+     +  G   ++G+ A  
Sbjct: 225 -DFTKSKNVEQDILVATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTVVLVGLPANA 279

Query: 306 QEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDG 365
           +  S     +V      G+  G+   R D  + LD + +GL+K    I    +  EI + 
Sbjct: 280 KCSSDVFNHVVKSISIVGSYVGN---RADTREALDFFSRGLVKSPIKIAGLSELPEIYEK 336

Query: 366 FE 367
            E
Sbjct: 337 ME 338

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 150/362 (41%), Gaps = 41/362 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE+   L  +D+ V  PKA+E+ I +  + +CHTD +   G  P  +  P + GH
Sbjct: 8   KGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGH 67

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD+  I      C  C++C+ G  + C            P  
Sbjct: 68  EGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNC------------PHA 115

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
               +T +G          +F +Y     V    I +   L   + + C   T +  A+K
Sbjct: 116 DLSGYTHDG----------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY-KALK 164

Query: 190 AANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
           +AN+  G  VA+ G AG +G   VQ A+  G  +V+ +D  + K++     G   F++  
Sbjct: 165 SANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFID-F 222

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAAG 305
           T  KD   IV  ++  TDGG         NV V   A+EA     +  G + ++G+ A  
Sbjct: 223 TKEKD---IVGAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPAGA 275

Query: 306 QEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDG 365
           +  S    Q+V      G+  G+   R D  + LD + +GL+K    +       EI + 
Sbjct: 276 KCCSDVFNQVVKSISIVGSYVGN---RADTREALDFFARGLVKSPIKVVGLSTLPEIYEK 332

Query: 366 FE 367
            E
Sbjct: 333 ME 334

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 95/363 (26%), Positives = 151/363 (41%), Gaps = 43/363 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           K  + YE+   L  +D+ V  PKA+E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 8   KGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGH 67

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                            +GD+  I      C  C++C+ G  + C            P  
Sbjct: 68  EGAGVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNC------------PHA 115

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I +   L E A +L  G+T     A+
Sbjct: 116 DLSGYTHDG----------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITV--YKAL 163

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+AN+  G  VA+ G AG +G   VQ A+  G  +V+ +D  + K++     G   F++ 
Sbjct: 164 KSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFID- 221

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
            T  KD   IVN ++  TDGG         NV V   A+EA     +  G + ++G+ A 
Sbjct: 222 FTKEKD---IVNAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPAN 274

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
            +  S    Q+V      G+  G+   R D  + LD + +GL+K    +       EI +
Sbjct: 275 AKCSSDVFNQVVKSISIVGSYVGN---RADTREALDFFARGLVKSPIKVVGLSTLPEIYE 331

Query: 365 GFE 367
             E
Sbjct: 332 KME 334

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/341 (24%), Positives = 146/341 (42%), Gaps = 37/341 (10%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE    L  +D+ V  PK +E+ I +  + +CHTD +   G  P G   P + GH
Sbjct: 32  KGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLGAKLPLVGGH 91

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                        T+ ++GD+  I      C  C+FC+ G  + C               
Sbjct: 92  EGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKA------------ 139

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
                     D+  +    +F +Y     +    I K   L   + + C   T +  A+K
Sbjct: 140 ----------DLSGYTHDGSFQQYATADAIQAAQIPKGTDLAQVAPILCAGVTVY-KALK 188

Query: 190 AANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
            ++V+ G  VA+ G AG +G   VQ A+  G  +V+ +D  DEK++     G   FV+  
Sbjct: 189 DSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFESLGGNHFVD-F 246

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEI 308
           T  KD   +V+++  +T+GG     + + +   +  ++E   +  G   ++G+  AG  +
Sbjct: 247 TKTKD---LVSEIQEITEGGPHGVINVSVSEKAIGQSVEYV-RPCGTVVLVGL-PAGATV 301

Query: 309 STRPFQLVTGRV-WRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
            +  F  V   +  +G+  G+   R D  + +D + KG +K
Sbjct: 302 KSDVFNHVIKSINIKGSYVGN---RADTREAIDFFAKGQVK 339

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 96/368 (26%), Positives = 152/368 (41%), Gaps = 46/368 (12%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE    L  +D+ V  PKA+E+ + +  + +CHTD +   G  P  +  P + GH
Sbjct: 11  KGVIFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPLPVKLPLVGGH 70

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           KVGD   I      C  C+ C+ G  + C            P+ 
Sbjct: 71  EGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNC------------PEA 118

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I     L E A +L  G+T     A+
Sbjct: 119 DLSGYTHDG----------SFQQYATADAVQAAKIPAGADLAEIAPILCAGITV--YKAL 166

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+AN+Q GD VA+ G AG +G   VQ A+  G  +V+ +D  +EK+Q     G   F+  
Sbjct: 167 KSANLQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQLGGEVFI-- 223

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
             D +  + I  ++I  T+GG         NV V   A+E+     +  G   ++G+ A 
Sbjct: 224 --DFRTCKDIEGEIIKATNGGAHGVI----NVSVSEAAIESSTNYVRANGTVVLVGLPAG 277

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
            +  S    Q+V      G+  G+   R D  + LD + +GL++    +       EI  
Sbjct: 278 AKCKSDVFNQVVKSISIVGSYVGN---RADTREALDFFVRGLVRSPIKVVGLSTLPEI-- 332

Query: 365 GFEDLHMG 372
            FE +  G
Sbjct: 333 -FEKMEKG 339

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 97/354 (27%), Positives = 141/354 (39%), Gaps = 45/354 (12%)

Query: 3   STQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEG 62
           S+Q      KA V YE    L  +DV V  PK +E+ + +  + +CH+D +   G  P  
Sbjct: 2   SSQAIPKTQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQ 61

Query: 63  L-FPCILGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRET 120
           L FP I GH                KVGD   I      C  C++C+ G  + C      
Sbjct: 62  LKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQC---PHL 118

Query: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCG 179
            G G   DG                   TF EY     V    I + V+L E A +L  G
Sbjct: 119 DGTGFTHDG-------------------TFQEYATADAVQAAHIPQNVNLAEVAPILCAG 159

Query: 180 VTTGFGAAVKAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYD 238
           +T     A+K AN+  G  V + GA G +G   +Q A   G  +VI +D  + K++    
Sbjct: 160 ITV--YKALKRANLMPGQWVTISGACGGLGSLAIQYALAMGF-RVIGIDGGEAKRKLFEK 216

Query: 239 FGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEA----CHKGWG 294
            G   F+    D      +   +I  T+GG         NV V   A+EA    C    G
Sbjct: 217 LGGEIFI----DFTKERDVAGAVIKATNGGSHGII----NVSVSEAAIEASTRYCRPN-G 267

Query: 295 QSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
              ++G+ A     S    Q+V      G+  G+   R D  + LD + +GL++
Sbjct: 268 TVVLVGMPAHAHCKSDVFNQVVKSISIVGSCVGN---RADTREALDFFARGLIE 318

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 94/374 (25%), Positives = 156/374 (41%), Gaps = 44/374 (11%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           MS++Q    Q KA + YE    L  +D+ V  PK++E+ I +  + +CHTD +   G  P
Sbjct: 1   MSASQIPKTQ-KAVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWP 59

Query: 61  -EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVR 118
                P + GH                K+GD+  I      C  C++C+    + C    
Sbjct: 60  LPTKLPLVGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNC---- 115

Query: 119 ETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLG 177
                   P+     +T +G          +F +Y     V    I     L E A +L 
Sbjct: 116 --------PEADLSGYTHDG----------SFQQYATADAVQAARIPAGTDLAEVAPVLC 157

Query: 178 CGVTTGFGAAVKAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFS 236
            G+T     A+K+AN++ G+ VA+ GA G +G   +Q A+  G  +V+ +D  +EK    
Sbjct: 158 AGITV--YKALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALF 214

Query: 237 YDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGW 293
            + G   F++  T  KD   +V  ++  T+GG         NV V   A+EA     +  
Sbjct: 215 KELGGEVFID-FTKTKD---VVKAVVDATNGGAHGVI----NVSVSEAAIEASTVYCRAN 266

Query: 294 GQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFI 353
           G   ++G+    +  S    Q+V      G+  G+   R D  + LD + +GL+K    +
Sbjct: 267 GTVVLVGLPGGAKCKSDVFNQVVKSTTIVGSYVGN---RADTREALDFFARGLVKSPIKV 323

Query: 354 THRRQFDEINDGFE 367
               +   I +  E
Sbjct: 324 VGLSELPSIYEKME 337

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 99/363 (27%), Positives = 152/363 (41%), Gaps = 43/363 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           KA + YE+   L  +DV V  PK +E+ I I  + +CHTD +   G  P +   P I GH
Sbjct: 11  KAVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGH 70

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD+  +      C  C+ C+    + C            P+ 
Sbjct: 71  EGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNC------------PEA 118

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F EY     V    I +   L E A +L  GVT     A+
Sbjct: 119 DLSGYTHDG----------SFQEYCTADAVQAARIPQGADLAEVAPILCAGVTV--YKAL 166

Query: 189 KAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+A++  G+ VA+ GA G +G   VQ A+  G  +V+ +D  +EKK+  ++ G   F++ 
Sbjct: 167 KSADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHEMGGEVFLDF 225

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
             + KD E  V   I  T+GG         NV V   A+EA     +  G   ++G+ A 
Sbjct: 226 RLE-KDMEAAV---IKATNGGAHGVI----NVSVSEAAIEASTRYVRSNGTVVLVGLPAN 277

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
               S    Q+V      G+  G+   R D  + LD + +GL+K    I       EI +
Sbjct: 278 AYCKSEVFSQVVKSYKIVGSYVGN---RADTREALDFFVRGLVKSPIHIVGLSTLPEIYE 334

Query: 365 GFE 367
             E
Sbjct: 335 KME 337

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 91/362 (25%), Positives = 148/362 (40%), Gaps = 41/362 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           KA + Y+   PL  +DV V  PK +E+ I I  + +CHTD +   G  P +   P I GH
Sbjct: 11  KAVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPLIGGH 70

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD+  +      C  C+ C+    + C            P+ 
Sbjct: 71  EGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNC------------PEA 118

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
               +T +G          +F EY     V    I +   L   + L C   T +  A+K
Sbjct: 119 DLSGYTHDG----------SFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY-KALK 167

Query: 190 AANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
           +A++  G  VA+ GA G +G   +Q A+  G  +V+ +D  +EKK+  ++ G   F+   
Sbjct: 168 SADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHELGGEVFL--- 223

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAAG 305
            D +  + +   +I  T+GG         NV V   A+E+     +  G   ++G+ A  
Sbjct: 224 -DFRLEKDMEAAIIKATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTVVLVGLPANA 278

Query: 306 QEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDG 365
              S    Q+V      G+  G+   R D  + LD + +GL+K    I       EI + 
Sbjct: 279 YCKSEVFAQVVKSYKIVGSYVGN---RADTREALDFFSRGLVKSPIHIVGLSTLPEIYEK 335

Query: 366 FE 367
            E
Sbjct: 336 ME 337

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 99/376 (26%), Positives = 149/376 (39%), Gaps = 49/376 (13%)

Query: 1   MSSTQGKAI--QCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDA-YTLSG 57
           MSS+  +A+  + K A+ YE +   V++D        H V++KI  T IC +D  Y L G
Sbjct: 1   MSSSMQQAVVLREKGAIVYEHRPVPVIED-------PHYVKVKIEKTGICGSDVHYYLHG 53

Query: 58  VDPEGLF----PCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNL 113
               G F    P +LGH             T V++GD V        +  +  KSG  NL
Sbjct: 54  SI--GPFVVRSPMVLGHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNL 111

Query: 114 CGAVRETQGKGVMP-DGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEP 172
           C   RE +     P DGT                     +Y +  +  +V +   VSLE 
Sbjct: 112 C---REMRFAATPPYDGT-------------------LVKYYISPEDFLVKLPDSVSLEE 149

Query: 173 ASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEK 232
            +L  C        A + A  Q    V VFGAG VGL     A+  G + V +VDI+  K
Sbjct: 150 GAL--CEPLAVAVHANRLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHK 207

Query: 233 KQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKG 292
              +   G T  V+  +D    E + NKL +     +D  FDC+G    +  A+  C  G
Sbjct: 208 LCVAPALGVTHPVD-SSDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPG 266

Query: 293 WGQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIK-GRTDMPQLLDDYEKGLLKIDE 351
                 + V ++   +S   F L    V +    G  +    D    ++      +    
Sbjct: 267 GTH---VQVGSSRDYVS---FPLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAAR 320

Query: 352 FITHRRQFDEINDGFE 367
            +THR  FD   + ++
Sbjct: 321 LVTHRFPFDRAVEAYK 336

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 84/359 (23%), Positives = 146/359 (40%), Gaps = 35/359 (9%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           KA + YE    L   D+ V  PK  E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 8   KAVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 67

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD   I      C  C++C+    + C            PD 
Sbjct: 68  EGAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC------------PDA 115

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
               +T +G          +F +Y     V    I +   L   + + C   T +  A+K
Sbjct: 116 DLSGYTHDG----------SFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY-KALK 164

Query: 190 AANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
           +A +Q G+ VA+ GA G +G   VQ A+  G  +++ +D  +EKK+   + G   F+   
Sbjct: 165 SARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYFI--- 220

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEI 308
            D  + + +V ++I +T+GG     + + +   +  + E C    G   ++G+ A  Q  
Sbjct: 221 -DFAESKDVVAEVIKVTNGGAHGVINVSVSEAAIAASAEYCRSN-GTVVLVGLPAGAQMR 278

Query: 309 STRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFE 367
           S     +V      G+  G+   R D  + +D + +GL+     +    Q  E+ +  E
Sbjct: 279 SEVFSHVVKSISVVGSYVGN---RADSREAIDFFTRGLVSAPIKVVGLSQLAEVYEKME 334

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 98/343 (28%), Positives = 150/343 (43%), Gaps = 47/343 (13%)

Query: 36  HEVRIKIMNTAICHTDA-YTLSGVDPEGLF----PCILGHXXXXXXXXXXXXXTSVKVGD 90
           H V++ I  T IC +D  Y  +G    G F    P +LGH             TSVKVGD
Sbjct: 30  HYVKLAIKKTGICGSDVHYYKTGAI--GNFVVKDPMVLGHESSGVVVEVGSKVTSVKVGD 87

Query: 91  HVIPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTF 150
            V        +  K  KSG  NLC ++       +  DGT   + L  +D    +  S  
Sbjct: 88  RVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPPI--DGTLLKYYLSPEDFLVKLPDS-- 143

Query: 151 SEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLS 210
                      V+ ++   +EP   L  GV      A K A+V+ G  V VFGAG VGL 
Sbjct: 144 -----------VSFEEGACVEP---LSVGVH-----ANKLADVRFGSKVVVFGAGPVGLL 184

Query: 211 VVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG-GL 269
               +R  G + V+ VD+ D K + + +FGAT  VN  +  K  + +V ++  +  G   
Sbjct: 185 AGAVSRAFGATDVVFVDVFDHKLERTNEFGATQTVN-SSKFKSEDDLVKEIQRVLSGEQP 243

Query: 270 DYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWR--GT--- 324
           +  F+C+G    +R  ++AC  G G+   +G+   G++    P   V  +  +  GT   
Sbjct: 244 EVVFECSGAEVCIRAGIKACKAG-GRYVQVGM---GKDNVNFPISEVVSKELQVLGTFRY 299

Query: 325 AFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFE 367
            FGD     D  +L+ +   G + +   ITHR +F +    +E
Sbjct: 300 CFGDY---NDSVKLISE---GKVNVKPLITHRFKFQDAIKAYE 336

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 88/362 (24%), Positives = 145/362 (40%), Gaps = 41/362 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           KA + YE   PL   D+ V  PKA E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 11  KAVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 70

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD   I      C  C++C+    + C            P+ 
Sbjct: 71  EGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNC------------PEA 118

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
               +T +G          +F +Y     V    I     L   + + C   T +  A+K
Sbjct: 119 DLSGYTHDG----------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALK 167

Query: 190 AANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
           +AN++ GD VA+ GA G +G   +Q A   G  +V+ +D  +EK+Q     G   F+   
Sbjct: 168 SANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQLGGEVFI--- 223

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAAG 305
            D +  + IV  ++  T+GG         NV V   A+E+     +  G   ++G+    
Sbjct: 224 -DFRKSKDIVADVVKATNGGAHGVI----NVSVSEAAIESSTEYVRSNGTVVLVGLPGGA 278

Query: 306 QEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDG 365
           +  S     +V      G+  G+   R D  + LD + +GL+K    +    +  +I + 
Sbjct: 279 KCKSDVFSHVVKSISIVGSYVGN---RADTREALDFFARGLVKSPIQVVGLSELPQIYEK 335

Query: 366 FE 367
            E
Sbjct: 336 ME 337

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 92/350 (26%), Positives = 145/350 (41%), Gaps = 43/350 (12%)

Query: 22  PLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGHXXXXXXXXXX 80
           PL  +++ V  PKA+E+ I +  + +CHTD +   G  P  +  P + GH          
Sbjct: 20  PLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGIVVAMG 79

Query: 81  XXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGK 139
               +  +GD+  I      C  C+ C+    + C            P      +T +G 
Sbjct: 80  DSVKNWNIGDYAGIKWLNGSCMNCESCELANESNC------------PQADLSGYTHDG- 126

Query: 140 DIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAVKAANVQKGDT 198
                    +F +Y     V    I     L E A +L  GVT     A+K+AN++ GD 
Sbjct: 127 ---------SFQQYATADAVQAAKIPHGTDLAEVAPILCAGVTV--YKALKSANLKAGDW 175

Query: 199 VAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETI 257
           VA+ GA G +G   +Q A   G  +V+ +D  +EK +     G   F++  T  KD   +
Sbjct: 176 VAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKLGGEYFID-FTKCKD---V 230

Query: 258 VNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAAGQEISTRPFQ 314
           + +++ +TDGG         NV V   A+EA     +  G   ++G+ A     S    Q
Sbjct: 231 IAEILEVTDGGAHGVI----NVSVSEAAIEASTRYCRANGTVVLVGLPANAYCKSEVFSQ 286

Query: 315 LVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
           +V      G+  G+   R D  Q LD + +GL+K    I       EI D
Sbjct: 287 VVKSISIVGSYVGN---RADTRQALDFFARGLVKSPIHIAPLSDLPEIFD 333

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/341 (24%), Positives = 141/341 (41%), Gaps = 37/341 (10%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE    L  +D+ V  PK +E+ I +  + +CHTD +   G  P  +  P + GH
Sbjct: 49  KGVIFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGH 108

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                        T+ ++GD+  I      C  C+ C+ G    C               
Sbjct: 109 EGAGVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNC--------------- 153

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
                  E  D+  +    +F +Y     V    I K   L + A +L  GVT     A+
Sbjct: 154 -------EHADLSGYTHDGSFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTV--YKAL 204

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K A+V+ G  VA+ G AG +G   VQ A+  G  +V+ +D  ++KK+  +D G   F+  
Sbjct: 205 KTADVRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETFI-- 261

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQE 307
             D +  + +V  +   T GG     + + +   +  + E   +  G   ++G+ A    
Sbjct: 262 --DFRTTKDMVGAIQEATQGGPHAVINVSVSEAAISMSTEYV-RPTGSVVLVGLPANAYV 318

Query: 308 ISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
            S     +V     +G+  G+   R D  + +D + +GL+K
Sbjct: 319 KSEVFSHVVKSISIKGSYVGN---RADTREAIDFFARGLVK 356

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 88/343 (25%), Positives = 140/343 (40%), Gaps = 48/343 (13%)

Query: 40  IKIMNTAICHTDAYTLSGVDPE---------GLFPC-ILGHXXXXXXXXXXXXXTSVKVG 89
           IK+ +T+IC TD     G +PE         G F   ILGH              + K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 90  DHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCST 149
           D VI    + C  C+ C     + C     T G G                I  +M   T
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGGW---------------ILGYMIDGT 159

Query: 150 FSEY--TVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTV 207
            +EY  T  AD S+ ++ + +S E A +L   + T     V+  NV+ GDTVA+ GAG V
Sbjct: 160 QAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPV 219

Query: 208 GLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG 267
           G+  V  +++   S +IVVDI+D +   + + G+T  +N        E  V+K++  T+G
Sbjct: 220 GMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAK-----EDAVSKILEYTNG 274

Query: 268 -GLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVW--RGT 324
            G+D   +  G     +   + C +   +    G   A   +  +P      ++W    T
Sbjct: 275 RGVDCVMEAVG----AQATWDICQRVIKE----GGHLANVGVHGKPVNFEIDKLWIKNLT 326

Query: 325 AFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFE 367
               +        L+     G LK +  +TH   F E++  + 
Sbjct: 327 ITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMSGNYN 369

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 95/363 (26%), Positives = 148/363 (40%), Gaps = 43/363 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE+   L  +D+ V  PK +E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 8   KGVIFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPLVGGH 67

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           KVGD   I    + C  C++C+ G  + C            P  
Sbjct: 68  EGAGVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNC------------PHA 115

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I +   L E A +L  G+T     A+
Sbjct: 116 DLSGYTHDG----------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGITV--YKAL 163

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+AN++ G  VA+ G AG +G   VQ A+  G  +V+ +D    K++     G   F++ 
Sbjct: 164 KSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVFID- 221

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
            T  KD   IV  +I  TDGG         NV V   A+EA     +  G   ++G+ A 
Sbjct: 222 FTKEKD---IVGAVIKATDGGAHGIV----NVSVSEAAIEASTRYCRANGTVVLVGLPAG 274

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
            +  S     +V      G+  G+   R D  + LD + +GL+K    +       EI +
Sbjct: 275 AKCTSDVFNHVVKSISIVGSYVGN---RADTREALDFFARGLVKSPIKVVGLSHLPEIYE 331

Query: 365 GFE 367
             E
Sbjct: 332 KME 334

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 86/363 (23%), Positives = 145/363 (39%), Gaps = 40/363 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE   PL  +D+ V  PK +E+ I +  + +CHTD +   G  P  +  P + GH
Sbjct: 34  KGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGH 93

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                         + ++GD   I      C  C+ C+ G  + C               
Sbjct: 94  EGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNC--------------- 138

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
                  E  D+  +    +F +Y          I +   L E A +L  GVT     A+
Sbjct: 139 -------EHADLSGYTHDGSFQQYATADATQAAQIPRGTDLAEVAPILCAGVTV--YKAL 189

Query: 189 KAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K A +Q G+ VA+ GA G +G   +Q A+  G  +V+ +D  + K +   + G   F++ 
Sbjct: 190 KTAALQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFKELGGETFID- 247

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
            T  K+ E ++  +   T GG         NV V   A+ A     +  G   I+G+ A 
Sbjct: 248 FTKYKNNEAMIKDIQEATKGGPQGVI----NVSVSEAAISASTQYVRPTGTVVIVGMPAG 303

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
               S     +V     +G+  G+   R D  + +D + +GL+K    +    +  +I +
Sbjct: 304 AYVKSDVFSHVVKSISIKGSYVGN---RADTREAIDFFSRGLVKSPITVVGLSELPKIYE 360

Query: 365 GFE 367
             E
Sbjct: 361 LME 363

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 95/364 (26%), Positives = 151/364 (41%), Gaps = 45/364 (12%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           KA + YE+   L  +D+ V  PK +E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 8   KAIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGH 67

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD+  I      C  C++C+ G  + C            P  
Sbjct: 68  EGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNC------------PHA 115

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F EY     V    I +   L E A +L  G+T     A+
Sbjct: 116 DLSGYTHDG----------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGITV--YKAL 163

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+AN++ G   A+ G AG +G   VQ A+  G  +V+ +D    K++     G   F++ 
Sbjct: 164 KSANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVFID- 221

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
            T  KD   IV+ ++  T+GG         NV V   A+EA     +  G   ++G+  A
Sbjct: 222 FTKEKD---IVSAVVKATNGGAHGII----NVSVSEAAIEASTRYCRANGTVVLVGL-PA 273

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKG-RTDMPQLLDDYEKGLLKIDEFITHRRQFDEIN 363
           G + S+  F  V   +   +  G   G R D  + LD + +GL+K    +       EI 
Sbjct: 274 GAKCSSDVFNHVVKSI---SIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSSLPEIY 330

Query: 364 DGFE 367
           +  E
Sbjct: 331 EKME 334

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 91/371 (24%), Positives = 151/371 (40%), Gaps = 37/371 (9%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           + ST       K  + YE K  L  +D+ V  PK +E+ I +  + +CHTD +   G  P
Sbjct: 24  LQSTAAIPKTQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 61  EGL-FPCILGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVR 118
             +  P + GH                KVGD   I      C  C+FC+SG  + C    
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 119 ETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLG 177
                   PD     +T +G          +F ++     +    I +   L E A +L 
Sbjct: 140 --------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILC 181

Query: 178 CGVTTGFGAAVKAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFS 236
            GVT     A+K A+++ GD VA+ G AG +G   VQ A   G  +V+ +D  +EK++  
Sbjct: 182 AGVTV--YKALKEADLKAGDWVAISGAAGGLGSLAVQYATAMGY-RVLGIDAGEEKEKLF 238

Query: 237 YDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQS 296
              G   F+    D    + +V+ +   T GG     + + +   +  + E   +  G  
Sbjct: 239 KKLGGEVFI----DFTKTKNMVSDIQEATKGGPHGVINVSVSEAAISLSTEYV-RPCGTV 293

Query: 297 FIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHR 356
            ++G+ A     S     +V     +G+  G+   R D  + LD + +GL+K    I   
Sbjct: 294 VLVGLPANAYVKSEVFSHVVKSINIKGSYVGN---RADTREALDFFSRGLIKSPIKIVGL 350

Query: 357 RQFDEINDGFE 367
            +  ++ D  E
Sbjct: 351 SELPKVYDLME 361

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 97/368 (26%), Positives = 145/368 (39%), Gaps = 46/368 (12%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           KA +  E   PL  +D+ V  PK +E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 8   KAVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGH 67

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                         + K+GD   I      C  C+ C+    + C            PD 
Sbjct: 68  EGAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC------------PDA 115

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I    +L E A +L  G+T     A+
Sbjct: 116 DLSGYTHDG----------SFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITV--YKAL 163

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+AN++ G  VA+ G AG +G   VQ AR  G  +V+ +D    K++     G   F+  
Sbjct: 164 KSANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECFI-- 220

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHK---GWGQSFIIGVAAA 304
             D      I   +I  T+GG         NV V   A+ A  K     G S ++G+ A 
Sbjct: 221 --DFTKEHDIAEAVIKATNGGAHGVI----NVSVSEGAISASTKYVRSCGTSVLVGMPAG 274

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
               S    Q+V      G+  G+   R D  + LD + +GL+K    I       EI  
Sbjct: 275 AICKSEVFDQVVRSTKIVGSYVGN---RADTREALDFFARGLVKAPIKIVGLSTLPEI-- 329

Query: 365 GFEDLHMG 372
            FE +  G
Sbjct: 330 -FEKMEKG 336

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 80.1 bits (196), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 92/371 (24%), Positives = 152/371 (40%), Gaps = 37/371 (9%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           + ST       K  + YE K  L  +D+ V  PK +E+ I +  + +CHTD +   G  P
Sbjct: 24  LQSTAAIPETQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 61  EGL-FPCILGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVR 118
             +  P + GH                K+GD   I      C  C+FC+SG  + C    
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 119 ETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLG 177
                   PD     +T +G          +F ++     +    I +   L E A +L 
Sbjct: 140 --------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILC 181

Query: 178 CGVTTGFGAAVKAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFS 236
            GVT     A+K A+++ GD VA+ G AG +G   VQ A   G  +V+ +D  +EK++  
Sbjct: 182 AGVTV--YKALKEADLKAGDWVAISGAAGGLGSLAVQYATAMGY-RVLGIDAGEEKEKLF 238

Query: 237 YDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQS 296
              G   F++  T  KD   +V+ +   T GG     + + +   +  + E      G  
Sbjct: 239 KKLGGEVFID-FTKTKD---MVSDIQEATKGGPHGVINVSVSEAAISLSTEYVRPT-GTV 293

Query: 297 FIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHR 356
            ++G+ A     S     +V     +G+  G+   R D  + LD + +GL+K    I   
Sbjct: 294 VLVGLPANAYVKSEVFSHVVKSINIKGSYVGN---RADTREALDFFSRGLIKSPIKIVGL 350

Query: 357 RQFDEINDGFE 367
            +  ++ D  E
Sbjct: 351 SELPKVYDLME 361

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 93/371 (25%), Positives = 148/371 (39%), Gaps = 46/371 (12%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           K  + YE    L  +D+ V  PKA+E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 10  KGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 69

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD   I      C  C++C+    + C            P+ 
Sbjct: 70  EGAGVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNC------------PEA 117

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I     L E A +L  GVT     A+
Sbjct: 118 DLSGYTHDG----------SFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTV--YKAL 165

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+AN++ GD VA+ G AG +G   VQ A+  G  +V+ +D  +EK +   D G   F+  
Sbjct: 166 KSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEYFI-- 222

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
             D    + I  ++I  T GG         NV V   A+E      +  G   ++G+   
Sbjct: 223 --DFTKSKNIPEEVIEATKGGAHGVI----NVSVSEFAIEQSTNYVRSNGTVVLVGLPRD 276

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
            +  S    Q+V      G+  G+   R D  + +D + +GL+K      H     E+  
Sbjct: 277 AKCKSDVFNQVVKSISIVGSYVGN---RADTREAIDFFSRGLVKAP---IHVVGLSELPS 330

Query: 365 GFEDLHMGTCL 375
            +E +  G  +
Sbjct: 331 IYEKMEKGAIV 341

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 79.3 bits (194), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 87/344 (25%), Positives = 144/344 (41%), Gaps = 37/344 (10%)

Query: 23  LVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGHXXXXXXXXXXX 81
           L  +D+ V  PK+ E+ I +  + +CHTD +   G  P     P + GH           
Sbjct: 22  LEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGAGIVVQVGE 81

Query: 82  XXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKD 140
                KVGD   I      C  C++C+ G  + C            P+     +T +G  
Sbjct: 82  NVQGWKVGDLAGIKWLNGSCMACEYCELGNESNC------------PNADLSGYTHDG-- 127

Query: 141 IFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAVKAANVQKGDTV 199
                   +F +Y     V    I +   L E A +L  G+T     A+K+AN++ G+ V
Sbjct: 128 --------SFQQYATADAVQAARIPQGTDLAEVAPVLCAGITV--YKALKSANLRAGEWV 177

Query: 200 AVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIV 258
           A+ G AG +G   VQ A+  G  +++ +D  +EK++   + G   F++  T  KD   IV
Sbjct: 178 AISGAAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRELGGEIFID-FTKTKD---IV 232

Query: 259 NKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTG 318
             +I  T+GG     + + +   +  + E C    G   ++G+    +  S    Q+V  
Sbjct: 233 GDIIKATNGGAHGVINVSVSEAAIGASTEYCRAN-GTVVLVGLPRDAKCKSDVFNQVVKS 291

Query: 319 RVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEI 362
               G+  G+   R D  + LD + +GL+K    I       EI
Sbjct: 292 ISIVGSYVGN---RADTREALDFFSRGLVKSPIHIAPLSDLPEI 332

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 79.3 bits (194), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 94/363 (25%), Positives = 148/363 (40%), Gaps = 43/363 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           K  + YE+   L  +D+ V  PKA+E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 8   KGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGH 67

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                            +GD   I      C  C++C+ G  + C            P  
Sbjct: 68  EGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNC------------PHA 115

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    +     L E A +L  G+T     A+
Sbjct: 116 DLSGYTHDG----------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITV--YKAL 163

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+AN+  G  VA+ G AG +G   VQ A+  G  +VI +D  + K++     G   FV+ 
Sbjct: 164 KSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVFVD- 221

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
            T  KD   IV  ++  T+GG         NV V   A+EA     +  G + ++G+ A 
Sbjct: 222 FTKEKD---IVGAVLKATNGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPAN 274

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
            +  S    Q+V      G+  G+   R D  + LD + +GL+K    +       EI +
Sbjct: 275 AKCCSDVFNQVVKSISIVGSYVGN---RADTREALDFFSRGLVKSPIKVVGLSTLPEIYE 331

Query: 365 GFE 367
             E
Sbjct: 332 KME 334

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 90/370 (24%), Positives = 154/370 (41%), Gaps = 45/370 (12%)

Query: 10  QCKAAVAYEAKK-PLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCI 67
           + + A+ +E+   PL  +D+ V  PK++E+ + I  + +CHTD +   G  P +   P +
Sbjct: 8   KTQKAIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPLV 67

Query: 68  LGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVM 126
            GH                K+GD+  +      C  C++C+ G  + C            
Sbjct: 68  GGHEGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNC------------ 115

Query: 127 PDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGA 186
           P+     +T +G          +F +Y     V    I    +L   + + C   T +  
Sbjct: 116 PNADLSGYTHDG----------SFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY-K 164

Query: 187 AVKAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFV 245
           A+K+AN++ G+ VA+ GA G +G   +Q A   G  +V+ +D  D+K +         F+
Sbjct: 165 ALKSANLRAGEWVAISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVFI 223

Query: 246 NPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHK---GWGQSFIIGVA 302
           +  T  KD  + VNK+   T+GG         NV V   A+EA  K     G   ++G+ 
Sbjct: 224 D-FTKTKDVISEVNKV---TNGGAHGVI----NVSVSEAAIEASTKYCRANGTVVLVGLP 275

Query: 303 AAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEI 362
              +  S    Q+V      G+  G+   R D  + LD + +GL+K    +        I
Sbjct: 276 GGAKCKSDVFNQVVKSMTIVGSYVGN---RADTREALDFFTRGLVKAPIHVAPLSTLPTI 332

Query: 363 NDGFEDLHMG 372
              FE +  G
Sbjct: 333 ---FEKMEKG 339

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 90/367 (24%), Positives = 147/367 (40%), Gaps = 44/367 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE    L  +D+ V  PKA+E+ I +  + +CHTD +   G  P  +  P + GH
Sbjct: 11  KGVIFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPLDVKLPLVGGH 70

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD+  I      C  C++C+    + C            P+ 
Sbjct: 71  EGAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNC------------PEA 118

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
               +T +G          +F +Y     V    I +   L   + + C   T +  A+K
Sbjct: 119 DLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALK 167

Query: 190 AANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
           +AN+  G+ VA+ GA G +G   +Q A+  G  +++ +D  DEK     + G   F++  
Sbjct: 168 SANLSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFKELGGEVFID-F 225

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAAG 305
           T  KD E  V   I  T+GG         NV V   A+E+     +  G   ++G+    
Sbjct: 226 TKTKDIEAAV---IEATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTCVLVGLPGGA 278

Query: 306 QEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDG 365
              S     +V      G+  G+   R D  + +D + +GL+K    I       EI   
Sbjct: 279 YCKSEVFSHVVKSISIVGSYVGN---RADTREAIDFFTRGLVKAPIHIAPLSAVPEI--- 332

Query: 366 FEDLHMG 372
           FE +  G
Sbjct: 333 FEKMEKG 339

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 98/363 (26%), Positives = 150/363 (41%), Gaps = 43/363 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           K  + YE    L  +D+ V  PK  E+ I ++ + +CHTD +   G  P +   P + GH
Sbjct: 13  KGVIFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPLVGGH 72

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD   I      C  C+ C+    + C            P+ 
Sbjct: 73  EGAGVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNC------------PEA 120

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I +   + E A +L  GVT     A+
Sbjct: 121 DLSGYTHDG----------SFQQYATADAVQAAHIPQGADMAEVAPILCAGVTV--YKAL 168

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+A ++ GD VA+ G AG +G   VQ A+  G  +V+ +D  DEK++F    G   FV+ 
Sbjct: 169 KSAELKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEVFVDF 227

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
           MT  KD   IV  +   T+GG      C  NV V   A+EA     +  G   ++G+ A 
Sbjct: 228 MT-CKD---IVGAVKEATNGG---AHGCI-NVSVSEKAIEASTQYVRTNGTVVLVGLPAG 279

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
               S    Q+V      G+  G+   R D  + LD + +GL+K    +       EI +
Sbjct: 280 AYCKSEVFDQVVKSYKIVGSYVGN---RADTREALDFFVRGLVKPTIKVVGLSTLPEIYE 336

Query: 365 GFE 367
             E
Sbjct: 337 KME 339

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 92/371 (24%), Positives = 150/371 (40%), Gaps = 37/371 (9%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           + ST       K  + YE    L  +D+ V  PK +E+ I +  + +CHTD +   G  P
Sbjct: 24  LQSTAAIPKTQKGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 61  EGL-FPCILGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVR 118
             +  P + GH                KVGD   I      C  C+FC+SG  + C    
Sbjct: 84  LAVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 119 ETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLG 177
                   P+     +T +G          +F ++     +    I     L E A +L 
Sbjct: 140 --------PEADLSGYTHDG----------SFQQFATADAIQAAKIQPGTDLAEVAPILC 181

Query: 178 CGVTTGFGAAVKAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFS 236
            GVT     A+K AN++ GD VA+ G AG +G   VQ A   G  +V+ +D  +EK++  
Sbjct: 182 AGVTV--YKALKEANLKAGDWVAISGAAGGLGSLAVQYATAMGY-RVLGIDAGEEKEKLF 238

Query: 237 YDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQS 296
              G   F++  T  KD   +V+ +   T GG     + + +   +  + E      G  
Sbjct: 239 KQLGGEVFID-FTKTKD---MVSDIQEATKGGPHGVINVSVSEAAISLSTEYVRPT-GTV 293

Query: 297 FIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHR 356
            ++G+ A     S     +V     +G+  G+   R D  + LD + +GL+K    I   
Sbjct: 294 VLVGLPANSYVKSEVFSHVVKSINIKGSYVGN---RADTREALDFFTRGLIKSPIKIVGL 350

Query: 357 RQFDEINDGFE 367
            +  ++ D  E
Sbjct: 351 SELPKVYDLME 361

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 94/364 (25%), Positives = 151/364 (41%), Gaps = 45/364 (12%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           K  + YE+   L  +++ V  PK +E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 8   KGVIFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGH 67

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           KVGD   +    + C  C++C+ G  + C            P  
Sbjct: 68  EGAGVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNC------------PHA 115

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I +   L E A +L  G+T     A+
Sbjct: 116 DLSGYTHDG----------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITV--YKAL 163

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+AN++ G+ VA+ G AG +G   VQ A+  G  +V+ +D    K++     G   F++ 
Sbjct: 164 KSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVFID- 221

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHK---GWGQSFIIGVAAA 304
            T  KD   I+  ++  TDGG         NV V   A+EA  K     G   ++G+  A
Sbjct: 222 FTKEKD---IIGAVVKATDGGAHGII----NVSVSEAAIEASTKYCRANGTVVLVGL-PA 273

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKG-RTDMPQLLDDYEKGLLKIDEFITHRRQFDEIN 363
           G + S+  F  V   +   +  G   G R D  + LD + +GL+K    +       EI 
Sbjct: 274 GAKCSSDVFNHVVKSI---SIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSSLPEIY 330

Query: 364 DGFE 367
           +  E
Sbjct: 331 EKME 334

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 91/362 (25%), Positives = 148/362 (40%), Gaps = 41/362 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           K  + YE+   L  +D+ V  PK +E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 8   KGVIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGH 67

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           KVGD   I    + C  C++C+ G  + C            P  
Sbjct: 68  EGAGVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNC------------PHA 115

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
               +T +G          +F +Y     V    I +   L   + + C   T +  A+K
Sbjct: 116 DLSGYTHDG----------SFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY-KALK 164

Query: 190 AANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
           +AN++ G  VA+ G AG +G   VQ A+  G  +V+ +D  + K++     G   F++  
Sbjct: 165 SANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVFID-F 222

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAAG 305
           T  KD   IV+ ++  TDGG         NV V   A+EA     +  G   ++G+ A  
Sbjct: 223 TKEKD---IVSAVVKATDGGAHGIV----NVSVSEAAIEASTRYCRANGTVVLVGLPAGA 275

Query: 306 QEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDG 365
           +  S     +V      G+  G+   R D  + LD + +GL+K    +       EI + 
Sbjct: 276 KCCSDVFNHVVKSISIVGSYVGN---RADTREALDFFARGLVKSPIKVVGLSTLPEIYEK 332

Query: 366 FE 367
            E
Sbjct: 333 ME 334

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 87/341 (25%), Positives = 141/341 (41%), Gaps = 37/341 (10%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE    L  +D+ V  PK +E+ I +  + +CHTD +   G  P  +  P + GH
Sbjct: 35  KGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGH 94

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           KVGD   I      C  C+FC+SG  + C            PD 
Sbjct: 95  EGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------------PDA 142

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F ++     +    I +   L E A +L  GVT     A+
Sbjct: 143 DLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTV--YKAL 190

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K AN++ GD VA+ G AG +G   VQ A   G  +V+ +D   EK++     G   F++ 
Sbjct: 191 KEANLKAGDWVAISGAAGGLGSLAVQYATAMGY-RVLGIDAGAEKEKLFKQLGGEVFID- 248

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQE 307
            T  KD   +V+ +   T GG     + + +   +  + E      G   ++G+ A    
Sbjct: 249 FTKTKD---MVSDIQEATKGGPQGVINVSVSEAAISLSTEYVRPT-GTVVLVGLPANAYV 304

Query: 308 ISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
            S     ++     +G+  G+   R D  + LD + +GL+K
Sbjct: 305 KSEVFSHVIKSINIKGSYVGN---RADTREALDFFSRGLIK 342

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 88/374 (23%), Positives = 153/374 (40%), Gaps = 44/374 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE   PL  +D+ V  P  +E+ I ++ + +CHTD +   G  P  +  P + GH
Sbjct: 10  KGVIFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPLVGGH 69

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           KVGD+  I      C  C+ C+    + C            P+ 
Sbjct: 70  EGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNC------------PEA 117

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
               +T +G          +F +Y     V    I     L+  + + C   T +  A+K
Sbjct: 118 DLSGYTHDG----------SFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY-KAIK 166

Query: 190 AANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
           +AN++ GD +A+ GA G +G   +Q  +  G  +++ +D   EK++     G   F++  
Sbjct: 167 SANLKAGDWLAISGACGGLGSLAIQYGKAMGF-RILGIDGGAEKEELFKKLGGEYFID-F 224

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAAG 305
           T  KD   I+ ++   T+GG         NV V   A+EA     +  G   ++G+ A  
Sbjct: 225 TQCKD---IIAEVKKATNGGAHGVI----NVSVSEAAIEASTNYVRSNGTVVLVGLPAGA 277

Query: 306 QEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDG 365
              S    Q+V      G+  G+   R D  + +D + +GL+K    +    Q   +   
Sbjct: 278 VCKSNVFNQVVKSTKIVGSYVGN---RADTREAIDFFVRGLVKSPIKVVGLSQLASV--- 331

Query: 366 FEDLHMGTCLRTVL 379
           F+D+  G  +  V+
Sbjct: 332 FDDMQAGKIVGRVV 345

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 87/344 (25%), Positives = 140/344 (40%), Gaps = 43/344 (12%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE    L  +D+ V  PK +E+ I +  + +CHTD +   G  P  +  P + GH
Sbjct: 47  KGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLDVKLPLVGGH 106

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                        T+ ++GD   I      C  C+ C+ G    C               
Sbjct: 107 EGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNC--------------- 151

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
                  E  D+  +    +F +Y     V    + K ++L E A +L  GVT     A+
Sbjct: 152 -------EHADLSGYTHDGSFQQYATADAVQAAQLPKGINLAEVAPILCAGVTV--YKAL 202

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K A++  G  VA+ G AG +G   VQ A+  G  +V+ +D  DEKK+  +  G   F++ 
Sbjct: 203 KTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIFID- 260

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
            T  KD   +V  +   T GG         NV V   A+       +  G   ++G+ A 
Sbjct: 261 YTTTKD---MVGAIQEATQGGPQGVI----NVSVSEAAISLSTQYVRPTGSVVLVGLPAN 313

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
               S     +V     +G+  G+   R D  + +D + +GL+K
Sbjct: 314 AYVKSEVFSHVVKSISIKGSYVGN---RADTREAIDFFNRGLIK 354

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 93/393 (23%), Positives = 160/393 (40%), Gaps = 77/393 (19%)

Query: 14  AVAYEAKKPLVVQDVIVDAPKAHE--VRIKIMNTAICHTD----------------AYTL 55
           A+AY  +K +   D +     +HE  V I +    +C +D                 + +
Sbjct: 3   ALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTHAM 62

Query: 56  SGVDPEGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQK------------- 102
           SG   +GL P  +GH             + VKVGDHV+      C+              
Sbjct: 63  SG---QGL-PQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHEREG 118

Query: 103 -CKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCST--FSEYTVVADV 159
            C  CK+G  N C  +                        F  +GC +  F+E  V+++ 
Sbjct: 119 LCIACKTGNPNCCTDLG-----------------------FCGLGCQSGGFAEKIVLSER 155

Query: 160 SVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRG 219
           +VV I   + L+ A+L+   ++  +  AV+ + +Q G T  V GAG +GL+ V   +  G
Sbjct: 156 NVVKIPNSLPLDVAALVE-PISVSW-HAVRISKLQPGQTALVLGAGPIGLAAVLALQSHG 213

Query: 220 CSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTG 277
              +IV +  D ++Q +   GA  F NP    + G+ ++  L  +  G  G ++++DC G
Sbjct: 214 AGTIIVSEPADTRRQKAEALGAQTF-NPT---EHGDNVIEALRKLAPGGEGFNFSYDCCG 269

Query: 278 NVHVMRNALEACHKGWGQSFIIGVAAAG-QEISTRPFQLVTGRVWRGTAFGDIKGRT-DM 335
                   L   H    +   + +A  G + I   P  + T   +     G I   T D 
Sbjct: 270 TSETFSAGL---HTLTPKGVAVNIAVWGPKPIDFYPMDVTTSERF---VTGSICYTTQDF 323

Query: 336 PQLLDDYEKGLLKIDEFITHRRQFDEINDGFED 368
            +++D  +KG + I++  T     + I +GFE+
Sbjct: 324 EEVVDAMDKGKIDINKVKTMITGRERIENGFEN 356

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 94/371 (25%), Positives = 147/371 (39%), Gaps = 46/371 (12%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           K  V  E+  PL  +++ V  PK +E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 39  KGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGH 98

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                         + KVGD   I      C  C+ C+    + C            PD 
Sbjct: 99  EGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC------------PDA 146

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I     L E A +L  G+T     A+
Sbjct: 147 DLSGYTHDG----------SFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITV--YKAL 194

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+AN++ G  VA+ G AG +G   VQ A+  G  +V+ +D    K++     G   F+  
Sbjct: 195 KSANLKAGQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVFI-- 251

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHK---GWGQSFIIGVAAA 304
             D +    IV  +++ T+GG         NV V   A+ A  K     G S ++G+ A 
Sbjct: 252 --DFQKESDIVGAVVNATNGGAHGVV----NVSVSEGAISASTKYVRACGTSVLVGMPAG 305

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
               S    Q+V      G+  G+   R D  + LD + +GL+     +       EI  
Sbjct: 306 AVCKSEVFDQVVRSTKIVGSYVGN---RADTREALDFFARGLVHAPINVVPLSTLPEI-- 360

Query: 365 GFEDLHMGTCL 375
            FE +  G  +
Sbjct: 361 -FEKMEKGQII 370

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 90/344 (26%), Positives = 138/344 (40%), Gaps = 43/344 (12%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE   PL  +D+ V  PKA+E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 33  KGVIFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGH 92

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD   I      C  C+ C+SG  + C               
Sbjct: 93  EGSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNC--------------- 137

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
                  E  D+  +    +F +Y     V    I K  ++ E A +L  G+T     A+
Sbjct: 138 -------EHADLSGYTHDGSFQQYATADAVQAARIPKGTNMAEVAPILCAGITV--YKAL 188

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K A+++ G  V + G AG +G   VQ A+  G  +VI +D    K++     G   FV+ 
Sbjct: 189 KEADMRAGQWVCISGAAGGLGSLAVQYAKAMGY-RVIGIDGGPGKEELFKSLGGEIFVD- 246

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHK---GWGQSFIIGVAAA 304
            T  KD   IV ++   T GG         NV V   A+    K     G   ++G+ A 
Sbjct: 247 FTKTKD---IVAEIQEATRGGPQGVI----NVSVSEAAISLSTKYVRPTGTVVLVGLPAH 299

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
               S     +V     +G+  G+   R D  + LD + +GL+K
Sbjct: 300 SYVKSEVFSHVVKSINIKGSYVGN---RADTREALDFFARGLIK 340

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 93/368 (25%), Positives = 147/368 (39%), Gaps = 46/368 (12%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           KA + YE   PL  +D+ V  P A E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 11  KAVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 70

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD+  I      C  C+ C+    + C            P+ 
Sbjct: 71  EGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNC------------PEA 118

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I +   L E A +L  G+T     A+
Sbjct: 119 DLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITV--YKAL 166

Query: 189 KAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+AN+  GD VA+ GA G +G   +Q A   G  +V+ +D   EK +     G   F++ 
Sbjct: 167 KSANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFKQLGGEVFID- 224

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
            T  KD E    ++I  T+GG         NV V   A+E+     +  G   ++G+   
Sbjct: 225 FTTCKDVE---GEIIKATNGGAHGVI----NVSVSEAAIESSTRYVRANGTVVLVGLPGG 277

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
            +  S     +V      G+  G+   R D  + LD + +GL+K    +       E+  
Sbjct: 278 AKCRSDVFSHVVKSISIVGSYVGN---RADTREALDFFSRGLVKSPIKVVGLSTLPEV-- 332

Query: 365 GFEDLHMG 372
            FE +  G
Sbjct: 333 -FEKMEKG 339

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 92/360 (25%), Positives = 146/360 (40%), Gaps = 43/360 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE    L  +D+ V  P  +E+ I +  + +CHTD +   G  P  +  P + GH
Sbjct: 11  KGVIFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGH 70

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                         + KVGD+  I      C  C+ C+ G  + C            P  
Sbjct: 71  EGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNC------------PQA 118

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I     L E A +L  G+T     A+
Sbjct: 119 DLSGYTHDG----------SFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTV--YKAL 166

Query: 189 KAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+A ++ G  VA+ GA G +G   VQ A+  G  +V+ +D  DEK +   + G   F++ 
Sbjct: 167 KSAELEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKELGGEYFID- 224

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEAC---HKGWGQSFIIGVAAA 304
            T  KD   I+ +++  T+GG         NV V   A+ A     +  G   ++G+ A 
Sbjct: 225 FTKCKD---IIGEVVKATNGGAHGVI----NVSVSEAAISASTRYARANGTVVLVGLPAG 277

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
               S    Q+V      G+  G+   R D  + LD + +GL+K    +       EI D
Sbjct: 278 AYCKSEVFNQVVKSIKIVGSYVGN---RADTREALDFFNRGLVKAPIKVVGLSTLPEIYD 334

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 95/371 (25%), Positives = 150/371 (40%), Gaps = 47/371 (12%)

Query: 10  QCKAAVAYEAKK-PLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCI 67
           + + AV +E     L  +D+ V  P A+E+ I +  + +CHTD +   G  P     P +
Sbjct: 5   KTQKAVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPLV 64

Query: 68  LGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVM 126
            GH                K+GD   I      C  C+ C+    + C            
Sbjct: 65  GGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNC------------ 112

Query: 127 PDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFG 185
           P      +T +G          +F +Y     V    I +   L E A +L  G+T    
Sbjct: 113 PHADLSGYTHDG----------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITV--Y 160

Query: 186 AAVKAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDF 244
            A+K+AN++ G+ VA+ G AG +G   VQ A+  G  +VI +D  DEK+Q     G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYF 219

Query: 245 VNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGV 301
           V    D +  + +V +++ +T GG         NV V   A+E+     +  G   ++G+
Sbjct: 220 V----DFRKSKDVVAEILEVTGGGAHGVV----NVSVSEAAIESSTHYVRANGTVVLVGL 271

Query: 302 AAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDE 361
               +  S     +V      G+  G    R D  Q LD + +GL+K    I       E
Sbjct: 272 PGGAKCCSDVFNHVVKSISIVGSYVGS---RADTRQALDFFARGLVKSPIKIV---GLSE 325

Query: 362 INDGFEDLHMG 372
           + D FE +  G
Sbjct: 326 LPDVFEKMEKG 336

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 81/340 (23%), Positives = 137/340 (40%), Gaps = 35/340 (10%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE   PL  +D+ V  PK++E+ I +  + +CHTD +   G  P  +  P + GH
Sbjct: 37  KGVIFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPLVGGH 96

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                         + K+GD   I      C  C+ C++G    C               
Sbjct: 97  EGAGVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANC--------------- 141

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
                  E  D+  +    +F +Y     V    I     L   + + C   T +  A+K
Sbjct: 142 -------EHADLSGYTHDGSFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY-KALK 193

Query: 190 AANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
            A+++ GD VA+ G AG +G   VQ A   G  +VI +D  ++KK+     G   F+   
Sbjct: 194 TADLKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVFI--- 249

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEI 308
            D    + IV  +   T GG     + + +   +  +++      G   ++G+ A     
Sbjct: 250 -DFTKSKDIVKDIQEATHGGPHGVINVSVSDKAISQSVQYIRPT-GTVVVVGMPANAVVK 307

Query: 309 STRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
           S    Q+V     +G+  G+   R D  + LD + +GL+K
Sbjct: 308 SDVFNQVVKSIQIKGSYVGN---RADTREALDFFTRGLVK 344

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 88/360 (24%), Positives = 145/360 (40%), Gaps = 43/360 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           K  + YE    L  +D+ V  PKA+E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 8   KGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 67

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                            +GD   I      C  C++C+    + C            PD 
Sbjct: 68  EGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC------------PDA 115

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I K   L E A +L  GVT     A+
Sbjct: 116 DLSGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTV--YKAL 163

Query: 189 KAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+A+++ GD VA+ GA G +G   +Q A+  G  +V+ +D   EK +   + G   FV  
Sbjct: 164 KSADLKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEYFV-- 220

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
             D    + ++ +++  T+GG         NV V   A+E      +  G   ++G+   
Sbjct: 221 --DYAVSKDLIKEIVDATNGGAHGVI----NVSVSEFAIEQSTNYVRSNGTVVLVGLPRD 274

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
            +  S    Q+V      G+  G+   R D  + LD + +GL+     I    +  ++ D
Sbjct: 275 AKCKSDVFTQVVKSVSIVGSYVGN---RADTREALDFFARGLVHAPIKIVGLSELADVYD 331

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 90/363 (24%), Positives = 142/363 (39%), Gaps = 43/363 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           KA V YE   PL  +D+ V  PKA+E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 41  KAVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 100

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           KVGD   I      C  C+ C++G  + C               
Sbjct: 101 EGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNC--------------- 145

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
                  E  D+  +    +F +Y     V    I +  +L E A +L  G+T     A+
Sbjct: 146 -------EHADLSGYTHDGSFQQYATADAVQAARIPEGTNLAEVAPILCAGITV--YKAL 196

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K A+++ G  V + G AG +G   VQ A+  G  +VI +D    K++     G   F+  
Sbjct: 197 KEADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVFI-- 253

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAA 304
             D    + +V  +   T GG         NV V   A+       +  G   ++G+ A 
Sbjct: 254 --DFTKSKDMVKDIQEATKGGPQGVI----NVSVSEAAISLSTQYVRPTGTVVLVGLPAH 307

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
               S     +V     +G+  G+   R D  + LD + +GL+K    I    +  ++ D
Sbjct: 308 AYVKSEVFSHVVKSINIKGSYVGN---RADTREALDFFARGLIKSPIKIVGLSELPKVYD 364

Query: 365 GFE 367
             E
Sbjct: 365 LME 367

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 147/361 (40%), Gaps = 55/361 (15%)

Query: 36  HEVRIKIMNTAICHTDA--YTLSGVDPEGL-FPCILGHXXXXXXXXXXXXXTSVKVGDHV 92
           H V++ I  T IC +D   Y   G+    L  P +LGH             T VKVGD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 93  IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSE 152
                   +     K G+ NLC  +       +  DGT   + L  +D            
Sbjct: 91  AIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDF----------- 137

Query: 153 YTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVV 212
             +V     V+ ++   +EP   L  GV +      K A V+ G  V VFGAG VGL   
Sbjct: 138 --LVKLPEGVSYEEGACVEP---LSVGVHSN-----KLAGVRFGTKVVVFGAGPVGLLTG 187

Query: 213 QGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP-------MTDLKDGETIVNKLISMT 265
             AR  G + VI VD+ D K Q + DFGAT+  N          DL DG   V KL+   
Sbjct: 188 AVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADG---VQKLLGGN 244

Query: 266 DGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWR--- 322
               D  F+C+G   V  +A     K  G    +G+   G+  +  P   V+G+  +   
Sbjct: 245 HA--DVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEMKLIG 298

Query: 323 --GTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFED--LHMGTCLRTV 378
               +FGD +   ++         G + +   ITH+ +F++    ++    H G  ++T+
Sbjct: 299 CFRYSFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTI 352

Query: 379 L 379
           +
Sbjct: 353 I 353

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 110/261 (42%), Gaps = 33/261 (12%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           K  + YE    L  +D+ V  PK +E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 34  KGVIFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 93

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                            +GD   I      C  C++C+    + C            PD 
Sbjct: 94  EGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC------------PDA 141

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
               +T +G          +F +Y     V    I K   L E A +L  GVT     A+
Sbjct: 142 DLSGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTV--YKAL 189

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K+AN++ GD VA+ G AG +G   VQ A+  G  +V+ +D  +EK +     G   FV+ 
Sbjct: 190 KSANLKAGDWVAISGAAGGLGSLAVQYAKAMGY-RVVGIDGGEEKGKLVKQLGGEAFVD- 247

Query: 248 MTDLKDGETIVNKLISMTDGG 268
            T  KD   +V ++  +T+GG
Sbjct: 248 FTKTKD---MVAEIQEITNGG 265

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 96/391 (24%), Positives = 154/391 (39%), Gaps = 75/391 (19%)

Query: 30  VDAPKA---HEVRIKIMNTAICHTD----------------AYTLSGVDPEGLFPCILGH 70
           +D PK    HE+ I +    IC TD                 + LSG+D     P  +GH
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 71  XXXXXXXXXXXXXTSVKVGDHVIPLYTAEC--------------QKCKFCKSGKTNLCGA 116
                        T  K GD V+   T  C              + C  C+ G  N C  
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCC-T 132

Query: 117 VRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLL 176
               QG G +  G                    F+E  VV +  VV I  K+ L+ A+L+
Sbjct: 133 HGSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALV 172

Query: 177 GCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFS 236
              ++  + AA + A  ++G    V G+G +GL+++   +     K++V +    +++ +
Sbjct: 173 E-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELA 230

Query: 237 YDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALE-ACHKGWGQ 295
                  F NP            K +S  D G DYTFDC+G       A++ AC +G   
Sbjct: 231 EKLNVVVF-NPTHTRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKAACIQG--- 286

Query: 296 SFIIGVAAAG-QEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDE--- 351
             I+ VA  G + ++  P  +  G        G +    D  +++D  +KG + I+E   
Sbjct: 287 -HIVNVAIWGPKPVAFHPMDMTYGEKKLTGTMGYV--TRDFEEVVDAIDKGYISIEECKL 343

Query: 352 FITHRRQF-DEINDGFEDL--HMGTCLRTVL 379
            IT R +  D +  GF +L  H  T ++ +L
Sbjct: 344 LITGRVKLEDGMEKGFHELIEHKETNVKILL 374

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 146/361 (40%), Gaps = 55/361 (15%)

Query: 36  HEVRIKIMNTAICHTDA--YTLSGVDPEGL-FPCILGHXXXXXXXXXXXXXTSVKVGDHV 92
           H V++ I  T IC +D   Y   G+    L  P +LGH             T VKVGD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 93  IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSE 152
                   +     K G  NLC  +       +  DGT   + L  +D            
Sbjct: 91  AIEPGVPSRYSDETKEGSYNLCPHMAFAATPPI--DGTLVKYYLSPEDF----------- 137

Query: 153 YTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVV 212
             +V     V+ ++   +EP   L  GV +      K A V+ G  V VFGAG VGL   
Sbjct: 138 --LVKLPEGVSYEEGACVEP---LSVGVHSN-----KLAGVRFGTKVVVFGAGPVGLLTG 187

Query: 213 QGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP-------MTDLKDGETIVNKLISMT 265
             AR  G + VI VD+ D K Q + DFGAT+  N          DL DG   V KL+   
Sbjct: 188 AVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADG---VQKLLGGN 244

Query: 266 DGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWR--- 322
               D  F+C+G   V  +A     K  G    +G+   G+  +  P   V+G+  +   
Sbjct: 245 HA--DVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEMKLIG 298

Query: 323 --GTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFED--LHMGTCLRTV 378
               +FGD +   ++         G + +   ITH+ +F++    ++    H G  ++T+
Sbjct: 299 CFRYSFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTI 352

Query: 379 L 379
           +
Sbjct: 353 I 353

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 89/357 (24%), Positives = 152/357 (42%), Gaps = 47/357 (13%)

Query: 36  HEVRIKIMNTAICHTDA--YTLSGVDPEGL-FPCILGHXXXXXXXXXXXXXTSVKVGDHV 92
           +  ++ +  T IC +D   Y   G+    L  P +LGH               +KVGD V
Sbjct: 30  YYAKVAVKATGICGSDVHYYRSGGIGKYILNSPMVLGHESSGVVVEVGPKVEKIKVGDRV 89

Query: 93  IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSE 152
                   +     K+GK NLC  +             +    ++G  + +++  + F  
Sbjct: 90  AIEPGVPDRYSDETKAGKYNLCPHM-----------AFAATPPIDGTLVKYYLSPADF-- 136

Query: 153 YTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVV 212
             +V     V+ ++   +EP   L  GV +      K A V+ G TV VFGAG VGL   
Sbjct: 137 --LVKLPDHVSFEEGACIEP---LSVGVHSN-----KLAKVRFGQTVVVFGAGPVGLLTG 186

Query: 213 QGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLK-DGETIVNKLISMTDGGL-D 270
             A+  G S V+ VD+ D+K + + +FGAT  +N     K D + + +++  +  G L D
Sbjct: 187 AVAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKNDPQALADEVEKLLGGALAD 246

Query: 271 YTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGR------VWRGT 324
             F+C+G    +   ++A   G G    IG+   G+     P   V+G+       +R  
Sbjct: 247 VVFECSGAESCIDAGVKATKNG-GTMVQIGM---GKNYVNFPIAEVSGKEMTLVGCFR-Y 301

Query: 325 AFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDG--FEDLHMGTCLRTVL 379
           ++GD K   ++         G + + + ITHR  F++      F   H G  ++T++
Sbjct: 302 SYGDYKDAVNL------VSTGRVDVKKLITHRFSFEDAAKAYDFNIAHGGEVVKTII 352

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 101/395 (25%), Positives = 158/395 (40%), Gaps = 58/395 (14%)

Query: 1   MSSTQGKAIQCKAA--VAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDA--YTLS 56
           MS T   ++  +    +A E +    ++D        H V++ I  T IC +D   Y   
Sbjct: 1   MSQTTNPSVVLRKVGDIAIEQRPVPTIED-------PHYVKLAIKATGICGSDVHYYRSG 53

Query: 57  GVDPEGL-FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCG 115
           G+    L  P +LGH             T VKVGD V        +     K G+ NLC 
Sbjct: 54  GIGKYILKAPMVLGHESSGEVVEVGNAVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCP 113

Query: 116 AVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASL 175
            +       +  DGT   + L  +D               V     V+ ++   +EP   
Sbjct: 114 HMAFAATPPI--DGTLVKYYLSPEDFL-------------VKLPEGVSYEEGACVEP--- 155

Query: 176 LGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQF 235
           L  GV +      K A V+    V VFGAG VGL     AR  G S V+ VD+ D K Q 
Sbjct: 156 LSVGVHSN-----KLAGVRFSTRVVVFGAGPVGLLTGAVARAFGASDVVFVDVFDNKLQR 210

Query: 236 SYDFGATDFVN----PMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHK 291
           + DFGAT+  N    P    ++  + V KL+       D  F+C+G   V  +A     K
Sbjct: 211 AKDFGATNTFNSSKIPTDKAQELASEVEKLLGGNHA--DVVFECSG-ADVCIDAGVKVTK 267

Query: 292 GWGQSFIIGVAAAGQEISTRPFQLVTGRVWR-----GTAFGDIKGRTDMPQLLDDYEKGL 346
             G    +G+   G+  +  P   V+G+  +       +FGD +   ++         G 
Sbjct: 268 VGGTMVQVGM---GKNYTNFPIAEVSGKEMKLIGCFRYSFGDYRDAVNL------VATGK 318

Query: 347 LKIDEFITHRRQFDEINDGFED--LHMGTCLRTVL 379
           + +   ITHR +F++    ++    H G  ++T++
Sbjct: 319 VNVKPLITHRFKFEDAAKAYDYNISHGGDVVKTII 353

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 89/371 (23%), Positives = 146/371 (39%), Gaps = 46/371 (12%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           K  + YE    L  +D+ V  PK +E+ I +  + +CHTD +   G  P     P + GH
Sbjct: 33  KGIIFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGH 92

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD   I      C  C++C+    + C            P  
Sbjct: 93  EGAGVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNC------------PHA 140

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
               +T +G          +F +Y     V    I +   L   S + C   T +  A+K
Sbjct: 141 DLSGYTHDG----------SFQQYATADYVQAARIPEGTDLAEVSPILCAGVTVY-KALK 189

Query: 190 AANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
           +AN++ GD VA+ G AG +G   VQ A+  G  +V+ +D   EK +     G   F+   
Sbjct: 190 SANLKAGDWVAISGAAGGLGSLAVQYAKAMGY-RVLGIDGGAEKGELVKKLGGEVFI--- 245

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAAG 305
            D    + +V  +   T+GG         NV V   A+ A     +  G   ++G+  AG
Sbjct: 246 -DFTKHKNLVEAVQEATNGGPHGVI----NVSVSEAAMTASTQFVRPTGTVVLVGL-PAG 299

Query: 306 QEISTRPFQLVTGRV-WRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
             I +  F  V   +  +G+  G+   R D  + +D + +G++K      H     E+  
Sbjct: 300 AVIKSEVFSHVVKSINIKGSYVGN---RADTREAIDFFARGMVKSP---IHVVGLSELPK 353

Query: 365 GFEDLHMGTCL 375
            +E +  G  L
Sbjct: 354 VYELMEKGKIL 364

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 88/353 (24%), Positives = 142/353 (40%), Gaps = 44/353 (12%)

Query: 23  LVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGHX-XXXXXXXXX 80
           L  +D+ V  P+ +E+ I +  + +CHTD +   G  P     P + GH           
Sbjct: 21  LQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGIVVAKGS 80

Query: 81  XXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGK 139
                 ++GD   I      C  C++C+    + C            P      +T +G 
Sbjct: 81  MVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNC------------PQADLSGYTHDG- 127

Query: 140 DIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAVKAANVQKGDT 198
                    +F +Y     V    + K   L E A +L  G+T     A+K+AN++ G+ 
Sbjct: 128 ---------SFQQYATADAVQAARVPKGTDLAEVAPILCAGITV--YKALKSANLRAGEW 176

Query: 199 VAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETI 257
           VA+ GA G +G   VQ A+  G  +V+ +D  DEK +     G   F+    D    + +
Sbjct: 177 VAISGASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLGGEYFI----DFTKSKDV 231

Query: 258 VNKLISMTDGGLDYTFDCTGNVHVMRNALEAC---HKGWGQSFIIGVAAAGQEISTRPFQ 314
           + ++I  TDGG         NV V   A+ A     +  G   ++G+ A     S    Q
Sbjct: 232 IAEVIKATDGGAHGVI----NVSVSEGAISASTRYARANGTVVLVGLPANAYCKSEVFNQ 287

Query: 315 LVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFE 367
           +V      G+  G+   R D  + LD + +GL+K    I       EI +  E
Sbjct: 288 VVKSVAIVGSYVGN---RADTREALDFFARGLVKSPIKIVGLSTLPEIYEKME 337

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 99/365 (27%), Positives = 150/365 (41%), Gaps = 51/365 (13%)

Query: 29  IVDAPKAHEVRIKIMNTAICHTDA--YTLSGVDPEGL-FPCILGHXXXXXXXXXXXXXTS 85
           I++ P  H V+I I  T IC +D   Y   G+    L  P +LGH             T 
Sbjct: 26  IIEDP--HYVKIAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGSAVTR 83

Query: 86  VKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFM 145
           VKVGD V        +     K G+ NLC  +       +  DGT   + L  +D     
Sbjct: 84  VKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDF---- 137

Query: 146 GCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAG 205
                    +V     V+ ++   +EP   L  GV +      K A V+ G  V VFGAG
Sbjct: 138 ---------LVKLPEGVSYEEGACVEP---LSVGVHSN-----KLAGVRFGSRVVVFGAG 180

Query: 206 TVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVN----PMTDLKDGETIVNKL 261
            VGL     AR  G S V+ +D+ D K   + +FGAT   N    P    ++    V KL
Sbjct: 181 PVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPADKTQELADEVEKL 240

Query: 262 ISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVW 321
           +S      D  F+C+G    +   ++    G G    IG+   G+  +  P   V+G+  
Sbjct: 241 LSGHHA--DIVFECSGADACIDAGVKITKVG-GTMVQIGM---GKNYTNFPIAEVSGKEM 294

Query: 322 R-----GTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDG--FEDLHMGTC 374
           +       +FGD +   D  +L+     G + +   ITHR +F++      F   H G  
Sbjct: 295 KLIGCFRYSFGDYR---DAVKLV---ASGKVNVKAMITHRFKFEDAAKAYDFNIAHGGEV 348

Query: 375 LRTVL 379
           ++T++
Sbjct: 349 VKTII 353

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 100/371 (26%), Positives = 151/371 (40%), Gaps = 52/371 (14%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPK---AHEVRIKIMNTAICHTDA-YTLSGVDPEGLF--P 65
           + AV  E    +V+ +V  + PK   A++V ++I  T IC +D  Y   G     +   P
Sbjct: 7   QEAVVLEQPGKIVLTNV--NIPKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVKSP 64

Query: 66  CILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGKGV 125
            +LGH              ++KVGD V        +     K G+ NL            
Sbjct: 65  MVLGHESSGVVVLIGDNVKTLKVGDRVALEPGFPNRFSSELKEGRYNL------------ 112

Query: 126 MPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFG 185
             D   +F      D        T ++Y       V  I   VS E  +L+         
Sbjct: 113 --DPDLKFAATPPYD-------GTLTKYYRAPKDFVYKIPDHVSFEEGALM-----EPLS 158

Query: 186 AAVKAANVQK---GDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGAT 242
            AV A  + K   G    VFGAG VGL   + A + G + V+ VD+++ K + +  FGAT
Sbjct: 159 VAVHANRLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGAT 218

Query: 243 DFVNPMTDLKDG---ETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFII 299
             VN   DL  G   ET++ K I     G D  F+C+G    +R  +E C  G G    +
Sbjct: 219 HMVN-SGDLPQGVSAETVIRKAIGKK--GADVVFECSGAQPCIRTGIEVCKAG-GTYVQV 274

Query: 300 GVAAAGQEISTRPFQLVTGR--VWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRR 357
           G+   GQE    P   +  +   ++G+ F   +G  D    ++    G L +   IT R 
Sbjct: 275 GM---GQEEIQFPISKIPAKEITFQGS-FRYCQG--DYSDSIELVSSGKLSLKPLITRRY 328

Query: 358 QFDEINDGFED 368
           QF E  + F++
Sbjct: 329 QFKEAIEAFDE 339

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 86/362 (23%), Positives = 143/362 (39%), Gaps = 39/362 (10%)

Query: 23  LVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGHXXXXXXXXXXX 81
           L  +D+ V  P ++EV I +  + +CHTD +T  G  P +   P + GH           
Sbjct: 42  LYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVAKGK 101

Query: 82  XXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKD 140
              + ++GD   +    + C  C+ C+ G    C    + +  G   DG           
Sbjct: 102 DVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGC---EQAEMSGSSHDG----------- 147

Query: 141 IFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVA 200
                   TF +Y  +  +    +   V L   + + C   + +  A+K  N+Q    VA
Sbjct: 148 --------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQWVA 198

Query: 201 VFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVN 259
           +FGA G +G   VQ A+  G   + +    +E+KQ  +  G   F+    D    + I  
Sbjct: 199 IFGATGGLGSIAVQYAKAMGYRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVDNIPA 254

Query: 260 KLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVT-G 318
            +   T GG     + T ++      ++ C +  G    +GV      + T  F +V  G
Sbjct: 255 AVKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTIVQHG 313

Query: 319 RVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFEDLHMG-TCLRT 377
              +G+A G    R D  + +D + +GL+K    I       E+   FE L  G T  R 
Sbjct: 314 FSIKGSASGS---RADTREAVDFFTRGLIKSPIKILG---LSELPKAFELLESGQTTGRL 367

Query: 378 VL 379
           VL
Sbjct: 368 VL 369

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 73/326 (22%), Positives = 125/326 (38%), Gaps = 49/326 (15%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAEC--------------QKCKFCKSG 109
            P  +GH             T  KVGDHV    T  C              +KC  CK G
Sbjct: 67  LPQAMGHEMAGIVREVGSGVTQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRG 126

Query: 110 KTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVS 169
             N+C  +    G GV   G                    F+E  V+ +     +   + 
Sbjct: 127 MYNVCSHLGLI-GNGVQSGG--------------------FAERVVINESHCYKLPNHIP 165

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
           +E  +L+     +    AV+ +  + G +V + G G +GLS +      GC++++V +  
Sbjct: 166 MEVVALVQPIAVSWH--AVRVSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPA 223

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEAC 289
             ++  +   GA  + +PM    +      + ++    G DY FDC+G    +R+++E C
Sbjct: 224 KIRRDLAEKMGAVVY-DPMQHSYEENIKYLRALAPDKDGFDYCFDCSGTPATLRSSIE-C 281

Query: 290 HKGWGQSFIIGVAAAGQEISTRPFQLVTG-RVWRGTAFGDIKGRTDMPQLLDDYEKGLL- 347
               G +  + + A G+ I   P  +    + + G+         D   ++D  EKG + 
Sbjct: 282 LTFRGTAVNVAMWATGKPIDFFPMDITQQEKSYTGSM---CYTHHDFEGVIDALEKGTID 338

Query: 348 --KIDEFITHRRQFDEINDGFEDLHM 371
             K    IT +   +    GFED  M
Sbjct: 339 PEKAQHMITAKVPLER---GFEDAMM 361

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 92/345 (26%), Positives = 149/345 (43%), Gaps = 47/345 (13%)

Query: 29  IVDAPKAHEVRIKIMNTAICHTDA-YTLSGVDPEGLF--PCILGHXXXXXXXXXXXXXTS 85
           + + P  H V++ I  T IC +D  Y  SG   + +   P +LGH              S
Sbjct: 23  VPELPNEHYVKVAIKATGICGSDIHYYKSGSIGKYVVNQPMVLGHESSGEVVEVGSAVRS 82

Query: 86  VKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPD-GTSRFHTLEGKDIFHF 144
           +KVGD V        +     K G+ NLC            PD   +    ++G  + ++
Sbjct: 83  IKVGDRVAIEPGVPDRYSDETKQGRYNLC------------PDMAFAATPPIDGTLVKYY 130

Query: 145 MGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGA 204
           +  + F    +V     V+ ++   +EP   L  GV      A K A V  G  V VFGA
Sbjct: 131 VSPADF----LVKLPDHVSFEEGACIEP---LSVGVH-----ANKLAKVHFGSVVVVFGA 178

Query: 205 GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISM 264
           G VGL     A+  G S+VI VD+ D K + +  FGAT  +N  +  +     V+  +S 
Sbjct: 179 GPVGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTINSKSLPRGEGDAVSAAVSN 238

Query: 265 TDGG--LDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGR--- 319
             GG   D  F+C+G    + + + +   G G    IG+   G+     P   V+G+   
Sbjct: 239 YLGGALADVVFECSGAEPCINSGVLSTKNG-GTMVQIGM---GKNYINFPLAEVSGKEMS 294

Query: 320 ---VWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDE 361
               +R  +FGD +   D  +L+     G +++ + IT+R +F++
Sbjct: 295 VIGCFR-YSFGDYR---DAVRLV---ATGQVEVKKMITNRFKFED 332

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 124/301 (41%), Gaps = 45/301 (14%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           M+S +   ++ K  +  E++        I +    H+V+I+I  T IC +D +  +    
Sbjct: 1   MASQEAVVLEKKELIQIESRP-------IPEIKNPHDVKIQIKATGICGSDVHYFTQ-GS 52

Query: 61  EGLF----PCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGA 116
            G F    P +LGH             +SVKVGD V        +  K   SG  NLC  
Sbjct: 53  IGDFVVKSPLVLGHESAGVVVEVGDAVSSVKVGDRVAVEPGVPSRYSKETMSGHYNLCPH 112

Query: 117 VRETQGKGVMPDGTSRFHTLEGKD-IFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASL 175
           +          DGT   + L  +D ++      +F E  VV  +SV              
Sbjct: 113 MAFAATPPY--DGTLVKYYLSPEDFVYKLADHISFEEGAVVEPLSVAV------------ 158

Query: 176 LGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQF 235
                      A + AN   G  V V GAG VGL     A+  G + V+ VDI + K + 
Sbjct: 159 ----------HANRLANTAFGQAVLVLGAGPVGLLAGAVAKAFGATDVVFVDIFESKLEK 208

Query: 236 SYDFGATDFV--NPMTDLKDGETIVNKLISMTDGGL--DYTFDCTGNVHVMRNALEACHK 291
           +  FGAT  V   P +D  D  ++V K +    GGL  D  F+C+G    +R A+++  +
Sbjct: 209 AKQFGATRTVLFKPDSDENDLVSLVTKSL----GGLHPDVVFECSGAEKCIRAAVKSVKR 264

Query: 292 G 292
           G
Sbjct: 265 G 265

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 133/333 (39%), Gaps = 41/333 (12%)

Query: 22  PLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGHXXXXXXXXXX 80
           PL  +++ V  PK  E+ I +  + +CHTD +   G  P     P + GH          
Sbjct: 55  PLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMG 114

Query: 81  XXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGK 139
                 +VGD   I      C  C+ C+ G  + C            P+     +T +G 
Sbjct: 115 ENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNC------------PEADLSGYTHDG- 161

Query: 140 DIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTV 199
                    +F +Y     V    I     L   + + C   T +  A+K+AN++ G+ V
Sbjct: 162 ---------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKSANLRAGNWV 211

Query: 200 AVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIV 258
           A+ GA G +G   +Q AR  G  +V+ +D  DEK+      G   FV    D +  + +V
Sbjct: 212 AISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRKLGGEVFV----DFRKSKDVV 266

Query: 259 NKLISMTDGGLDYTFDCTGNVHVMRNALEACH---KGWGQSFIIGVAAAGQEISTRPFQL 315
             ++  T GG         NV V   A+E+     +  G   ++G+    +  S     +
Sbjct: 267 ADVVKATGGGAHGVI----NVSVSEAAIESSTEYVRSNGTVVLVGLPGGAKCKSDVFNHV 322

Query: 316 VTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
           V      G+  G+   R D  + LD + +GL++
Sbjct: 323 VKSVSIVGSYVGN---RADTREALDFFARGLVQ 352

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 88/362 (24%), Positives = 145/362 (40%), Gaps = 47/362 (12%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSG-VDPEGLFPCILGH 70
           KA +  E    L  +D+ V  PK++E+ I ++ + +CH+D +   G +      P + GH
Sbjct: 11  KAIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPLPLKLPLVGGH 70

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD+  I      C  C+FC+      C     T   G + DG
Sbjct: 71  EGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFT---GTVHDG 127

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
                              +F +Y     V    I +   L   + L C   T +  A+K
Sbjct: 128 -------------------SFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTAY-KALK 167

Query: 190 AANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
           +AN++ G  VA+ GA G +G   +Q A   G  +V+ +D  +EK ++    G   F+   
Sbjct: 168 SANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKTLGGEVFI--- 223

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHK---GWGQSFIIGV---A 302
            D K  + +V  +I  TDGG         N+ V   A+    K     G S ++ +   A
Sbjct: 224 -DYKKSKDVVADVIKATDGGAHGVL----NIAVDPRAISMSTKYVRSNGTSVLVSLPKDA 278

Query: 303 AAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEI 362
               E+ T   Q+V      G+  G+   R D  + +D + +GL+KI   +       +I
Sbjct: 279 VCESEVFT---QVVKSTSIVGSCVGN---RADTREAIDFFTRGLIKIPIHMAPLSSLPQI 332

Query: 363 ND 364
            D
Sbjct: 333 YD 334

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 97/239 (40%), Gaps = 39/239 (16%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAEC--------------QKCKFCKSG 109
            P  +GH             T VKVGDHV+    + C              + C  C+ G
Sbjct: 67  LPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRG 126

Query: 110 KTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVS 169
             NLC       G GV+  G                    F+E  VV+   ++ + K++ 
Sbjct: 127 SENLCTHAGFV-GLGVISGG--------------------FAEQVVVSQHHIIPVPKEIP 165

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
           L+ A+L+     T    AVK +  +KG +  V GAG +GL  +   +  G SK++V +I 
Sbjct: 166 LDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIA 223

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEA 288
           + + + +   G   F NP         I+  L    D G DY++DC+G       +L+A
Sbjct: 224 ERRIEMAKKLGVEVF-NPSKHGHKSIEILRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 87/368 (23%), Positives = 147/368 (39%), Gaps = 40/368 (10%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE    L  +D+ V  PKA+E+ I +  + +CHTD +   G  P  +  P + GH
Sbjct: 35  KGVIFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGH 94

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                         + ++GD+  I      C  C+ C+ G  + C    +    G   DG
Sbjct: 95  EGAGIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNC---LQADLSGYTHDG 151

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
                              +F +Y     V    I K   L E A +L  GVT     A+
Sbjct: 152 -------------------SFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTV--YKAL 190

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K A+++ G  VA+ G AG +G   VQ A+  G  +V+ +D  D K++     G   F+  
Sbjct: 191 KTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQCGGEVFI-- 247

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQE 307
             D +  + +V  +   T+GG     + + +   +  + E      G   ++G+ A    
Sbjct: 248 --DFRKSKDMVADIQEATNGGPHGVINVSVSEAAISMSTEYVRPT-GVVVLVGLPADAYV 304

Query: 308 ISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFE 367
            S     +V     +G+  G+   R D  +  D + +GL+K    I       E+ + +E
Sbjct: 305 KSEVFSHVVKSISIKGSYVGN---RADTREATDFFTRGLVKSPIKIIG---LSELPEAYE 358

Query: 368 DLHMGTCL 375
            +  G  L
Sbjct: 359 LMEQGKIL 366

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 103/244 (42%), Gaps = 49/244 (20%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAEC--------------QKCKFCKSG 109
            P  +GH             T VKVGDHV+    + C              + C+ CK G
Sbjct: 67  LPLAMGHEMSGIVAEVGPKVTKVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKG 126

Query: 110 KTNLC---GAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDK 166
             NLC   G +    G GV+  G                    F+E   V++  ++ + K
Sbjct: 127 SENLCTHGGFI----GLGVISGG--------------------FAEQVAVSEHHIIPVPK 162

Query: 167 KVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVV 226
           ++ L+ A+L+     T    AVK +  +KG +  V GAG +GL  +   +  G  K++V 
Sbjct: 163 EIPLDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVS 220

Query: 227 DINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTGNVHVMRN 284
           ++ + + + + + G   F NP    K G+  +  L  +T    G DY++DC+G       
Sbjct: 221 EVAERRIEMAKNLGVEVF-NPS---KHGQKSIEVLRGLTKSHDGFDYSYDCSGIQVTFET 276

Query: 285 ALEA 288
           +L+A
Sbjct: 277 SLKA 280

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 91/371 (24%), Positives = 146/371 (39%), Gaps = 45/371 (12%)

Query: 1   MSSTQGKAIQC--KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGV 58
            +ST   AI    K  + YE+   L  +D+ V  PK +E+ I +  + +CHTD +   G 
Sbjct: 24  FNSTVAPAIPTTQKGVIFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGD 83

Query: 59  DP-EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGA 116
            P     P + GH              + ++GD   I      C  C+ C+ G  + C  
Sbjct: 84  WPLPTKLPLVGGHEGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNC-- 141

Query: 117 VRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASL 175
                            H     D+  +    +F +Y     V    I K   L E A +
Sbjct: 142 ----------------LHA----DLSGYTHDGSFQQYATADAVQAAQIPKGTDLAEVAPI 181

Query: 176 LGCGVTTGFGAAVKAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQ 234
           L  GVT     A+K A+++ G  VA+ G AG +G   VQ A+  G  +++ +D    K++
Sbjct: 182 LCAGVTV--YKALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEE 238

Query: 235 FSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACH---K 291
                G   F++  T  KD   IV+ +   T GG         NV V   A+       +
Sbjct: 239 LFKSLGGEVFID-FTKTKD---IVSAIQEATKGGPHGVI----NVSVSEAAISTSTQYVR 290

Query: 292 GWGQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDE 351
             G   ++G+ A     S     +V     +G+  G+   R D  + LD + +GL+K   
Sbjct: 291 PTGTVVLVGLPANAYVKSEVFSHVVKSINIKGSYVGN---RADTREALDFFSRGLVKSPI 347

Query: 352 FITHRRQFDEI 362
            I    +  E+
Sbjct: 348 KIVGLSELPEV 358

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/331 (23%), Positives = 135/331 (40%), Gaps = 37/331 (11%)

Query: 23  LVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGHXXXXXXXXXXX 81
           L ++ + V +PKA+E+ I +  + +CH+D +   G  P +   P + GH           
Sbjct: 25  LELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPLVGGHEGAGIVVAMGA 84

Query: 82  XXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKD 140
                K+GD+  I    + C  C+ C+      C                         D
Sbjct: 85  SVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYA----------------------D 122

Query: 141 IFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVA 200
           I  F    +F +Y     V    I    +L   S + C   T F  A+K AN+  G+ VA
Sbjct: 123 ISGFTRDGSFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF-KALKTANLTAGNWVA 181

Query: 201 VFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVN 259
           + GA G +G   +Q A+  G S V+ +D   EK+    D G   F+    D    E +V 
Sbjct: 182 ISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVFL----DFSKSENLVP 236

Query: 260 KLISMTDGGLDY--TFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVT 317
           +++S T GG       + + + + +  ++  C    G   ++G+ +    +S     +V 
Sbjct: 237 EVVSATGGGGGAHGVLNLSASENAINTSVRFCRAN-GVIVLVGIPSGATCVSEVFDHVVK 295

Query: 318 GRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
                G++ G+   R D  + LD Y +GL++
Sbjct: 296 SIKIVGSSVGN---RADTREALDFYSRGLIR 323

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 93/362 (25%), Positives = 151/362 (41%), Gaps = 47/362 (12%)

Query: 30  VDAPKAHEVRIKIMNTAICHTDA--YTLSGVDPEGL-FPCILGHXXXXXXXXXXXXXTSV 86
           +D P  H V++ I  T IC +D   Y   G+    L  P +LGH             T V
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRV 84

Query: 87  KVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMG 146
           K+GD V        +     K G+ NLC  +       +  DGT   + L  +D      
Sbjct: 85  KIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDF----- 137

Query: 147 CSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGT 206
                   +V     V+ ++   +EP S+   GV +      K A V+ G  V VFGAG 
Sbjct: 138 --------LVKLPDGVSYEEGACVEPLSV---GVHSN-----KLAGVRFGTRVVVFGAGP 181

Query: 207 VGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGAT-DFVNPMTDLKDGETIVNKLISMT 265
           VGL     A   G S VI VD+ D + Q + DFGA+  F +    + + + + +++  + 
Sbjct: 182 VGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVEKLL 241

Query: 266 DG-GLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWR-- 322
            G   D  F+C+G   V  +A     K  G    +G+   G+  +  P   V+G+  R  
Sbjct: 242 GGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEMRLI 297

Query: 323 ---GTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFED--LHMGTCLRT 377
                +FGD +   ++         G + +   ITHR +F++    ++    H G  ++T
Sbjct: 298 GCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDVVKT 351

Query: 378 VL 379
           ++
Sbjct: 352 II 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 93/362 (25%), Positives = 151/362 (41%), Gaps = 47/362 (12%)

Query: 30  VDAPKAHEVRIKIMNTAICHTDA--YTLSGVDPEGL-FPCILGHXXXXXXXXXXXXXTSV 86
           +D P  H V++ I  T IC +D   Y   G+    L  P +LGH             T V
Sbjct: 27  IDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRV 84

Query: 87  KVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMG 146
           K+GD V        +     K G+ NLC  +       +  DGT   + L  +D      
Sbjct: 85  KIGDRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDF----- 137

Query: 147 CSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGT 206
                   +V     V+ ++   +EP S+   GV +      K A V+ G  V VFGAG 
Sbjct: 138 --------LVKLPDGVSYEEGACVEPLSV---GVHSN-----KLAGVRFGTRVVVFGAGP 181

Query: 207 VGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGAT-DFVNPMTDLKDGETIVNKLISMT 265
           VGL     A   G S VI VD+ D + Q + DFGA+  F +    + + + + +++  + 
Sbjct: 182 VGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVEKLL 241

Query: 266 DG-GLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWR-- 322
            G   D  F+C+G   V  +A     K  G    +G+   G+  +  P   V+G+  R  
Sbjct: 242 GGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEMRLI 297

Query: 323 ---GTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFED--LHMGTCLRT 377
                +FGD +   ++         G + +   ITHR +F++    ++    H G  ++T
Sbjct: 298 GCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDVVKT 351

Query: 378 VL 379
           ++
Sbjct: 352 II 353

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 101/241 (41%), Gaps = 43/241 (17%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAEC--------------QKCKFCKSG 109
            P  +GH             T VKVGDHV+    + C              + C+ CK G
Sbjct: 67  LPLAMGHEMSGIIAKVGPRVTKVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKG 126

Query: 110 KTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVS 169
             NLC A     G GV+  G                    F+E  VV++  ++ + K++ 
Sbjct: 127 SENLC-AHSGFVGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIP 165

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
           L+ A+L+     T    AVK +  +KG +  V GAG +GL  +   +  G  K++V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVKLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVA 223

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTGNVHVMRNALE 287
           + + + +       F NP    + G   V  L  +T+   G DY++DC+G       +L+
Sbjct: 224 ERRLKMAKSLDVEVF-NPA---QHGHKSVELLRGLTESHDGFDYSYDCSGIQATFETSLK 279

Query: 288 A 288
           A
Sbjct: 280 A 280

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/351 (21%), Positives = 141/351 (40%), Gaps = 35/351 (9%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60
           +SST       K  + YE+   L  +D+ V  P+ +E+ + +  + +CHTD +   G  P
Sbjct: 19  LSSTISIPSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWP 78

Query: 61  -EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVR 118
            +   P + GH              + ++GD   I      CQ C+ C+ G  + C    
Sbjct: 79  LDTKLPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHA- 137

Query: 119 ETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGC 178
                                D+  +    TF +Y     +    I K   L   + + C
Sbjct: 138 ---------------------DLSGYTHDGTFQQYATADAIQAAHIPKGTDLAGVAPILC 176

Query: 179 GVTTGFGAAVKAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSY 237
              T +  A++++  + G+ VA+ G AG +G    Q AR  G  +V+ +D  ++K +   
Sbjct: 177 AGVTVY-KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFK 234

Query: 238 DFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSF 297
             G   F++  T  KD   I   ++  T GG     + + +   M  ++E   +  G   
Sbjct: 235 SLGGEIFID-FTKEKD---IPAAILEATQGGAHGVINVSVSEKAMSQSVEYV-RPQGTVV 289

Query: 298 IIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
           ++G+ A     S     +V     +G+  G+   R D  + ++ + +GL+K
Sbjct: 290 LVGLPANAVIKSNVFNHVVKSFSIKGSYVGN---RADSREAVEFFSRGLVK 337

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 97/240 (40%), Gaps = 41/240 (17%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQK--------------CKFCKSG 109
            P  +GH                KVGDHV+   T  C+               C  CK G
Sbjct: 67  LPQAMGHEMAGVVSRVGPGVKKFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKG 126

Query: 110 KTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVS 169
             N+C  +    G GV   G                    F+E  V+ +     +   + 
Sbjct: 127 YYNICSKLGLC-GAGVQSGG--------------------FAERVVMNESHCHKVPDDLP 165

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
           L+ A+L+          A++  N +KG +  V G+G +GL ++      GC+ ++V +  
Sbjct: 166 LDIAALIQPIAVCWH--ALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPA 223

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTGNVHVMRNALE 287
             ++ F+ + GAT F +P + L   E  +  L S+  G  G DYTFDC+GN +    ++E
Sbjct: 224 KIRRDFAKELGATVF-DP-SSLPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 93/362 (25%), Positives = 146/362 (40%), Gaps = 42/362 (11%)

Query: 8   AIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAY--TLSGVDPEGLF- 64
           A + KA +  E  K +     I      H V+++I  T IC +D +  T   +   G F 
Sbjct: 3   ATEQKAVILEEKGKIVFGNRPIPSIEDQHFVKVQIKATGICGSDVHFCTHGAI---GSFI 59

Query: 65  ---PCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQ 121
              P +LGH             T V VGD V        +  +   SG  NLC  ++   
Sbjct: 60  VKEPMVLGHESSGIVVEVGSEVTKVAVGDRVAIEPGYPSRYSEETVSGHYNLCPGMKFAA 119

Query: 122 GKGVMPDGTS-RFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180
              V  DGT  ++  +    ++      TF E  +V  ++V                   
Sbjct: 120 TPPV--DGTLLKYFQVPEDFVYKLPDDVTFEEGALVEPLAVAV----------------- 160

Query: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240
                 AVK A V+ GD V VFGAG VGL V    +  G ++V+ +D+ D+K   S + G
Sbjct: 161 -----HAVKLAGVKFGDKVVVFGAGPVGLLVGSVCKAFGATEVVSIDVVDKKLDKSLEMG 215

Query: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFI-I 299
           +T  +N   D+ +    +     +     +   DCTG    +R+++ AC  G     + +
Sbjct: 216 STIAIN-SKDMAEEALALEIQNDLNGQHPNKVIDCTGAEPCLRSSILACKPGGTVVQVGM 274

Query: 300 GVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQF 359
           G   A   +S    + +T +       GD +   D  QLL  Y+K  + +   ITHR  F
Sbjct: 275 GTTNASLPVSDIVIKELTFKGSMRYCHGDYQ---DAIQLL-KYKK--VDVKAIITHRFSF 328

Query: 360 DE 361
           D+
Sbjct: 329 DD 330

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 84/343 (24%), Positives = 136/343 (39%), Gaps = 41/343 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  V  E    L   D+ V  PK++E+ I +  + +CHTD +   G  P  +  P + GH
Sbjct: 40  KGVVFTEHNGELKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGH 99

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                           K+GD   I      C  C+ C++G    C               
Sbjct: 100 EGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMSCELCETGHEANC--------------- 144

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
                  E  D+  +    +F +Y     V    I +   L   + + C   T +  A+K
Sbjct: 145 -------EHADLSGYTHDGSFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALK 196

Query: 190 AANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
            AN++ G+ VA+ G AG +G   VQ A+  G  +V+ +D  +EK++     G   FV   
Sbjct: 197 TANLKPGEWVAISGAAGGLGSLAVQYAKAMGY-RVVGIDGGEEKEKLFRSLGGEVFV--- 252

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNAL-EACH--KGWGQSFIIGVAAAG 305
            D    + IV  + + T GG         NV V   A+ ++ H  +  G   ++G+ A  
Sbjct: 253 -DFTKSKDIVADIQNATKGGPQGVI----NVSVSEAAITQSTHYVRPTGTVVLVGLPANS 307

Query: 306 QEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
              S     +V      G+  G+   R D  + LD + +GL+K
Sbjct: 308 VVKSDIFSHVVKSINIVGSYVGN---RADTREALDFFARGLIK 347

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 97/230 (42%), Gaps = 43/230 (18%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAEC--------------QKCKFCKSG 109
            P  +GH             T VKVGDHV+    + C              + C  CK G
Sbjct: 67  LPQAMGHEMSGIIAKVGPKVTKVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKG 126

Query: 110 KTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVS 169
             NLC       G GV+  G                    F+E  VV++  ++ + K++ 
Sbjct: 127 CENLCTHAGFI-GLGVISGG--------------------FAEQVVVSEHHIIPVPKEIP 165

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
           L+ A+L+     T    AV+ +  +KG +  V GAG +GL  +   +  G  +++V ++ 
Sbjct: 166 LDVAALVEPLSVTWH--AVRLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVA 223

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTG 277
           + + + +   G   F +P    K GE  V  L ++T    G DY++DC+G
Sbjct: 224 ERRMELARRLGVEIF-DPR---KHGEKSVESLRALTKSHDGFDYSYDCSG 269

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 79/341 (23%), Positives = 139/341 (40%), Gaps = 37/341 (10%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE    L  +D+ V  PK +E+ I I  + +CHTD +   G  P  +  P + GH
Sbjct: 33  KGVIFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPLVGGH 92

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                        T+ ++GD   +    + C  C++C+ G  + C               
Sbjct: 93  EGAGVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKA------------ 140

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
                     D+  +    +F +Y     +    I K   L E A +L  GVT     A+
Sbjct: 141 ----------DLSGYTHDGSFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTV--YKAL 188

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K +  + G  VA+ G AG +G   VQ A   G  +V+ +D  + K++     G   FV+ 
Sbjct: 189 KTSGAKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVFVD- 246

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQE 307
            T  KD   +V+ +   T+GG     + + +   ++ + E   +  G   ++G+ A    
Sbjct: 247 FTKTKD---MVSAIQEATNGGPHAVVNVSVSEAAIQQSTEYV-RPTGTVVLVGLPAHAYV 302

Query: 308 ISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
            S     +V     +G+  G+   R D  + +D + + L+K
Sbjct: 303 KSEIFSHVVKSISIKGSYVGN---RADTREAIDFFSRNLVK 340

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 80/329 (24%), Positives = 135/329 (41%), Gaps = 46/329 (13%)

Query: 59  DPEGL-FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAEC--------------QKC 103
           D  GL  P  +GH             T++K GDHV+   T  C               +C
Sbjct: 61  DVSGLGLPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAEC 120

Query: 104 KFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVA 163
             C+ G  N C  +    G GV   G                    F+E  VV++  VV 
Sbjct: 121 AACQRGFYNCCAHLG-FMGLGVHSGG--------------------FAEKVVVSEKHVVK 159

Query: 164 IDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKV 223
           I   + L+ A+L+   ++  +  AV+ + +QKG +  V GAG +GL+ +   +  G SK+
Sbjct: 160 IPNTLPLDVAALVEP-ISVSW-HAVRISKLQKGQSALVLGAGPIGLATILALQGHGASKI 217

Query: 224 IVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMR 283
           +V +  + ++  +   G   F +P    +D   I+ KL    + G D+ +DC+G   V  
Sbjct: 218 VVSEPAEIRRNQAAKLGVETF-DPSEHKEDAVNILKKLAPGGE-GFDFAYDCSG---VKP 272

Query: 284 NALEACHKGWGQSFIIGVAAAGQE-ISTRPFQL-VTGRVWRGTAFGDIKGRTDMPQLLDD 341
                 H    +   + +A  G + I  +P  + +  +   G+    IK   D+ Q L +
Sbjct: 273 TFDTGVHATTFRGMYVNIAIWGHKPIDFKPMDVTLQEKFVTGSMCYTIKDFEDVVQALGN 332

Query: 342 YEKGLLKIDEFITHRRQF-DEINDGFEDL 369
               + K    IT R++  D    GF++L
Sbjct: 333 GSIAIDKARHLITGRQKIEDGFTKGFDEL 361

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 82/378 (21%), Positives = 151/378 (39%), Gaps = 40/378 (10%)

Query: 2   SSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPE 61
           S++ G  +  KA + YE    L  +D+ V  PK +E+ + +  + +CHTD +   G  P 
Sbjct: 25  STSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPL 84

Query: 62  GL-FPCILGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRE 119
               P + GH             T+ ++GD+  +      C  C++C++G  + C    E
Sbjct: 85  ATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCA---E 141

Query: 120 TQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCG 179
               G   DG                   +F +Y     V    I +   L   + + C 
Sbjct: 142 ADLSGYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCA 182

Query: 180 VTTGFGAAVKAANVQKGDTVAV-FGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYD 238
             T +  A+K AN+  G  VA+    G +G   VQ A+  G  +V+ +D    K      
Sbjct: 183 GVTVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALFKK 240

Query: 239 FGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFI 298
            G   F+    D    + IV  +   T+GG     + + +   +  +++   +  G   +
Sbjct: 241 LGGEVFI----DFTKSKDIVADIQEATNGGPHGAVNVSVSEAAIVQSVKYI-RPTGTVVL 295

Query: 299 IGVAAAGQEISTRPFQLVTGRV-WRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRR 357
           +G+  A   +++  F  V   +  +G+  G+   R DM + +D + +GL+K    I    
Sbjct: 296 VGL-PANSYVNSEIFSHVIKSISIKGSYVGN---RADMREAIDFFTRGLVKAPIKII--- 348

Query: 358 QFDEINDGFEDLHMGTCL 375
              E+   + +L  G  +
Sbjct: 349 GLSELPTAYHELEAGNMV 366

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 99/377 (26%), Positives = 151/377 (40%), Gaps = 56/377 (14%)

Query: 20  KKPLVVQDVIVDAPK---AHEVRIKIMNTAICHTDA--YTLSGVDPEGLF----PCILGH 70
           +KP V+     D P+    H V++ I  T IC +D   YT   +   G F    P +LGH
Sbjct: 10  QKPGVITVDKRDVPEIKDPHYVKLHIKATGICGSDVHYYTQGAI---GQFVVKSPMVLGH 66

Query: 71  XXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGT 130
                        T+VKVGD V        +      SG  NLC  +             
Sbjct: 67  ESSGIVAEVGSAVTNVKVGDRVAIEPGIPSRYSDETMSGNYNLCPHM------------- 113

Query: 131 SRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASL---LGCGVTTGFGAA 187
             F      D        T ++Y +  +  V  +   +S E  +L   +  GV      A
Sbjct: 114 -VFAATPPYD-------GTLTKYYLAPEDFVYKMPDHLSFEEGALAEPMSVGVH-----A 160

Query: 188 VKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
            K A  + G  V V GAG VGL     AR  G ++V+ VDI +EK + S  FGAT  V+ 
Sbjct: 161 NKLAGTRFGSKVLVSGAGPVGLLAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSS 220

Query: 248 MTDLKDGETIVNKLISMTDGGL-DYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQ 306
            +D    E  V+++  +  G L +   +C+G    +R  ++AC K  G    +G+   G+
Sbjct: 221 SSDE---ERFVSEVSKVLGGDLPNIVLECSGAQPAIRCGVKAC-KAGGHYVQVGM---GK 273

Query: 307 EISTRPFQLVTGR--VWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIND 364
           +    P   V  +   + G  F   KG  D    +     G +     I+HR  FD+  +
Sbjct: 274 DDVNFPISAVGSKEITFHG-CFRYKKG--DFADSVALLSSGRINGKPLISHRFAFDKAPE 330

Query: 365 G--FEDLHMGTCLRTVL 379
              F   H    ++T++
Sbjct: 331 AYKFNAEHGNEVVKTII 347

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 97/363 (26%), Positives = 150/363 (41%), Gaps = 44/363 (12%)

Query: 30  VDAPK---AHEVRIKIMNTAICHTDA-YTLSGVDPEGLF--PCILGHXXXXXXXXXXXXX 83
           V  PK    +EV I+I  T IC +D  Y   G     +   P +LGH             
Sbjct: 23  VSIPKISDPNEVIIQIKATGICGSDIHYYTHGRIANYVVESPMVLGHESSGIVALIGENV 82

Query: 84  TSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFH 143
            ++KVGD V        +     K G+ NL              D   +F      D   
Sbjct: 83  KTLKVGDRVALEPGIPDRFSPEMKEGRYNL--------------DPNLKFAATPPFD--- 125

Query: 144 FMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFG 203
                T ++Y       V  +   VS E  +L+   ++    A  K A ++ G    VFG
Sbjct: 126 ----GTLTKYYKTMKDFVYKLPDDVSFEEGALIE-PLSVAIHAN-KLAKIKFGARCVVFG 179

Query: 204 AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLIS 263
           AG +GL   + A + G + V+ VD+ + K + +  FGAT  VN   DL  G T V+ +I 
Sbjct: 180 AGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVN-SGDLPHGVT-VDSVIK 237

Query: 264 MTDG--GLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLV-TGRV 320
              G  G D  F+C+G    +R  +E C  G G    +G+   GQE    P  ++ T  +
Sbjct: 238 KAIGKKGADVVFECSGAEPCVRAGIEVCKAG-GTIVQVGM---GQEEIQFPISIIPTKEL 293

Query: 321 WRGTAFGDIKG-RTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFEDL--HMGTCLRT 377
                F   +G  +D  +L+   +   L +  FITHR  F +  + FE+   H    ++T
Sbjct: 294 TFQGCFRYCQGDYSDSIELVSSRK---LSLKPFITHRYSFKDAVEAFEETSHHPLNNIKT 350

Query: 378 VLK 380
           +++
Sbjct: 351 IIE 353

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 82/344 (23%), Positives = 135/344 (39%), Gaps = 40/344 (11%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL-FPCILGH 70
           K  + YE    L  +D+ V  PK +E+ + +  + +CHTD +   G  P  +  P + GH
Sbjct: 31  KGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLSVKLPLVGGH 90

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                         + ++GD   I      C  C+ C+SG  + C               
Sbjct: 91  EGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNC--------------- 135

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSL-EPASLLGCGVTTGFGAAV 188
                  E  D+  +    +F +Y     V    I +  +L E A +L  G+T     A+
Sbjct: 136 -------EHADLSGYTHDGSFQQYATADAVQAAKIPEGTNLAEVAPVLCAGITV--YKAL 186

Query: 189 KAANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNP 247
           K A++  G  V + G AG +G   VQ  +  G  +VI +D    K++     G   F++ 
Sbjct: 187 KEASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFKSLGGEVFID- 244

Query: 248 MTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHK---GWGQSFIIGVAAA 304
            T  K    +V  +   T+GG         NV V   A+    K     G   ++G+ A 
Sbjct: 245 FTKQKTDSDMVAAIQKATNGGPHGVI----NVSVSDAAISLSTKYVRTCGTVVLVGLPAH 300

Query: 305 GQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
               S     +V     +G+  G+   R D  + LD + +GL+K
Sbjct: 301 SVVKSDVFSHVVKSINIKGSYVGN---RADTREALDFFSRGLIK 341

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 70/323 (21%), Positives = 127/323 (39%), Gaps = 49/323 (15%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQK--------------CKFCKSG 109
            P  +GH             T  KVGDHV+      C+               C  CK G
Sbjct: 67  LPQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNKPWCSACKKG 126

Query: 110 KTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVS 169
             N+C  +      G++ +G                GC+   E   + +     + K + 
Sbjct: 127 HYNVCSNL------GLIGNGVQS------------GGCA---ERMCINESHCFKVPKDMP 165

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
           ++ A+L+     +    A+K A  ++G +V V G G +GL  +   +  GCS ++V +  
Sbjct: 166 MDIAALIQPIAVSWH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCSDIVVSEPA 223

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEAC 289
             +++ +   GAT +     + +     + K+I   D G DY FD +G    +  A+E C
Sbjct: 224 KVRRELAERMGATTYDPSQHNTEKNIQNLRKMILGGD-GFDYVFDNSGTPETLETAIE-C 281

Query: 290 HKGWGQSFIIGVAAAGQEISTRPFQLV-TGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLK 348
               G +  + +    + +   P  +    +++ G+       + D   ++D +E+GL+ 
Sbjct: 282 LTVRGTAVNVAMWPPHKRVEFSPMAVTKEEKIYTGSM---CYTQFDFEGVIDAFERGLID 338

Query: 349 ID---EFITHRRQFDEINDGFED 368
            D     IT +     I DG ED
Sbjct: 339 KDIARHMITAKVP---IEDGLED 358

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 100/243 (41%), Gaps = 43/243 (17%)

Query: 61  EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAEC--------------QKCKFC 106
           EGL P  +GH             T  KVGD V+   T  C              + C  C
Sbjct: 104 EGL-PQAMGHEIAGTIIECGPGVTKFKVGDRVVVEPTGTCKDRYRWPNSPNVDKEPCAAC 162

Query: 107 KSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDK 166
           K G  N+C  +    G GV   G                    F+E  V+ +     +  
Sbjct: 163 KKGLYNICSNLGLV-GAGVQSGG--------------------FAERLVMNERQCYKVPD 201

Query: 167 KVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVV 226
            +S++ A+L+     +    AV+ +  +KG +V + GAG +GL  +      G S+V+V 
Sbjct: 202 HMSMDVAALIQPIAVSWH--AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGVSEVVVS 259

Query: 227 DINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTGNVHVMRN 284
           +    ++ F+   GA  + +P    KD +  +  L S+  G  G DY FDC+GN   ++ 
Sbjct: 260 EPAKIRRDFAEKMGAIVY-DP--SAKDHDESIKYLRSIAPGGDGFDYAFDCSGNPATLKA 316

Query: 285 ALE 287
           A+E
Sbjct: 317 AIE 319

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 98/375 (26%), Positives = 144/375 (38%), Gaps = 59/375 (15%)

Query: 2   SSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDA--YTLSGVD 59
           S TQ   I  K  +    +KP+     + D    H V+++I  T IC +D   Y    + 
Sbjct: 3   SQTQTAVILQKKGLIEFGEKPI---PALTDE---HWVKVQIKATGICGSDVHFYKYGSI- 55

Query: 60  PEGLF----PCILGHXXXXXXXXXXXXXTSVKVGDHVI--PLYTAECQKCKFCKSGKTNL 113
             G F    P +LGH              ++KVGD V   P Y +   +     SG  NL
Sbjct: 56  --GDFVVKSPMVLGHESSGIIAEVGSAVKTLKVGDRVALEPGYPSRYTEATM--SGHYNL 111

Query: 114 CGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCS----TFSEYTVVADVSVVAIDKKVS 169
           C                            HF        T ++Y +     V  +   VS
Sbjct: 112 C-------------------------PFMHFAATPPCDGTLTKYYLTPFDFVYKLPDNVS 146

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
            E  +LL   ++ G  A  K A  + GD V VFGAG VGL     A++ G  +V+ +D+ 
Sbjct: 147 YEEGALLE-PLSVGVHAN-KQAGTRFGDKVVVFGAGPVGLLNGAVAKVFGALQVVFIDVV 204

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGL--DYTFDCTGNVHVMRNALE 287
           DEK + +  FGAT  +N      + E  +   I    GG+  D   +CTG    +R  + 
Sbjct: 205 DEKLERAKHFGATAVINSSKLRINDEFELAVAIKEKLGGVDPDIVLECTGAEPCIRAGIR 264

Query: 288 ACHKGWGQSFIIGVAAAGQEISTRPF-QLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGL 346
           A   G G    +G+   G++ +  P  Q     +     F    G  D    LD    G 
Sbjct: 265 ALKTG-GTFVQVGM---GKDDANIPITQFSCREITLKGCFRYCHG--DYQNALDLVATGK 318

Query: 347 LKIDEFITHRRQFDE 361
           + +   +T R  FDE
Sbjct: 319 IPVKLLVTRRFTFDE 333

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 96/242 (39%), Gaps = 42/242 (17%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAEC--------------QKCKFCKSG 109
            P  +GH                K+GDHV+   TA C                C+ C++G
Sbjct: 67  LPQAMGHEISGIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNG 126

Query: 110 KTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVS 169
             N+C  +  T G GV   G                    F+E  V+ +     I   + 
Sbjct: 127 MPNICKYLGLT-GAGVEGGG--------------------FAEKMVINEHHCHKIPHHMP 165

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
           L+ ASL+     +    AVK ++ ++G +V + G G +GL  +   +  GC  ++V +  
Sbjct: 166 LDVASLIQ--PISVCWHAVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPA 223

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTGNVHVMRNALE 287
             +++ +   GA  F      L +    +  L  M  G  G DYTFDC+G    ++ A+E
Sbjct: 224 LIRRELAEKMGARVFDPSNMSLDNS---IKTLTEMAPGSQGFDYTFDCSGIPATLKVAIE 280

Query: 288 AC 289
            C
Sbjct: 281 CC 282

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 105/234 (44%), Gaps = 29/234 (12%)

Query: 51  DAYTLSGVDPEGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQ---KCKFCK 107
           + + +SGV      P  +GH              ++KVGDHV+   T  C+   +    K
Sbjct: 58  EKHAMSGVG----LPQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVK 113

Query: 108 SGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCST--FSEYTVVADVSVVAID 165
                 C A ++             F+    +  F  +GC +  F+E  V+++  VV + 
Sbjct: 114 HASDEECAACKKD------------FYNCCSELGFCGLGCHSGGFAEKVVISEKHVVKVP 161

Query: 166 KKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIV 225
           K + L+ A+L+     +    AV+ + ++ G +  + GAG +GL+ V   +  G   ++V
Sbjct: 162 KDIPLDVAALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVV 219

Query: 226 VDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTG 277
            + +  +++ +   GA  F NP      G+  V++L  +  G  G D+++DC+G
Sbjct: 220 SEPSASRRKQAEALGALTF-NP---FDHGDKAVDELRKIPPGSDGFDFSYDCSG 269

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 74/141 (52%), Gaps = 8/141 (5%)

Query: 150 FSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGL 209
           FSE  V+++  V+ I K++ L+ A+L+   ++  +  AVK +N++ G +  V GAG +GL
Sbjct: 147 FSEKVVISEQHVIKIPKEIPLDIAALVEP-ISVSW-HAVKISNLKPGQSALVLGAGPIGL 204

Query: 210 SVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG-- 267
           + +   +  G  K++V +    +++ +   G   F NP    + GE  V +L  +  G  
Sbjct: 205 ATILALQGHGAGKIVVSEPAQIRREQAAKLGVETF-NP---FEHGEKAVEELRKIPPGGD 260

Query: 268 GLDYTFDCTGNVHVMRNALEA 288
           G D++FDC+G        L A
Sbjct: 261 GFDFSFDCSGMKATFDTGLHA 281

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 105/280 (37%), Gaps = 60/280 (21%)

Query: 37  EVRIKIMNTAICHTDAYTLS----------GVDPEG--LFPCILGHXXXXXXXXXXXXXT 84
           EV I++    IC TD +  S          G  P      P  +GH             T
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 85  SVKVGDHVIPLYTAEC--------------QKCKFCKSGKTNLCGAVRETQGKGVMPDGT 130
            VKVGDHV+      C              + C  C+ G  N+C                
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHA------------- 134

Query: 131 SRFHTLEGKDIFHFMGCST--FSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAV 188
                      F  +G S   F+E   V+    + I K + L+ A+L+     T   A  
Sbjct: 135 ----------CFTGLGTSGGGFAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA-- 182

Query: 189 KAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
           K A  QKG T  V GAG +GL+ +   +  G SK++V ++   ++  +   G   F NP 
Sbjct: 183 KVAGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NP- 240

Query: 249 TDLKDGETIVNKLISMTDG--GLDYTFDCTGNVHVMRNAL 286
            + KD    + +L  + +G  G D  FDC+G       AL
Sbjct: 241 AEHKDA---IAELRKIPEGATGFDAAFDCSGVKATFNTAL 277

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 88/216 (40%), Gaps = 27/216 (12%)

Query: 23  LVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGHXXXXXXXXXXX 81
           L  +D+ V  P + E+ I +  + +CHTD +   G  P     P + GH           
Sbjct: 19  LEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVALGE 78

Query: 82  XXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKD 140
                KVGD   I      C  C++C+ G  + C            P      +T +G  
Sbjct: 79  NVKGWKVGDLAGIKWLNGSCMACEYCELGNESNC------------PHADLSGYTHDG-- 124

Query: 141 IFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVA 200
                   +F +Y     V    I +   L   + + C   T +  A+K+A+++ G  VA
Sbjct: 125 --------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSADLKAGQWVA 175

Query: 201 VFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQF 235
           + GA G +G   VQ AR  G  +V+ +D  D+K++ 
Sbjct: 176 ISGACGGLGSLAVQYARAMG-YRVLGIDGGDDKRKL 210

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 100/386 (25%), Positives = 151/386 (39%), Gaps = 71/386 (18%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPK---AHEVRIKIMNTAICHTDA--YTL 55
           MS TQ        AV  + K  +  +D+   AP+   +H V+I +  T IC +D   YT 
Sbjct: 1   MSGTQ-------KAVVLQKKGEITFEDI--PAPEITDSHYVKIHVKKTGICGSDIHYYTH 51

Query: 56  SGVDPEGLF----PCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKT 111
             +   G F    P +LGH             T V+VGD V        +     KSG  
Sbjct: 52  GSI---GEFVVKKPMVLGHESSGVVVEVGKDVTLVQVGDRVAIEPGVPSRYSDETKSGHY 108

Query: 112 NLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLE 171
           NLC  +               F      D        T  +Y +  +  +V +   VS E
Sbjct: 109 NLCPHMA--------------FAATPPYD-------GTLVKYYLAPEDFLVKLPDHVSFE 147

Query: 172 P---ASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDI 228
               A  L  GV      A + A    G  V VFGAG VGL     A   G S V+ VD+
Sbjct: 148 EGACAEPLAVGV-----HANRLAETSFGKNVVVFGAGPVGLVTGAVAAAFGASAVVYVDV 202

Query: 229 NDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG-GLDYTFDCTGNVHVMRNALE 287
            + K + S DFGAT+ +N  T  K  + +   + S   G   +   DC+G    +R A++
Sbjct: 203 FENKLERSKDFGATNTIN-STKYKSEDELTEVIKSELKGEQPEIAIDCSGAEICIRTAIK 261

Query: 288 ACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYE---- 343
              K  G    +G+   G++    P  ++  +  R    G  +         +DY+    
Sbjct: 262 VL-KAGGSYVQVGM---GKDNINFPIAMIGAKELR--VLGSFR------YYFNDYKIAVK 309

Query: 344 ---KGLLKIDEFITHRRQFDEINDGF 366
              +G + + + ITH  +F+E  D +
Sbjct: 310 LISEGKVNVKKMITHTFKFEEAIDAY 335

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 85/373 (22%), Positives = 147/373 (39%), Gaps = 40/373 (10%)

Query: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSG--- 57
           +SST     Q KA V YE    L   D+ V  PK +E+ + I  + +CHTD +   G   
Sbjct: 23  LSSTAIPTTQ-KAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWA 81

Query: 58  VDPEGLFPCILGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGA 116
           + P+   P + GH             T+ ++GD+  +      C +C+FC+ G    C  
Sbjct: 82  IKPK--LPLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNC-- 137

Query: 117 VRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLL 176
             ET              TL G     +    TF +Y     +    I     L   + +
Sbjct: 138 --ETP-------------TLSG-----YTHDGTFQQYATADAIHAAHIPPGTDLAKVAPI 177

Query: 177 GCGVTTGFGAAVKAANVQKGDTVAV-FGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQF 235
            C   T +  A+K A +  G  VA+    G +G   VQ A   G  +V+ +D  +EK+  
Sbjct: 178 LCAGITVY-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMGY-RVVGIDGGNEKEAL 235

Query: 236 SYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQ 295
               G   FV    D    + IV+ +   T GG     + + + + +  ++E   +  G 
Sbjct: 236 FRSLGGETFV----DFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVEYV-RPTGT 290

Query: 296 SFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITH 355
             ++G+       S     ++     +G+  G+   R D  + ++ + +GL++    I  
Sbjct: 291 VVLVGLPPDATVKSDVLTHVLKSINIKGSYVGN---RADTKEAIEFFTRGLVQSPIKIIG 347

Query: 356 RRQFDEINDGFED 368
             Q +E     E+
Sbjct: 348 LSQLEEAYKAMEE 360

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 74/360 (20%), Positives = 134/360 (37%), Gaps = 35/360 (9%)

Query: 12  KAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP-EGLFPCILGH 70
           KA V  E    L  +D+ V   KA+E+ I +  + +CH+D Y      P     P + GH
Sbjct: 21  KAMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPLVGGH 80

Query: 71  XXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                         + K+GD   +    + C  C+ C+ G    C    +++  G   +G
Sbjct: 81  EGAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LKSEYNGFTRNG 137

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
                              +F +Y  V  +    +     L   +   C   T +  A+K
Sbjct: 138 -------------------SFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY-KAIK 177

Query: 190 AANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
           +AN++ G  +A+ GA G +G   +Q  +  G  +V+ +D  + K     + G   F+   
Sbjct: 178 SANIRAGQWMAITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKELGGEVFI--- 233

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEI 308
            D    + +V  ++S T+GG             +  +++      G   I+ V       
Sbjct: 234 -DFTKSKDLVADVVSATNGGAHGVLSIAATEDAINTSVKYVRSN-GTCVIVSVPDGAYCK 291

Query: 309 STRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFED 368
           S    Q+V      GT   +   R +  + +D + +GL+K    I    Q  ++    E 
Sbjct: 292 SDVFNQVVKSISIVGTYVAN---RAETREAIDFFARGLVKAPIEIVPLSQLLQVYKKIES 348

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 97/241 (40%), Gaps = 42/241 (17%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAEC--------------QKCKFCKSG 109
            P  +GH                +VGDHV+   T+ C              + C  CK G
Sbjct: 67  LPQAMGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRG 126

Query: 110 KTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVS 169
             N+C  +    G GV   G                    FSE  V+    V+ I K + 
Sbjct: 127 LYNICSHLGLC-GVGVQSGG--------------------FSERVVMNQKHVIKIPKHIP 165

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
           L+ A+L+     +    A++ + +  G +  V G G +GL  +   +  G SK++V +  
Sbjct: 166 LDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKIVVSEPA 223

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTGNVHVMRNALE 287
             +++ +   GA  F +P T+ ++ E  V  L  +  G  G DY+FDC+G     R ++ 
Sbjct: 224 KNRRELAKLMGAEVF-DP-TEWEEHEA-VEYLRKVAPGGDGFDYSFDCSGLPVTFRASVH 280

Query: 288 A 288
           A
Sbjct: 281 A 281

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 74/142 (52%), Gaps = 8/142 (5%)

Query: 149 TFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVG 208
            F+E  VV +  +V + ++V  +  +L+   ++  +  AV+ +  +KG +  + GAG +G
Sbjct: 148 AFAERVVVGERHIVKLPEEVPTDVGALVE-PISVAW-HAVRVSKFEKGKSALILGAGPIG 205

Query: 209 LSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG- 267
           L+ +   +  G SK++V ++ + ++  +   G   F +P    K G+  V +L ++  G 
Sbjct: 206 LAAILALKAHGASKIVVSELAERRRILASKMGVEVF-DPS---KHGDNAVTELRNIPRGQ 261

Query: 268 -GLDYTFDCTGNVHVMRNALEA 288
            G DY FDC+G       AL+A
Sbjct: 262 HGFDYAFDCSGVKATFNTALKA 283

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 81/155 (52%), Gaps = 20/155 (12%)

Query: 137 EGKDIFHF--------MGCSTFSEYT-VVADVSVVAIDKKVSLEPASLLGCGVT---TGF 184
           +GKD+ +F        +  STF++YT   ++ +V+ + K+ + E   L   G+    T  
Sbjct: 78  KGKDVTNFEIGDKVAYISNSTFAQYTKFPSEGTVMKLSKETNDEELKLYAAGLLQALTAL 137

Query: 185 GAAVKAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATD 243
               +A +V+KGD + +F A G VGL + Q  RM+G   + V    DEK + + ++GA  
Sbjct: 138 SFTNEAYHVRKGDYILLFAAAGGVGLILNQLLRMKGAHAIAVAS-TDEKLEIAKEYGAEY 196

Query: 244 FVNPMTDLKDGETIVNKLISMTDG-GLDYTFDCTG 277
            +N        E I+ K++ +T+G G+D +FD  G
Sbjct: 197 LIN-----SSKEDILKKVLEITNGEGVDASFDSVG 226

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 107/244 (43%), Gaps = 25/244 (10%)

Query: 140 DIFHFMGCSTFSEYTVVADVSVVA------IDKKVSLEPASLLGCGVTTGFGAAVKAANV 193
           D   ++   TF++YT +A+   ++       DK++ L  ASL    V T    A +A  V
Sbjct: 100 DKVAYLSAGTFAQYTKIAETGHISKLPENTTDKQLELYAASL--VQVLTALTFAKEAYTV 157

Query: 194 QKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLK 252
           +KGD V ++ A G VGL+  Q  +  G   + V    DEK Q + +FGA   VN      
Sbjct: 158 KKGDFVLLYAAAGGVGLAFNQILKRLGAHTIAVAS-TDEKLQLAKEFGAEYLVN-----S 211

Query: 253 DGETIVNKLISMTDG-GLDYTFDCTGNVHVMRNALEAC-HKGWGQSFIIGVAAAG-QEIS 309
             E ++ +++ +T G G+D  +D  G        L A   KG   SF  G A+     I+
Sbjct: 212 SKEDVLARVLEITQGQGVDVAYDSIGK-DTFETTLSALRRKGTFVSF--GNASGPVPPIA 268

Query: 310 TRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEF---ITHRRQFDEINDGF 366
                    ++ R T FG I  + +     ++  K LL  +EF   IT     +E     
Sbjct: 269 ISRLSPKNIKILRPTLFGYIASQEEWAYYSEELIK-LLHSEEFKVLITKIYPLEEYRKAT 327

Query: 367 EDLH 370
           E+L 
Sbjct: 328 EELE 331

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 90/242 (37%), Gaps = 43/242 (17%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQK--------------CKFCKSG 109
            P  +GH             T  KVGD V+   T  C+               C  CK G
Sbjct: 67  LPQAMGHEMAGTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRG 126

Query: 110 KTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVS 169
             N+C  +    G GV   G                    F+E  V+ +     + + V 
Sbjct: 127 LYNICSYLG-LCGAGVQSGG--------------------FAERVVINESHCYKVPEFVP 165

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
           L+ A+L+          A+   + + G T  + GAG +GL  +      GCS + V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPA 223

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTGNVHVMRNALE 287
             +++ +   GA  F       KD    ++ L S+  G  G DYTFDC+G + V  NA  
Sbjct: 224 KVRRELAEKMGARVFDPTAHAAKDS---IDYLRSVAPGGDGYDYTFDCSG-LEVTLNASV 279

Query: 288 AC 289
            C
Sbjct: 280 QC 281

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 91/242 (37%), Gaps = 43/242 (17%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQK--------------CKFCKSG 109
            P  +GH              ++KVGD V+   T  C+               C  CK G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKG 126

Query: 110 KTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVS 169
             N+C  +    G GV   G                    F+E  V+ +     +   V 
Sbjct: 127 YYNICSYLG-LCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
           L+ A+L+          A++    + G T  + GAG +GL  +      GC  ++V +  
Sbjct: 166 LDVAALIQPLAVCWH--AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPA 223

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTGNVHVMRNALE 287
             +++ +   GA  +       K+    ++ L S+ DG  G DYTFDC+G + V  NA  
Sbjct: 224 KVRRELAEKMGARVYDPTAHAAKES---IDYLRSIADGGDGFDYTFDCSG-LEVTLNAAI 279

Query: 288 AC 289
            C
Sbjct: 280 QC 281

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 79/163 (48%), Gaps = 20/163 (12%)

Query: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADV-SVVAIDKKVSLEPASLLGCG 179
           +GKGV           E  D   ++  STF++Y+ ++    V+ + K  S E   L   G
Sbjct: 78  KGKGVT--------NFEVGDQVAYISNSTFAQYSKISSQGPVMKLPKGTSDEELKLYAAG 129

Query: 180 ---VTTGFGAAVKAANVQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQF 235
              V T      +A +V+KGD V +F A G VGL + Q  +M+G   + V    DEK + 
Sbjct: 130 LLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAVAS-TDEKLKI 188

Query: 236 SYDFGATDFVNPMTDLKDGETIVNKLISMTDG-GLDYTFDCTG 277
           + ++GA   +N        E I+ +++  T+G G+D +FD  G
Sbjct: 189 AKEYGAEYLIN-----ASKEDILRQVLKFTNGKGVDASFDSVG 226

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 127/322 (39%), Gaps = 54/322 (16%)

Query: 65  PCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAEC---QKCKFCKSGKTNLCGAVRETQ 121
           P  +GH             T VKVGD V+   T  C    +    K  KT  C A ++  
Sbjct: 68  PQAMGHEFSGYVAKVGPKVTKVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACKDRC 127

Query: 122 GKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVT 181
                 D    +    G  +        F+E  V  +  VV +     ++ A+L+     
Sbjct: 128 ------DNCCEYAGFMGLGVVG----GAFAERIVTIEHHVVKLPDGFPMDVAALI----- 172

Query: 182 TGFGAAVKAANVQK---GDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYD 238
                A  AA V K   G +  V GAG +GL+++   + +G SK+IV +    +++ +  
Sbjct: 173 EPLSVAWHAARVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADR 232

Query: 239 FGATDFVNPMTDLKDGETIVNKLISMT-DG-GLDYTFDCTGNVHVMRNALEACHKGWGQS 296
                F +P T    G+  V  L S T DG G D+ FDC+G        L+A H    + 
Sbjct: 233 MHVETF-DPST---HGDKSVAMLRSKTFDGKGFDFAFDCSGVPATFNTGLQAAHY---RG 285

Query: 297 FIIGVAAAGQEISTRPFQL------VTGRVWRGTAFGDIKGRT--DMPQLLDDYEKGLLK 348
            +  VA  G      P  +      VTG +          G T  D  ++ + ++ G + 
Sbjct: 286 TLCNVAIWGSGFDFNPMGITLLEKDVTGSI----------GYTVQDFAEVTEAFKDGKID 335

Query: 349 IDE---FITHRRQFDEINDGFE 367
           I+E    IT R +   I DG+E
Sbjct: 336 IEECKHLITGRYR---IEDGWE 354

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 102/222 (45%), Gaps = 17/222 (7%)

Query: 150 FSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGL 209
           F+E  +V +  +V I  ++ L+ A+L+     T   A  K     KG T  + G+G +GL
Sbjct: 146 FAEQILVGEQHIVRIPDEIPLDVAALVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGL 203

Query: 210 SVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGL 269
           +++   +  G SK++V ++   +++ +       F +P    K+    + +L++    G 
Sbjct: 204 AMILVLKALGASKIVVSEVAQVRRKLAEKMKVEVF-DPSVHGKNTSNEL-RLLTENKDGF 261

Query: 270 DYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDI 329
           D+ FDC+G    M  A+   H    +  I+ VA  G   ST  F ++   +   T  G I
Sbjct: 262 DFAFDCSGLEVTMNTAI---HATKCRGTIVNVAVWG---STMEFNMMDITLQEKTLIGSI 315

Query: 330 KGRT-DMPQLLDDYEKGLLKIDE---FITHRRQFDEINDGFE 367
                D  +++    K  + I++    IT +++   I DG+E
Sbjct: 316 GYVVRDFEEVVASIHKRAISIEDCRHLITGKQK---IEDGWE 354

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 69/144 (47%), Gaps = 12/144 (8%)

Query: 140 DIFHFMGCSTFSEYTVVA-DVSVVAIDKKVSLEPASLLGCGVTTGFGAAV---KAANVQK 195
           D   ++  STF+++T    +  ++ + K +S E   ++   +  G        +A NVQK
Sbjct: 108 DKVAYLSASTFAQFTKYPQNGHLIKLPKDISAEKEKIIAGSLVQGLTPLTFIDEAYNVQK 167

Query: 196 GDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDG 254
           GD + V+ A G VGL   Q  + RG  + I V   DEK Q + ++GA   +N   D    
Sbjct: 168 GDFILVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTKD---- 222

Query: 255 ETIVNKLISMTDG-GLDYTFDCTG 277
             IV K+   T+G G+   FD  G
Sbjct: 223 -DIVEKVKEFTNGEGVAAAFDSIG 245

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 93/242 (38%), Gaps = 43/242 (17%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQK--------------CKFCKSG 109
            P  +GH               +KVGD V+   T  C+               C  CK G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKG 126

Query: 110 KTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVS 169
             N+C  +    G GV   G                    F+E  V+ +     +   V 
Sbjct: 127 YYNICSYLG-LCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
           L+ A+L+          A+     + G T  + GAG +GL  +      GC  ++V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPA 223

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTGNVHVMRNALE 287
             +++ +   GA  + +P T+    E+I + L S+ +G  G DYTFDC+G + V  NA  
Sbjct: 224 KLRRELAEKMGARVY-DP-TEHAARESI-DYLRSVAEGGDGFDYTFDCSG-LEVTLNAAI 279

Query: 288 AC 289
            C
Sbjct: 280 QC 281

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 93/242 (38%), Gaps = 43/242 (17%)

Query: 64  FPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQK--------------CKFCKSG 109
            P  +GH               +KVGD V+   T  C+               C  CK G
Sbjct: 67  LPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKG 126

Query: 110 KTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVS 169
             N+C  +    G GV   G                    F+E  V+ +     +   V 
Sbjct: 127 YYNICSYLG-LCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVP 165

Query: 170 LEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDIN 229
           L+ A+L+          A+     + G T  + GAG +GL  +      GC  ++V +  
Sbjct: 166 LDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPA 223

Query: 230 DEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTGNVHVMRNALE 287
             +++ +   GA  + +P T+    E+I + L S+ +G  G DYTFDC+G + +  NA  
Sbjct: 224 KLRRELAEKMGARVY-DP-TEHAAKESI-DYLRSIAEGGDGFDYTFDCSG-LEITLNAAI 279

Query: 288 AC 289
            C
Sbjct: 280 QC 281

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 68/144 (47%), Gaps = 12/144 (8%)

Query: 140 DIFHFMGCSTFSEYTVVADVS-VVAIDKKVSLEPASLLGCGVTTGFGAAV---KAANVQK 195
           D   ++  +TF+++T V + + V  +    S E   L   G+  G  A     +A +V+K
Sbjct: 89  DKVSYIAGATFAQFTKVPNSTHVFKLPDTTSTEQLKLYAAGMIQGLTALTFVNEAYDVKK 148

Query: 196 GDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDG 254
           GD V ++ A G VGL   Q  RMRG   + V   N EK   + + GA   +N   D    
Sbjct: 149 GDYVLLYAAAGGVGLIFNQLLRMRGAHTIAVASTN-EKLSLAKENGAEFLINSKED---- 203

Query: 255 ETIVNKLISMTDG-GLDYTFDCTG 277
             I+ K+  +T G G+D  FD  G
Sbjct: 204 -NILEKVQQITKGNGVDVAFDSVG 226

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 103/226 (45%), Gaps = 37/226 (16%)

Query: 140 DIFHFMGCSTFSEYT------VVADVSVVAIDKKVSLEPASLL-GCGVTTGFGAAVKAAN 192
           D   +M  STF++YT      +++ +     D ++ +  A+L+ G    T    A K   
Sbjct: 90  DKVAYMSSSTFAQYTKYSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYK--- 146

Query: 193 VQKGDTVAVFGA-GTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDL 251
           V++GD + ++ A G VGL + Q  + RG   + VV   +EK++ +  FGA   +N     
Sbjct: 147 VKEGDYILLYAAAGGVGLLMDQLLKERGAHAIAVVS-TEEKEELAKKFGAEYVIN----- 200

Query: 252 KDGETIVNKLISMT-DGGLDYTFDCTGN--VHVMRNALEACHKGWGQSFIIGVAAAGQEI 308
              E I+ + + +T D G+D  FD  G     +  NAL+   KG   SF+    A+G   
Sbjct: 201 SSKEDILKRALEITNDKGVDAVFDSVGKDTFDISLNALKL--KG---SFVSFGNASG--- 252

Query: 309 STRPFQLV-----TGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKI 349
              PF L        R+ R T FG +      P+  D Y K L ++
Sbjct: 253 PVPPFALSRLSSKNIRLMRPTLFGYLA----EPEDWDHYSKKLFEL 294

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 105/270 (38%), Gaps = 53/270 (19%)

Query: 34  KAHEVRIKIMNTAICHTDAYTLSGVDPEGLF--------------PCILGHXXXXXXXXX 79
           K  +V I I+   IC TD + L  +D    F              P  +GH         
Sbjct: 25  KPDDVLIDIVWCGICGTDLHEL--LDGPNFFPKDGETHEISGRGLPQAMGHEMAGVVSQV 82

Query: 80  XXXXTSVKVGDHVIPLYTAECQK----------CKFCKSGKTNLCGAVRETQGKGVMPDG 129
               T  + GDHV+   T  CQ           CK CK G  N+C  +    G GV   G
Sbjct: 83  GSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCKACKRGMHNVCVHLGLC-GCGVQSGG 141

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
                               F+E  V+ +     +   + L+ A+L+          AVK
Sbjct: 142 --------------------FAEKVVIGEKHCFKVPSWIPLDVAALIQPLAVCWH--AVK 179

Query: 190 AANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMT 249
              V++G +  + G G +GL ++   +  GC+ ++V +    ++  +   GA    NPM 
Sbjct: 180 LGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIVVSEPAKIRRDLAEKMGAI-VSNPM- 237

Query: 250 DLKDGETIVNKLISMTDG--GLDYTFDCTG 277
           D K  E  +  L S++    G D+TFDC+G
Sbjct: 238 DFKTNEENIKNLCSLSPNGEGYDFTFDCSG 267

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 107/240 (44%), Gaps = 18/240 (7%)

Query: 150 FSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGD--TVAVFGAGTV 207
           F+E  VV +  VV + ++V  +  +L+   ++  +  AVK A  +KG      V GAG +
Sbjct: 146 FAEQVVVGERHVVKLPEEVPTDVGALVE-PLSVAW-HAVKVAGFEKGSGKNALVLGAGPI 203

Query: 208 GLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDF-VNPMTDLKDGETIVNKLISMTD 266
           GL+ +   +  G SK++V ++   +++ +   G   F  +   D K G   + ++    D
Sbjct: 204 GLATILALKAHGASKIVVSELAAIRRELALKMGVEVFDPSKHGDEKQGIKKLREIPEDHD 263

Query: 267 GGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAG-QEISTRPFQLVTGRVWRGTA 325
            G D+ FDC+G       AL   H    +   + VA  G   I   P  +         +
Sbjct: 264 -GFDFAFDCSGVETTFNTAL---HSLTFRGTAVNVAIWGPHPIDYYPMDITLQEKKLTGS 319

Query: 326 FGDIKGRTDMPQLLDDYEKGLLKIDE---FITHRRQFDE-INDGFEDL--HMGTCLRTVL 379
            G +    D  +++D   KG + I+E    IT R++ +     GF +L  H  T ++ ++
Sbjct: 320 IGYV--VQDFEEVVDALHKGDISIEECKHLITGRQKLENGWEKGFMELMNHKETNIKILM 377

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 109/283 (38%), Gaps = 28/283 (9%)

Query: 37  EVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXXXXXXXXTS-VKVGDHV-IP 94
           ++ +KI    +C +D +  SG   +   P I+GH             TS VKVGD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 95  LYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYT 154
                C KCK C +G  + C            P+    + T        ++    +++Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYC------------PNAIQTYSTPYEDG---YVSKGGYADYV 139

Query: 155 VVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQG 214
            V +   V I + +    A+ L CG  T F   ++      G  VA+ G G +G   V  
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 215 ARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFD 274
           A+  G ++V  +     KK+ +   GA  F+    +    E   ++        LD    
Sbjct: 199 AKAMG-AEVYAISRTSSKKEDAMKLGADHFIATKEEPDWHEKYFDE--------LDLVVV 249

Query: 275 CTGNV-HVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLV 316
           C G+V  +  N L       G+   I +    + +  +PF LV
Sbjct: 250 CAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV 292

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 68/136 (50%), Gaps = 9/136 (6%)

Query: 145 MGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANV----QKGDTVA 200
           +  STF EYTV     V  + +++ L+ AS +G  + T   A     NV    ++  ++ 
Sbjct: 142 LRTSTFQEYTVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIV 201

Query: 201 VFGAGT-VGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVN 259
           ++G  T VG+ VVQ A+  G +K+I +  + + +Q+    GAT  ++     +D   IVN
Sbjct: 202 IWGGSTGVGIFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIHREEKTED---IVN 257

Query: 260 KLISMTDGGLDYTFDC 275
           ++  +   G+ +  D 
Sbjct: 258 EIKKICPNGVSHGVDL 273

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 101/243 (41%), Gaps = 43/243 (17%)

Query: 61  EGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAEC--------------QKCKFC 106
           EGL P  +GH                +VGD V+   T  C              ++C  C
Sbjct: 65  EGL-PQAMGHEIAGIVSEIGPKVKKFQVGDRVVVEPTGTCKDRYRWPDAPNANQEECAAC 123

Query: 107 KSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDK 166
           K G  N+C  +    G GV   G                    F+E  V+ +     I +
Sbjct: 124 KKGLYNICSNLGLV-GCGVQSGG--------------------FAERMVMNEAKCYKIPE 162

Query: 167 KVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVV 226
            ++++ A+L+     +    AV+ +  + G +V + G G +GL  +      G ++V+V 
Sbjct: 163 HLTMDVAALIQPIAVSWH--AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVVVS 220

Query: 227 DINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGG--LDYTFDCTGNVHVMRN 284
           +    ++  +   GA  + +PMT  +D +  +  L S+  GG   DYTFDC+GN   ++ 
Sbjct: 221 EPAKIRRDLAEKMGAVVY-DPMT--RDHDESIKYLRSIAPGGDGFDYTFDCSGNPATLKA 277

Query: 285 ALE 287
           A+E
Sbjct: 278 AIE 280

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 67/302 (22%), Positives = 105/302 (34%), Gaps = 48/302 (15%)

Query: 33  PKA---HEVRIKIMNTAICHTDAYTLSGVDPEGLFPC----------ILGHXXXXXXXXX 79
           PKA   H+V I++    IC ++ + L          C          ++GH         
Sbjct: 28  PKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYGPKTQVVGHEVVGKVVAV 87

Query: 80  XXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEG 138
               +   VGD V +    + C +C  C SG    C     T  K   PDG         
Sbjct: 88  GPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTYCK-PYPDG--------- 137

Query: 139 KDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDT 198
                ++    ++ +    +     I  ++  E  + L CG  T F    +    +    
Sbjct: 138 -----YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNLQGKHDPK 192

Query: 199 VAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIV 258
           VAV G G +G   +  AR  G ++V        K+  +   GA  FV        G+   
Sbjct: 193 VAVIGIGGLGHMAIMIARALG-AEVYAFSRGHSKRDDALKMGAHHFV------ATGDADW 245

Query: 259 NKLISMTDGGLDYTFD----CTGNVHVMR-NALEACHKGWGQSFIIGVAAAGQEISTRPF 313
           N        GLD TFD    C  +   +  NA+  C K       +G+    +E+S +PF
Sbjct: 246 N-------AGLDDTFDLILNCASSTSSLDLNAMLPCLKVNCNFVSVGLPHIDEELSVKPF 298

Query: 314 QL 315
             
Sbjct: 299 SF 300

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/257 (21%), Positives = 106/257 (41%), Gaps = 30/257 (11%)

Query: 128 DGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVA------IDKKVSLEPASLLGCGVT 181
           D  ++F      D   ++  +TF++YT +++   V+       D+++ L   SL+    +
Sbjct: 103 DAVTKFDV---NDKVAYLSSNTFAQYTKISEAGTVSKVPQDSTDEQLKLYAGSLVQALTS 159

Query: 182 TGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGA 241
             F    +A  V+KGD + ++ A             +  +  I V   DEK Q + ++GA
Sbjct: 160 LAF--VREAYPVKKGDYILLYAAAGGAGLAFNQFLKKAGAHTIAVASTDEKLQLAKEYGA 217

Query: 242 TDFVNPMTDLKDGETIVNKLISMTDG-GLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300
              +N   D      ++ +++ +T+G G++  FD  G       +L+A  +   +  ++ 
Sbjct: 218 EFLINSSKD-----DVLARVLEITNGQGVEAAFDSVGK-DTFETSLKALKR---KGTLVS 268

Query: 301 VAAAGQEISTRPFQLVTG---RVWRGTAFGDIKGRTDM----PQLLDDYEKGLLKIDEFI 353
              A   +      ++T    ++ R + FG I    +      +L D    G LKI   I
Sbjct: 269 FGNASGPVPPVAINILTPKNIKLLRPSLFGYIATHEEWESYSSELFDLLHSGALKI--LI 326

Query: 354 THRRQFDEINDGFEDLH 370
           +     +E N   E L 
Sbjct: 327 SKTYPLEEYNQAAEQLE 343

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 112/296 (37%), Gaps = 58/296 (19%)

Query: 20  KKPLVVQDVIVDAPKAHEVRIKIMNTAICHTD--AYTLSGV--DPEGL--------FPCI 67
           K+P++  D         E+ I +    IC TD   YT   +   P+G          P  
Sbjct: 19  KEPVISAD--------DELIIAVSYCGICGTDLKEYTEGAIFFPPDGGHNEISGNGLPQA 70

Query: 68  LGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQK--------------CKFCKSGKTNL 113
           +GH              + KVGDHV+   T  C+               C  C  G TN+
Sbjct: 71  MGHEISGVVEKVGKGCKTFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIGMTNI 130

Query: 114 CGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPA 173
           C  +    G G+   G                    F+E  V+ +  V  I   + L+  
Sbjct: 131 CAHL-ALCGAGLESGG--------------------FAERLVINEAHVHKIPDHMPLDIG 169

Query: 174 SLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKK 233
           +L+     +    AVK A+ +KG +  + G G +GL  +   +  GC  +++ +    ++
Sbjct: 170 ALIQ--PISVCWHAVKVAHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRR 227

Query: 234 QFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEAC 289
           +++   GA  + +P     D      + +     G DYTFDC+G    +  A+E C
Sbjct: 228 EYAGKMGAKVY-DPTGVPFDESVKTLREMGPNGDGFDYTFDCSGLPITLNAAIECC 282

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 123/316 (38%), Gaps = 31/316 (9%)

Query: 36  HEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXXXXXXXXTSVKVGDHV-IP 94
           ++V +KI    +C +D +T SG   E   P ++GH               +KVGD V I 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 95  LYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYT 154
                C +C  CKS     C     T  K    D T  +++  G           +++Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRK----DYTDGYNSKGG-----------YADYI 142

Query: 155 VVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQG 214
            + +   V I + +    A+ L CG  T F   ++      G  V + G G +G   +  
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 215 ARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFD 274
           A+  G ++   +  +  KK+ +   GA  F+      K+      K         D    
Sbjct: 202 AKAMG-AETFAISRSSAKKEDAIKMGADHFIA----TKEEPDWATKYFDT----FDLIVV 252

Query: 275 CTGNV-HVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRT 333
           C+ ++  +  N +    K  G+   I V    + ++ +PF L+ G     +A G   G  
Sbjct: 253 CSNSLTDIDFNVVPRTMKVGGKIVSICVPEQHEVMNLKPFGLI-GVSISNSALG---GIN 308

Query: 334 DMPQLLDDYEKGLLKI 349
           ++ Q+LD   K  LKI
Sbjct: 309 EIKQMLDLVSKKNLKI 324

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 86/398 (21%), Positives = 146/398 (36%), Gaps = 84/398 (21%)

Query: 14  AVAYEAKKPLVVQDVIVDA--PKAHEVRIKIMNTAICHTDAYTLSG-------------V 58
           A+ Y +K  +   D + +       E+ + I+   IC TD + L+              +
Sbjct: 3   ALVYFSKGDIRFTDTLAEPEISTGDELLVDIVYCGICGTDLHELTDGPIFFPLDNERNEI 62

Query: 59  DPEGLFPCILGHXXXXXXXXXXXXXTSVKVGDHVIPLYTAECQK--------------CK 104
              GL P  +GH                +VGDHV    T  C+               C 
Sbjct: 63  SGNGL-PQAMGHEMAGIVTAVGSGVKKFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCT 121

Query: 105 FCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAI 164
            C+ G  N C  +    G GV   G                    F+E  VV +      
Sbjct: 122 SCQRGMYNCCDYLGLI-GNGVQSGG--------------------FAERIVVNESHCYKC 160

Query: 165 DKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVI 224
              +  E A+L+          A+  A  + G +V + G G +GL  +      GC+++I
Sbjct: 161 PDNLPWEVAALIQPIAVCWH--AINIAQFKPGSSVLILGGGPIGLGTILALNGHGCTEII 218

Query: 225 VVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG--GLDYTFDCTGNVHVM 282
           V +    ++ ++   GA  + +P+      E  +  L  M  G  G DY FDC+G    +
Sbjct: 219 VSEPVKLRRDYAEKMGAVVY-DPLQ--CSHEQSIPNLRKMAPGADGFDYCFDCSGTPATL 275

Query: 283 RNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTG-RVWRGT-------------AFGD 328
           + ++E C    G +  + + A  + ++  P  +    +++ G+             AFGD
Sbjct: 276 KASIE-CLTFRGTAVNVAMWATNKAVNFYPMDITKQEKIYTGSMCYTYHDFEEVIEAFGD 334

Query: 329 -----IKGR---TDMPQLLDDYEKGLLKIDEFITHRRQ 358
                 K R   T   +L   YE  LLK+   +TH+ +
Sbjct: 335 GSIDAEKARHMITSKVRLEQGYEDALLKL---LTHKEE 369

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 69/150 (46%), Gaps = 20/150 (13%)

Query: 151 SEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGA-GTVGL 209
           +EY VV++ +V    K V+   A+ LG  +TT    A++ A V+  D V+V GA G+VG 
Sbjct: 51  AEYCVVSEDAVALKPKNVTFAQAACLGVPLTTA-SLALQRAAVEPSDCVSVIGASGSVGS 109

Query: 210 SVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDG-G 268
            VVQ A+  GC       +    +Q   D         +   +D E   + L S+T G G
Sbjct: 110 YVVQLAQSMGCR------VLRAARQSPTD---------VCIAEDEE--FSALTSLTQGRG 152

Query: 269 LDYTFDCTGNVHVMRNALEACHKGWGQSFI 298
           +D   D  G   +M+ A E    G   + I
Sbjct: 153 VDVVIDTVGMPALMKAAAEKLAHGGRMAVI 182

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 63/156 (40%), Gaps = 17/156 (10%)

Query: 36  HEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXXXXXXX-XTSVKVGDHV-I 93
           H+++IK+    +C +D +  SG       P ++GH                +KVGD V +
Sbjct: 34  HDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVVKVGDRCDNGLKVGDRVGV 93

Query: 94  PLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEY 153
                 C +C  CK+   + C     T G G  PDG              ++    ++++
Sbjct: 94  GAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG--------------YISKGGYADF 138

Query: 154 TVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
             V +  VV I + +  E A+ L CG  T F   ++
Sbjct: 139 VRVHEHFVVPIPENIPSEYAAPLLCGGLTVFSPLLR 174

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 73/152 (48%), Gaps = 26/152 (17%)

Query: 145 MGCSTFSEYTVVADVSVV-----------AIDKKVSLEPASLLGCGVTTGFGAAVKA--- 190
           +  STF EYTV  D  +V            + K+  LE A+ +G G+ T  G+A+ +   
Sbjct: 141 LETSTFQEYTVF-DSRLVWKLPQYRLPNGRLHKRFDLEFAAGVGVGLVTA-GSAISSLVD 198

Query: 191 ------ANVQK-GDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATD 243
                 A+ QK G+ V   G+ +VGL V+Q A+     + IVV    + K++  + GA+ 
Sbjct: 199 LSLRDQADHQKLGNIVIWGGSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELGASC 258

Query: 244 FVNPMTDLKDGETIVNKLISMTDGGLDYTFDC 275
            ++     +  E I++ ++S    G+D+  D 
Sbjct: 259 IIDRH---QSEEEILDDILSHCPEGIDFGIDV 287

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 117/311 (37%), Gaps = 44/311 (14%)

Query: 18  EAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXX 77
           E  K   +++  V + K H+  +KI    +CH+D   L G  P       +GH       
Sbjct: 93  ENNKLEYLENYRVQSLKPHQGLLKIKAVGLCHSDLTILKGGFPASQR-YAMGHEICGELV 151

Query: 78  XXXXXXTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET-----QGKGVMPDGTSR 132
                     VG+    +  A C  C  CK G  + C A  E      Q  G+  DG   
Sbjct: 152 QTYADEPKYAVGELYTVVGNAPCGGCDSCKKGWESCCTANGEKACGLGQCYGIGRDG--- 208

Query: 133 FHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEP--ASLLGCGVTTGFGAAVKA 190
                            ++EY  +    +V + K++  +P   ++    V T + A    
Sbjct: 209 ----------------GYAEYIAIDLRHLVKVPKELVNKPEICAVATDAVLTPYHAIKNI 252

Query: 191 ANVQKGD--TVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPM 248
               K       V G G +GL+ +Q A   G S+VI VD  D + Q + + GA       
Sbjct: 253 PGFAKTPDYCTLVIGLGGLGLNGMQVANALG-SRVICVDFKDSQLQKATEMGA------- 304

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEI 308
                 E +  +L +    G+D   D  G+   + +A+    K  G   ++G++AAG EI
Sbjct: 305 ------EQVFKQLPTDASLGVDAVVDFVGHTSTIASAMFHL-KPHGFLALVGISAAGYEI 357

Query: 309 STRPFQLVTGR 319
                  + G+
Sbjct: 358 RFPALSYMLGK 368

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 35.0 bits (79), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 187 AVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFV 245
           AV+   V+ GD V V     +GL V    R  G  KV+++   D KKQ S  FG T F+
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 69/320 (21%), Positives = 124/320 (38%), Gaps = 36/320 (11%)

Query: 35  AHEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXXXXXXX-XTSVKVGDHV- 92
           A ++ +K+    +C +D +  +G       P ++GH                +KVGD V 
Sbjct: 56  ARDIVLKVEACGVCGSDIHCAAGHWGPRNNPLVVGHEIIGRVIEVGSGCKEGLKVGDRVG 115

Query: 93  IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSE 152
           +      C +C  C+S     C  +           GT  F   +G     ++    ++ 
Sbjct: 116 VGAQALSCLECSRCESENEQYCSNM----------TGTYNFPYPDG-----YISQGGYAS 160

Query: 153 YTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVV 212
           + +V +   + I   +    A+ L CG  T F   ++ +NV  G +V V G G +G   V
Sbjct: 161 HVIVHEHFAIPIPDNIPSHLAAPLMCGGITAFSPLLR-SNVGPGTSVGVVGIGGIGHMAV 219

Query: 213 QGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYT 272
             A+  G + V  +     KK  +   GA  ++  + D    +T  N         LD  
Sbjct: 220 IFAKALG-ANVTAISRRSNKKDDALKLGADVYIAAVEDKDWHKTYANT--------LDLI 270

Query: 273 FDCTGNVHVMR-NALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGD--I 329
             C+ ++  +  + + +  K  G+   I +  A + +  RP  L      +G + G   I
Sbjct: 271 VVCSSSLTELDFDRIPSLLKVGGKVLSIAIPEASERLVLRPLLL------KGISIGTSVI 324

Query: 330 KGRTDMPQLLDDYEKGLLKI 349
               ++ +LLD   K  LKI
Sbjct: 325 GSPAEIKKLLDFVSKKNLKI 344

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 85/212 (40%), Gaps = 19/212 (8%)

Query: 36  HEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXXXXXXXXTS-VKVGDHV-I 93
           +++ IKI    +C +D +  SG   +   P ++GH             TS +KVGD V +
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 94  PLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEY 153
                 C  C  C +     C  V  T G    PDG              + G   ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG--------------YNGKGGYANY 138

Query: 154 TVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQ 213
             V +   V I + +    A+ L CG  T +   ++      G  V + G G +G   + 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 214 GARMRGCSKVIVVDINDEKKQFSYDFGATDFV 245
            A+  G ++V  +  +D KK+ ++  GA  F+
Sbjct: 198 FAKSMG-AEVYAISRSDAKKEDAFKLGADHFI 228

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 60/156 (38%), Gaps = 17/156 (10%)

Query: 36  HEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXXXXXXXXTS-VKVGDHV-I 93
           H++ IK+    +C +D +  SG   +   P ++GH              S +K+GD V +
Sbjct: 36  HDIEIKVECCGVCGSDIHAASGNWGDLTKPLVVGHEIIGTVVRLGENCNSGLKLGDRVGV 95

Query: 94  PLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEY 153
                 C  C+ CK+     C     T G+   PDG S                  +++Y
Sbjct: 96  GAQVFSCLDCERCKNDNEPYCEGFVTTYGQD-YPDGYSSK--------------GGYADY 140

Query: 154 TVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
             V +   V I + +    A+ L CG  T +   V+
Sbjct: 141 FRVHEHFAVPIPENIPSHLAAPLMCGGLTVYSPLVR 176

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 136/343 (39%), Gaps = 53/343 (15%)

Query: 15  VAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXX 74
           V YE KK L            H++ IKI    +C +D +T SG   +   P ++GH    
Sbjct: 25  VEYEPKKFL-----------DHDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIG 73

Query: 75  XXXXXXXXXTS-VKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSR 132
                    TS +K+GD V +      C +C  CKS     C     T            
Sbjct: 74  TVVRLGDKCTSGLKLGDRVGVGAQAFSCLECGRCKSDNEPYCTKSVWT------------ 121

Query: 133 FHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAAN 192
            ++   +D ++  G   +++Y  + +   + I + +    A+ L CG  T F   ++   
Sbjct: 122 -YSTNYEDGYNSKG--GYADYIRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLRNG- 177

Query: 193 VQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFV----NPM 248
             +G  V + G G +G   +  A+  G ++V  +     KK  S   GA  F+     P 
Sbjct: 178 CGRGKKVGIMGIGGIGHMALIFAKAMG-AEVYAISRTSAKKDDSIKMGADHFIATKEEPD 236

Query: 249 TDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQE- 307
              K  +T  + ++  ++   D  FD      V+   ++   K      I+ + A  Q  
Sbjct: 237 WATKYFDTF-DLIVVCSNSLTDINFD------VVPRTMKVGGK------IVSICAPEQNE 283

Query: 308 -ISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKI 349
            I+ +PF L+ G     +A G   G  ++ Q+LD   K  LKI
Sbjct: 284 VINLKPFGLL-GVSISNSALG---GINEIKQMLDLVSKKDLKI 322

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 70/311 (22%), Positives = 117/311 (37%), Gaps = 33/311 (10%)

Query: 36  HEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXXXXXXX-XTSVKVGDHV-I 93
           ++V ++I    IC +D +  SG       P ++GH              T VKVGD V +
Sbjct: 34  YDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKCHTGVKVGDRVGV 93

Query: 94  PLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEY 153
               + C  C  C S     C     T  +   PDG              ++    ++ +
Sbjct: 94  GAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDG--------------YVSQGGYASH 138

Query: 154 TVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK--AANVQKGDTVAVFGAGTVGLSV 211
               +  V+ I +K+    A+ L CG  T F   +       +K   V + G G +GL  
Sbjct: 139 IRAHEHFVIPIPEKIPTHLAAPLLCGGITVFSPLINNDCGPNKKVGIVGIGGIGHMGLIF 198

Query: 212 VQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDY 271
              A+  G ++V  +  +  KK+ +   GA  F+      K+      K  S     LD 
Sbjct: 199 ---AKALG-AEVYAISRSSAKKEDAMKLGADHFIA----TKEEPDWEKKYAST----LDL 246

Query: 272 TFDCTGNV-HVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIK 330
              C  ++  +    L    +  G+   I V    +E++ +PFQL +G     +  G  K
Sbjct: 247 VIVCASSLTEINLEQLIKTMRIKGRIISICVPKETEELNLKPFQL-SGITIGNSQLGSRK 305

Query: 331 GRTDMPQLLDD 341
               + QL+ D
Sbjct: 306 ELIQLLQLVAD 316

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 60/156 (38%), Gaps = 17/156 (10%)

Query: 36  HEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXXXXXXXXTS-VKVGDHV-I 93
           H+V IKI    +C +D +  +G   +   P ++GH              S ++VG  V +
Sbjct: 34  HDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKSNSGLQVGQRVGM 93

Query: 94  PLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEY 153
                 C +C  CKS     C     T G+    DG              ++    +++Y
Sbjct: 94  GAQVFSCLECDRCKSDNEPYCTKFVTTYGQP-YEDG--------------YVSQGGYADY 138

Query: 154 TVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
             V +  VV I + +    A+ L CG  T +   V+
Sbjct: 139 VRVHEHFVVPIPENIPSHLAAPLLCGGLTAYSPLVR 174

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 53/255 (20%), Positives = 88/255 (34%), Gaps = 35/255 (13%)

Query: 67  ILGHXXXXXXXXXXXXXTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGV 125
           ++GH             +  KVGD V +    + C +C  C+S     C     T     
Sbjct: 75  VVGHEVVGKVVAVGPEVSLCKVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCN-P 133

Query: 126 MPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFG 185
            PDG              ++    ++ +    +     I  ++  E  + L CG  T F 
Sbjct: 134 YPDG--------------YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFS 179

Query: 186 AAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFV 245
              +    +K   VA+ G G +G   +  ++  G ++V  V     K+  +   GA  F+
Sbjct: 180 PIKRNIQGKKNPRVAIIGIGGLGHMAIMISKALG-AEVSAVSRGYSKRDDALKMGADHFI 238

Query: 246 NPMTDLKDGETIVNKLISMTDGGLDYTFD----CTGNVHVMR-NALEACHKGWGQSFIIG 300
                    E   N        GLD TFD    C  +   +  NAL  C K       +G
Sbjct: 239 ------ATSEPNWN-------AGLDDTFDLILNCASSTSSLDLNALLPCLKVNCNFVSVG 285

Query: 301 VAAAGQEISTRPFQL 315
           +    ++   +PF  
Sbjct: 286 LPHIDEDFKVKPFSF 300

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 59/297 (19%), Positives = 102/297 (34%), Gaps = 39/297 (13%)

Query: 34  KAHEVRIKIMNTAICHTDAYTLSGVDPEGLFPC----------ILGHXXXXXXXXXXXXX 83
           +AH+V I++    IC ++ ++L          C          ++GH             
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 84  TSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIF 142
           T   +GD V +      C KC  C SG    C      Q  G      +  +  +G    
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYC-----PQAVGTYCSRYADGYISQGGYAS 148

Query: 143 HFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVF 202
           H      F             I   +  E  + L CG  T +    +     K   VA+ 
Sbjct: 149 HVRAHEQF----------CFPIPDDIPSELVAPLQCGGLTVYSPIKRNIEGVKDPKVAII 198

Query: 203 GAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLI 262
           G G +G   +  ++  G ++V        KK+ +   GA  F+   T  +  E+ +N   
Sbjct: 199 GIGGLGHMAIMISKALG-AEVTAFSRGYSKKEDALKMGAHHFI--ATGEEGWESGLNDT- 254

Query: 263 SMTDGGLDYTFDCTGNVHVMR-NALEACHKGWGQSFI-IGVAAAGQEISTRPFQLVT 317
                  D   +C  +   +  N L  C K   ++FI +G+    ++   +PF   +
Sbjct: 255 ------FDLILNCASSTTSLDLNKLLPCLK-INRNFISVGLPHVDEDFKVKPFSFFS 304

>Kwal_33.12956 s33 complement(14925..16160) [1236 bp, 411 aa] {ON}
           YBR046C (ZTA1) - Homolog to quinone oxidoreductase (E.
           coli) [contig 123] FULL
          Length = 411

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 59/158 (37%), Gaps = 40/158 (25%)

Query: 145 MGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTT-----GFGAAVKAANVQKGDTV 199
           +  STF E+TV     V  +       P   L  G+T       F A +  A V  G  +
Sbjct: 153 LKSSTFQEFTVFDSRLVWRL-------PQETLSSGITRRRFSLDFAAGIGVALVTAGSAL 205

Query: 200 AVF-------------------GAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240
           + F                   G+ +VG+  +Q AR  G  K I+   + + + +  + G
Sbjct: 206 SSFIDFDRSFNEAPSKSLVIWGGSSSVGIFTIQLARNLGIFKNIIAISSLKYEHYLKELG 265

Query: 241 AT---DFVNPMTDLKDGETIVNKLISMTDGGLDYTFDC 275
           AT   D   P+ +LK        L  +   G+DY  D 
Sbjct: 266 ATIVLDRSRPLVELKQA------LSKLCPEGVDYGIDV 297

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 117/309 (37%), Gaps = 36/309 (11%)

Query: 36  HEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXXXXXXX-XTSVKVGDHV-I 93
           H++ IKI    +C +D +  +G   +   P ++GH              T +KVGD V +
Sbjct: 34  HDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVVGHEIIGKVVKIGPKCNTGLKVGDRVGV 93

Query: 94  PLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEY 153
                 C +C  CK+     C     T  +    DG              ++    ++ Y
Sbjct: 94  GAQVFSCLECDRCKNDNEPYCPKFVTTYSQP-YEDG--------------YVSQGGYANY 138

Query: 154 TVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQ 213
             V +   V I + +    A+ L CG  T +   ++           V   G   + ++ 
Sbjct: 139 VRVHEHFAVKIPENIPDHLAAPLLCGGITVYSPLLRNGCGPGKKVGIVGIGGIGHMGLLF 198

Query: 214 GARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVN--KLISMTDGGL-D 270
              M   ++V  +  ++ KK+ S   GA  ++    +   GE   +   LI +    L D
Sbjct: 199 AKAMG--AEVYAISRSNAKKEDSLKLGADHYIATKEEPNWGEKYFDTFDLIVVCASSLTD 256

Query: 271 YTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIK 330
             FD      VM  A+    K  G+   I +    Q ++ +PF L+ G     +A G IK
Sbjct: 257 VDFD------VMPKAM----KVGGRIVSISIPDEDQTLTMKPFGLL-GVSIANSALGSIK 305

Query: 331 GRTDMPQLL 339
              ++ QLL
Sbjct: 306 ---EIEQLL 311

>Suva_14.204 Chr14 complement(368893..370023) [1131 bp, 376 aa] {ON}
           YNL134C (REAL)
          Length = 376

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 62/133 (46%), Gaps = 14/133 (10%)

Query: 161 VVAIDKKVSLEPASLLGCG--VTTGFGAAVK--AANVQKGDTVAVFGAGT-VGLSVVQGA 215
           V +++  VSL P SL   G  +T  FG  +K   +  Q+   + ++G  T VG  ++Q  
Sbjct: 137 VKSLEGAVSL-PVSLTTAGMILTYHFGLDLKWEPSTPQRDQPILLWGGATAVGQPLIQLV 195

Query: 216 RMRGC-SKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFD 274
           +   C SK+IVV     +KQ   ++GA +    + D  D + +  + I      + Y  D
Sbjct: 196 KKLNCFSKIIVVASRKHEKQLK-EYGADE----LFDYHDADVV--EQIKKKYNNIPYLVD 248

Query: 275 CTGNVHVMRNALE 287
           C  ++  ++   +
Sbjct: 249 CVSDLGTLQQVYQ 261

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 57/156 (36%), Gaps = 17/156 (10%)

Query: 36  HEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXXXXXXXXTS-VKVGDHV-I 93
           H+V IKI    +C +D +  +G       P ++GH              S +K+G  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQRVGV 93

Query: 94  PLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEY 153
                 C +C  CKS     C     T  +    DG              ++    ++ Y
Sbjct: 94  GAQVFSCLECNRCKSDNEPYCTKFVTTYSQP-YEDG--------------YVSQGGYANY 138

Query: 154 TVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
             V +  VV + K +    A+ L CG  T +   ++
Sbjct: 139 VRVHEHFVVPVPKNIPSHLAAPLLCGGLTVYSPLIR 174

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 221 SKVIVVDINDEKKQFSYDFGAT-DFVNPMTDLKDGETIVNKLISMTDG-GLDYTFDCTG 277
           S VI VD+ D K Q + DFGAT  F +    + + + + ++L  +  G   D  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 366

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 64/175 (36%), Gaps = 18/175 (10%)

Query: 14  AVAYEAKKPLVVQDVIVDAPK--AHEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHX 71
           AV    KK L  + V+  A +    +V I+I    +C +D +   G   E   P ++GH 
Sbjct: 11  AVVDSHKKWLSPEKVVYPAKQFNPRDVDIEIEACGVCGSDVHCAKGNWGEMKLPLVVGHE 70

Query: 72  XXXXXXXXXXX-XTSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDG 129
                        T +KVGD V +    + C  C  C +     C     T  +    DG
Sbjct: 71  IIGKVVRLGDKCDTGLKVGDRVGVGAQVSACLDCNRCNNDNEQYCPKFVTTYSQPYFEDG 130

Query: 130 TSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGF 184
                         ++G   ++ +  V +  V+ I + +     + L CG  T +
Sbjct: 131 --------------YVGQGGYASHIRVHEHFVIPIPESLETNNVAPLLCGGATVY 171

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 72/319 (22%), Positives = 125/319 (39%), Gaps = 36/319 (11%)

Query: 36  HEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXXXXXXX-XTSVKVGDHV-I 93
           ++V IKI    +C +D +  +G   +   P ++GH              T +K+GD V +
Sbjct: 33  NDVDIKIEACGVCGSDIHCAAGNWGQKQTPLVVGHEIIGKVVKVGPKCKTGLKIGDRVGV 92

Query: 94  PLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEY 153
                 C +C+ CK+     C     T  +    DG              ++    ++ Y
Sbjct: 93  GAQVFSCLECERCKNDNEPYCARFVTTYSQP-YEDG--------------YVSQGGYANY 137

Query: 154 TVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQ 213
             V +   V I + +  E A+ L CG  T +   ++      G  V + G G +G   + 
Sbjct: 138 VRVHEHFAVPIPENIPSEYAAPLLCGGLTVYSPLLRNG-CGPGKKVGILGIGGIGHMGIL 196

Query: 214 GARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVN--KLISMTDGGL-D 270
            A+  G ++V  +  ++ KK+ S   GA  ++    +   G    +   LI +    L D
Sbjct: 197 FAKAMG-AEVYAISRSNAKKEDSLKLGADHYIATKEEPDWGTKYFDTFDLIVVCASSLTD 255

Query: 271 YTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIK 330
             FD      VM  A+    K  G+   I V    + ++ +PF L+ G     +  G I 
Sbjct: 256 VDFD------VMPKAM----KVGGRIVSISVPEQDEVLTMKPFGLI-GVSIANSILGSI- 303

Query: 331 GRTDMPQLLDDYEKGLLKI 349
              +M QLL    +  +KI
Sbjct: 304 --AEMKQLLKLVSENNIKI 320

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 57/156 (36%), Gaps = 17/156 (10%)

Query: 36  HEVRIKIMNTAICHTDAYTLSGVDPEGLFPCILGHXXXXXXXXXXXXXTS-VKVGDHV-I 93
           H+V IKI    +C +D +  +G       P ++GH              S +KVG  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLGDKSNSGLKVGQRVGV 93

Query: 94  PLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEY 153
                 C +C  CKS     C     T  +    DG              ++    ++ Y
Sbjct: 94  GAQVFSCLECDRCKSDNEPYCTKFVTTYSQP-YEDG--------------YISQGGYANY 138

Query: 154 TVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVK 189
             V +  +V I + V    A+ L CG  T +   V+
Sbjct: 139 VRVHEHFIVPIPENVPSHLAAPLLCGGLTVYSPLVR 174

>KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON}
           weakly similar to uniprot|P53912 Saccharomyces
           cerevisiae YNL134C
          Length = 398

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 78/190 (41%), Gaps = 25/190 (13%)

Query: 142 FHFMGCSTFSEYTVVADVSVVAID----------KKVSLEPASLLGCGVTTGFGAAVKA- 190
           +  +  STF E+TV     V  +           K+  L+ A+ +G  + T  G+A+ + 
Sbjct: 137 YRELKTSTFQEFTVFDSRLVWRLPREILPDGTTRKRFGLDFAAGVGVPLVTA-GSALSSF 195

Query: 191 ------ANVQKGDTVAVFG-AGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATD 243
                     +G ++ V+G + +VG+  +Q AR  G  K I+   +   + +  + GAT 
Sbjct: 196 VDFNEIGKADQGRSLVVWGGSSSVGIFTIQLARNLGIFKNIIAVSSLRYEDYLKELGATA 255

Query: 244 FVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWG--QSFIIGV 301
            ++        E +V K   +   G+DY  D           LE    G G  +S +   
Sbjct: 256 VIDRTL---PSEELVQKFQELCPTGVDYGVDVISK-KTAELVLEILKDGKGTKKSLVCLS 311

Query: 302 AAAGQEISTR 311
            A G+++  +
Sbjct: 312 GAPGEDVRAK 321

>TPHA0F02090 Chr6 (465913..466995) [1083 bp, 360 aa] {ON} 
          Length = 360

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 102/295 (34%), Gaps = 37/295 (12%)

Query: 84  TSVKVGDHV-IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIF 142
           T +KVGD V +      C  C  CK    N C     T G     DG             
Sbjct: 83  TGIKVGDRVGVGAQALACLDCNRCKEDHENYCFGNIWTYGGPTYADG------------- 129

Query: 143 HFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVF 202
            ++    ++ +  V +   + I + +  E A+ L CG  T F   +            V 
Sbjct: 130 -YIPQGGYASHIRVHEHFAIPIPENIPSELAAPLLCGGVTVFAPLLNGGAGPGKKVGIVG 188

Query: 203 GAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVN--K 260
             G   + ++ G  M   ++V  +     KK  S   GA  ++  + D    ET  +   
Sbjct: 189 IGGIGHMGILFGKAMG--AEVYALSRTQSKKADSLKLGADHYIATVEDKNWSETYKDTFD 246

Query: 261 LISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRV 320
           L+ +    L    D    +  MR          G+   I     G++I   P  L+ G  
Sbjct: 247 LLVICSSSLS-QLDIDELIKTMRIG--------GRIISICAPEIGEKIVLNPLGLL-GVS 296

Query: 321 WRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDE--INDGFEDLHMGT 373
              +  G    R ++ QLLD   K  +K         Q  E  +N+ FE +  GT
Sbjct: 297 IENSGIGS---RKEILQLLDLVSKKNIKP---WVETLQVGEAGVNEAFERMEKGT 345

>KAFR0J02060 Chr10 (393802..395718) [1917 bp, 638 aa] {ON} Anc_2.165
           YOR112W
          Length = 638

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 5/50 (10%)

Query: 209 LSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIV 258
           LS+++  ++ G  K+  VDIN+ ++   Y +  T+ V P+T L D ETI+
Sbjct: 61  LSMIRKIKLPGLIKI--VDINETEE---YVYIVTEIVEPVTKLNDHETIM 105

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,699,564
Number of extensions: 1475413
Number of successful extensions: 3531
Number of sequences better than 10.0: 175
Number of HSP's gapped: 3430
Number of HSP's successfully gapped: 177
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)