Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B008707.349ON54254225350.0
TDEL0C019907.349ON60652612591e-167
NCAS0A141507.349ON57051812501e-166
Kwal_56.246387.349ON52751711491e-152
KLTH0H01276g7.349ON55753411311e-149
ZYRO0F11682g7.349ON59739511291e-148
Suva_4.797.349ON70839911271e-146
YDL167C (NRP1)7.349ON71939511191e-145
Skud_4.907.349ON70739411081e-143
Smik_4.717.349ON75938810991e-141
SAKL0F11352g7.349ON58339110651e-138
ACL149W7.349ON62838410171e-131
TBLA0E020607.349ON56439010101e-130
Kpol_530.327.349ON68441310001e-127
KLLA0D12364g7.349ON6313959861e-126
KNAG0C037807.349ON5383859491e-121
TPHA0F029607.349ON6544039551e-121
NDAI0A019007.349ON5655138411e-105
CAGL0I03344g7.349ON6034026342e-74
SAKL0H17952g8.229ON58950790.58
NCAS0G025802.167ON22463760.76
KLLA0B08976g3.379ON30536760.82
CAGL0G05401g2.52ON67139761.2
NCAS0C059204.7ON287126741.5
YHR015W (MIP6)1.357ON65927732.4
KLLA0F23650g2.167ON312118722.8
CAGL0D05236g7.188ON44335714.3
TBLA0A057201.110ON1307135698.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B00870
         (542 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   981   0.0  
TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...   489   e-167
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   486   e-166
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   447   e-152
KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...   440   e-149
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   439   e-148
Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   438   e-146
YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   435   e-145
Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   431   e-143
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   427   e-141
SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   414   e-138
ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...   396   e-131
TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...   393   e-130
Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   389   e-127
KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...   384   e-126
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   370   e-121
TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...   372   e-121
NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   328   e-105
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   248   2e-74
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    35   0.58 
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    34   0.76 
KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {O...    34   0.82 
CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {...    34   1.2  
NCAS0C05920 Chr3 (1218910..1219773) [864 bp, 287 aa] {ON} Anc_4....    33   1.5  
YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putati...    33   2.4  
KLLA0F23650g Chr6 (2210563..2211501) [939 bp, 312 aa] {ON} simil...    32   2.8  
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    32   4.3  
TBLA0A05720 Chr1 (1417989..1421912) [3924 bp, 1307 aa] {ON} Anc_...    31   8.5  

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/542 (88%), Positives = 482/542 (88%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60
           MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60

Query: 61  KLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQRW 120
           KLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQRW
Sbjct: 61  KLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQRW 120

Query: 121 CLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEENDGAIDDKMFKNE 180
           CLNHPEVMSWKPKLESDKTINMDKKK             DMYNFKEENDGAIDDKMFKNE
Sbjct: 121 CLNHPEVMSWKPKLESDKTINMDKKKLGLLELLTVLGLEDMYNFKEENDGAIDDKMFKNE 180

Query: 181 RDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDTTQS 240
           RDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDTTQS
Sbjct: 181 RDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDTTQS 240

Query: 241 ELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHEEAI 300
           ELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHEEAI
Sbjct: 241 ELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHEEAI 300

Query: 301 EVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPGDWS 360
           EVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPGDWS
Sbjct: 301 EVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPGDWS 360

Query: 361 CPSCGFSNFQRRTACFRCSFPAPSNGHINIKSQNNSHHPEITSEHNTEGSQQXXXXXXXX 420
           CPSCGFSNFQRRTACFRCSFPAPSNGHINIKSQNNSHHPEITSEHNTEGSQQ        
Sbjct: 361 CPSCGFSNFQRRTACFRCSFPAPSNGHINIKSQNNSHHPEITSEHNTEGSQQNNTNRANA 420

Query: 421 XXXXXMYRYNTRYVXXXXXXXXXXXXXXXXXXXXIPFRAGDWNCASCTYHNFAKNVLCLR 480
                MYRYNTRYV                    IPFRAGDWNCASCTYHNFAKNVLCLR
Sbjct: 421 SFNNSMYRYNTRYVNGSSYNQMNNNNHNNNTGSNIPFRAGDWNCASCTYHNFAKNVLCLR 480

Query: 481 CGGPKTSTIYQQQXXXXXXXXXXXXXXVIEKPKDESTRKVDLLEFVSLASNNVLRNISST 540
           CGGPKTSTIYQQQ              VIEKPKDESTRKVDLLEFVSLASNNVLRNISST
Sbjct: 481 CGGPKTSTIYQQQNNNHNHGNNNNNINVIEKPKDESTRKVDLLEFVSLASNNVLRNISST 540

Query: 541 GN 542
           GN
Sbjct: 541 GN 542

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score =  489 bits (1259), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 253/526 (48%), Positives = 324/526 (61%), Gaps = 58/526 (11%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGE--VPTKVDQIVIDEQAE-SFKA 57
           M YV+LE++  H++E PKDH R+ K+++Q ++A ++       ++  I +D+Q   SF+ 
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60

Query: 58  AFEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEY 117
           +  K +  + SI  +  F+LCSL+STW IRVT+ RQARD G  +P +LQ+P++FDL KEY
Sbjct: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120

Query: 118 QRWCLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEENDGAIDDKMF 177
            RWC NHPEV++ +    +      D+               ++    E +   I +K  
Sbjct: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQ--------------TEILKVLEMSTEEITEKPV 166

Query: 178 KNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDT 237
                +  +  +LLQL  RCTT +D  +VL+ PYDS  D+R+FLQE+S+VLY+NNLP DT
Sbjct: 167 -----LGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDT 221

Query: 238 TQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHE 297
           TQSELESWFTQFG RPVGFWT KN+V +T+++ N W+ NNSPYVEE DSI GFVVFQTHE
Sbjct: 222 TQSELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHE 281

Query: 298 EAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPG 357
           EA EVL LNGR+ILSN+ANTKQPRVVEH+VEIQPSST VLD+A EILS FPQSKNKPRPG
Sbjct: 282 EATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPG 341

Query: 358 DWSCPSCGFSNFQRRTACFRCSFPAPS------------NGHINIKSQNN---------- 395
           DW+CPSCGFSNFQRRTACFRCSFPA S            NG+IN  +Q            
Sbjct: 342 DWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQYMNYNGNINSTNQGGNIYITKVGGS 401

Query: 396 ---SHHPEITSEHNTEG--SQQXXXXXXXXXXXXXMYRYN---------TRYVXXXXXXX 441
              SH+   T    T+   +                YR+N           Y        
Sbjct: 402 PTQSHYQINTQLPQTQAVRTNANYNDQNSLKHSNSAYRFNGNNGGNSPIMNYSNNRFNGQ 461

Query: 442 XXXXXXXXXXXXXIPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487
                        +PFRAGDW C +CTYHNFAKN++CLRCG  K S
Sbjct: 462 QVNNSNVNNGGSNVPFRAGDWKCPTCTYHNFAKNLVCLRCGAAKVS 507

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489
           R GDWNC SC + NF +   C RC  P  S +
Sbjct: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAV 370

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  486 bits (1250), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 262/518 (50%), Positives = 316/518 (61%), Gaps = 44/518 (8%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60
           MFYV+LEL+T HQVETPKDH+RITK ++Q +N+  L     +   I I + A +FK    
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSETLQATFEEPKSIDIPDMANAFKDTIS 60

Query: 61  KLNESITSITRD-SSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQR 119
           +L   I +   D S F+LCSLFS WDIRVTL RQA DLG  +P +L++P++F+L KE+ +
Sbjct: 61  QLEADIKAEIVDFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPRVFNLWKEFDK 120

Query: 120 WCLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEENDGAIDDKMFKN 179
           WC NHPEV            I M K               D+ N  E +          N
Sbjct: 121 WCGNHPEV------------IPMRKSNLRVKSPKTAGDISDIVNILEIDTSLQVPLSTSN 168

Query: 180 ERDMTI---STSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSD 236
            + +     ST++L +L  +CTT DD + VLT PYDS  D+++FLQERSRVLYMNNLPSD
Sbjct: 169 PQTLLSIQDSTNILTKLRKKCTTLDDVQLVLTRPYDSYADIKTFLQERSRVLYMNNLPSD 228

Query: 237 TTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTH 296
           TTQSELESWFTQFG RP+GFWT KN + +TSS+ + W+ N +P V+E D + GFVVFQ+H
Sbjct: 229 TTQSELESWFTQFGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCVAGFVVFQSH 288

Query: 297 EEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRP 356
           EEA E L LNGR+ILSN+ANTKQPRVVEH+VEIQPSST VLD   +ILS+FPQSKNKPRP
Sbjct: 289 EEATEALVLNGRSILSNIANTKQPRVVEHIVEIQPSSTRVLDAGQDILSAFPQSKNKPRP 348

Query: 357 GDWSCPSCGFSNFQRRTACFRCSFPAPSN-------GHINIKSQN--------NSHHPEI 401
           GDWSCPSCGFSNFQRRTACFRCSFPAP+N       G  NI S N         S  P I
Sbjct: 349 GDWSCPSCGFSNFQRRTACFRCSFPAPNNNKGLNISGTSNIASTNQMPVVNRIQSTFP-I 407

Query: 402 TSEHNTEGSQQXXXXXXXXXXXXXMYR-YNTRYVXXXXXXXX-----------XXXXXXX 449
              H +  SQ                R  N R+                           
Sbjct: 408 PQSHQSSISQTFQQYNKPLTPSNSGSRTQNFRHNGSNNTNNNNNNRYNTNSQFSMTSGGI 467

Query: 450 XXXXXIPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487
                +PFRAGDW C SCTYHNFAKNV+CLRC  PK S
Sbjct: 468 TTGSNVPFRAGDWKCPSCTYHNFAKNVVCLRCRIPKIS 505

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 20/42 (47%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHINIKSQNNS 396
           R GDW CPSC + NF +   C RC  P  S    N    N S
Sbjct: 476 RAGDWKCPSCTYHNFAKNVVCLRCRIPKISQQSHNGNEGNQS 517

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  447 bits (1149), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 247/517 (47%), Positives = 319/517 (61%), Gaps = 52/517 (10%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60
           M YV+LE+D  H+ ++PKD ++I    +Q ++   L  V  +   IV+ E   S + A  
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTEELKSVFQENKHIVL-ENGCSLQEAVS 59

Query: 61  KLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQRW 120
           +L + I    +D  F+LCSL STW  RVT+ RQARD    +P  LQ+P++FDL KEY RW
Sbjct: 60  QLEKDIGEHLKDD-FVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRVFDLWKEYDRW 118

Query: 121 CLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEENDGAIDDKMFKNE 180
           C+NHPE ++ +      ++ +M KK              ++ +  E +    D      E
Sbjct: 119 CVNHPETLALR------RSNSMGKK---------VKDVAELRSVLELDSATQDSTPGAAE 163

Query: 181 RDMTIST-SVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDTTQ 239
            D    T +++ QL  +C T++D   VLT PYDS  DVR+FLQERS+VLYMNNLP DTTQ
Sbjct: 164 PDALEQTIAIIRQLHKKCVTAEDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQ 223

Query: 240 SELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHEEA 299
           SELESWFTQFG RPVGFWT KN+V +TS++ N W+SNNS YVE  DSI GFVVFQ+HEEA
Sbjct: 224 SELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEA 283

Query: 300 IEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPGDW 359
            E L+LNGR+ILSN+ANTKQPRV+EH+VE+QPSS  VLD+A EILS FPQSKNKPRPGDW
Sbjct: 284 TEALSLNGRSILSNIANTKQPRVIEHIVEVQPSSARVLDRAQEILSPFPQSKNKPRPGDW 343

Query: 360 SCPSCGFSNFQRRTACFRCSFP----APSNGHINIKSQNNSHH----------------- 398
           +CPSCGFSNFQRRT+CFRCSFP    AP N    +K+    H+                 
Sbjct: 344 NCPSCGFSNFQRRTSCFRCSFPSTGSAPMNNTGYVKNTMQPHNIQVGGQQQAAYKMRTAA 403

Query: 399 --PEITSEHNTEGSQQXXXXXXXXXXXXXMYRYNTRYVXXXXXXXXXXXXXXXXXXXXIP 456
             P + ++ +++  Q               +    R+                     +P
Sbjct: 404 GIPPVQTQASSQMGQPHMAQQHQQQQQRMRFNQGPRF----------GQNQQPQGGSNVP 453

Query: 457 FRAGDWNCASCTYHNFAKNVLCLRCGGPKTSTIYQQQ 493
           FRAGDW CA+CTYHNFAKNV+CLRCGGPK ST +QQ+
Sbjct: 454 FRAGDWKCATCTYHNFAKNVVCLRCGGPK-STEHQQK 489

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score =  440 bits (1131), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 247/534 (46%), Positives = 315/534 (58%), Gaps = 50/534 (9%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60
           M YV+LE++  H+ ++PKD ++I K  +Q ++   L  V  +   + +     + + A  
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGC-TLQDAVA 59

Query: 61  KLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQRW 120
           +L + I+   +D  F+LCSL STW  RVT+ RQARD    +P  LQ+PK+FDL KEY RW
Sbjct: 60  QLEKDISEHAKDD-FVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDRW 118

Query: 121 CLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYN------FKEENDGAIDD 174
           C+NHPE  + +      +T ++ + +                N       K E  GA  +
Sbjct: 119 CMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGA--E 176

Query: 175 KMFKNERD---------------------MTISTSVLLQLLIRCTTSDDTKNVLTCPYDS 213
           ++   + D                     +T +  ++ QL  +C T+DD   VLT PYDS
Sbjct: 177 QLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDS 236

Query: 214 DTDVRSFLQERSRVLYMNNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTW 273
             DVR+FLQERS+VLYMNNLP DTTQSELESWFTQFG RPVGFWT KN+V +TS++ N W
Sbjct: 237 YLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNW 296

Query: 274 NSNNSPYVEELDSIPGFVVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSS 333
           +SNNS YVE  DSI GFVVFQ+HEEA E L+LNGR+ILSN+ANTKQPRV+EH+VEIQPSS
Sbjct: 297 SSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSS 356

Query: 334 TSVLDKAHEILSSFPQSKNKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHINIKSQ 393
             VLD+A EILS FPQSKNKPRPGDW+CPSCGFSNFQRRT+CFRCSFPA S   +N    
Sbjct: 357 ARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMN---- 412

Query: 394 NNSHHPEITSEHN--------------TEGSQQXXXXXXXXXXXXXMYRYNTRYVXXXXX 439
           NN +       HN              T    Q               +   +       
Sbjct: 413 NNGYMKNPLQPHNAQAGSQQQAAYKMRTPAGLQAMQVQSGPHMGQPQQQQQQQQRMRYNQ 472

Query: 440 XXXXXXXXXXXXXXXIPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTSTIYQQQ 493
                          +PFRAGDW CA+CTYHNFAKNV+CLRCGGPK ST +QQ+
Sbjct: 473 GQRFGQGQQHQGGSNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPK-STEHQQK 525

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  439 bits (1129), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 228/395 (57%), Positives = 278/395 (70%), Gaps = 26/395 (6%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQ----IVIDEQAESFK 56
           M+YV+LE++T H +E PKD  RI K+++Q VNA  L +V  + +Q    I+ +  + +  
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETL-QVHYQENQAPLHIISENDSTNLH 59

Query: 57  AAFEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKE 116
            A   LNE I  I  D  F+LCSL STW +RVTL+RQARD   ++P +LQ+PKIFDL KE
Sbjct: 60  EAVANLNEEINRIAGDEPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKIFDLWKE 119

Query: 117 YQRWCLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEENDGAIDDKM 176
           Y+RWC+NHPEVM  +             ++             +  NF        +D  
Sbjct: 120 YERWCVNHPEVMPLRKN---------GGRRMKDVAELARVLDINGLNF--------NDSS 162

Query: 177 FKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSD 236
           F    D++ S  +LL+L  RC+T +D   VLT PYDS  DVR+FLQE S+VLY+NNLP D
Sbjct: 163 F----DLSRSVEILLRLHQRCSTPEDMAMVLTHPYDSHMDVRNFLQECSKVLYLNNLPPD 218

Query: 237 TTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTH 296
           TTQSELESWFTQFG RPVGFWT KN+V +TS++ N W+ NNSPYVEE DSI GFVVFQTH
Sbjct: 219 TTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSMNNSPYVEEQDSISGFVVFQTH 278

Query: 297 EEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRP 356
           EEA EVL LNGR+ILSN+ANTKQPRVVEH+VEIQPSST VLD+A EILS FPQSKNKPRP
Sbjct: 279 EEATEVLTLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRP 338

Query: 357 GDWSCPSCGFSNFQRRTACFRCSFPAPSNGHINIK 391
           GDW+CPSCGFSNFQRRTACFRCSFPA +   +N K
Sbjct: 339 GDWNCPSCGFSNFQRRTACFRCSFPATTAVQVNTK 373

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (85%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489
           +PFRAGDW C SC YHNFAKNV+CLRCGGPK + +
Sbjct: 485 VPFRAGDWKCPSCIYHNFAKNVVCLRCGGPKITAV 519

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489
           R GDWNC SC + NF +   C RC  P T+ +
Sbjct: 337 RPGDWNCPSCGFSNFQRRTACFRCSFPATTAV 368

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFP 381
           R GDW CPSC + NF +   C RC  P
Sbjct: 488 RAGDWKCPSCIYHNFAKNVVCLRCGGP 514

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  438 bits (1127), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 227/399 (56%), Positives = 287/399 (71%), Gaps = 19/399 (4%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANAL------GEVPTKVDQIVIDEQAES 54
           M YV+LEL   H  ++PKD  RI  + +Q+V+A  L      G  P+    I +D + +S
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPS----IDVDGEKKS 56

Query: 55  FKAAFEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLM 114
            ++A  +L++ I  I  +  F+L SL STW IRVTL RQARD G  +  +LQ+P++FDL 
Sbjct: 57  LESAMGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLW 116

Query: 115 KEYQRWCLNHPEVMSWKPKL----ESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEENDG 170
           KE++RWC+NHPE+M  +  +     + K+ ++                 ++ N  EE+D 
Sbjct: 117 KEFERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDF 176

Query: 171 AIDDKMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYM 230
           A+D     N   +  +  VLLQL  +C++++D K+VLT PYDS TD+RSFLQERS+VLYM
Sbjct: 177 ALD-----NHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYM 231

Query: 231 NNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGF 290
           NNLP DTTQSELESWFTQ+G RPVGFWT KN+V DTS++ N W+ NNSPYVE+ DSI GF
Sbjct: 232 NNLPPDTTQSELESWFTQYGARPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGF 291

Query: 291 VVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQS 350
           VVFQTHEEA EVLALNGR+ILSN+ANTKQPRVVEHV+E+QPSST VLDKA EILS FPQS
Sbjct: 292 VVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQS 351

Query: 351 KNKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHIN 389
           KNKPRPGDW+CPSCGFSNFQRRTACFRCSFPAPSN  ++
Sbjct: 352 KNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQMH 390

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (96%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKT 486
           IPFRAGDW C++CTYHNFAKNV+CLRCGGPK+
Sbjct: 560 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 591

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 17/30 (56%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487
           R GDWNC SC + NF +   C RC  P  S
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPS 385

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHI 388
           R GDW C +C + NF +   C RC  P   N  +
Sbjct: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADV 596

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  435 bits (1119), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 222/395 (56%), Positives = 284/395 (71%), Gaps = 12/395 (3%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANAL--GEVPTKVDQIVIDEQAESFKAA 58
           M YV+LEL   H  +TPKD  RI  + FQ+VNA  L        +  I ++   +S ++A
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60

Query: 59  FEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQ 118
             +L++ I  +  +  F+L SL+STW IRVTL RQARD G  +  +LQ+PK+FDL KE+ 
Sbjct: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120

Query: 119 RWCLNHPEVMSWKPKLESD----KTINMDKKKXXXXXXXXXXXXXDMYNFKEENDGAIDD 174
           RWC+NHPE++  K  + ++    K+I+++  K                +   E  G++ +
Sbjct: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILE--VSIPTEEAGSVPE 178

Query: 175 KMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLP 234
                +R    +T +L+QL  +CT+ +D ++VLT PYDS TD+R+FLQE+S++LYMNNLP
Sbjct: 179 IYSLLKR----TTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLP 234

Query: 235 SDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQ 294
            DTTQSELESWFTQ+G RPVGFWT KN+V DTS++ N W+ NNSPYVE+ DSI GFVVFQ
Sbjct: 235 PDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQ 294

Query: 295 THEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKP 354
           THEEA EVLALNGR+ILSN+ANTKQPRVVEHV+E+QPSST VLDKA EILS FPQSKNKP
Sbjct: 295 THEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKP 354

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHIN 389
           RPGDW+CPSCGFSNFQRRTACFRCSFPAPSN  I+
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQIH 389

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 31/32 (96%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKT 486
           +PFRAGDW C++CTYHNFAKNV+CLRCGGPK+
Sbjct: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 17/30 (56%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487
           R GDWNC SC + NF +   C RC  P  S
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPS 384

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNG 386
           R GDW C +C + NF +   C RC  P   +G
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSISG 612

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  431 bits (1108), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 224/394 (56%), Positives = 284/394 (72%), Gaps = 16/394 (4%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANAL------GEVPTKVDQIVIDEQAES 54
           M YV+LEL   +  ++PKD  RI  + +Q+V+A  L        +P    +I +D +A+S
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLP----KIEVDGEAKS 56

Query: 55  FKAAFEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLM 114
            ++A  +L++ I  +  +  F+L SL STW IRVTL+RQARD G  +  +LQ+P++FDL 
Sbjct: 57  LESAMIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLW 116

Query: 115 KEYQRWCLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKE---ENDGA 171
           KE+ RWC+NHPE++  + K  S+   N                  +M    E    ++GA
Sbjct: 117 KEFDRWCVNHPELLEQR-KATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGA 175

Query: 172 IDDKMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMN 231
             D + + +  +  +T +LLQL  +C++ +D K+VLT PYDS TD+R+FLQERS+VLYMN
Sbjct: 176 --DFIPEEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMN 233

Query: 232 NLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFV 291
           NLP DTTQSELESWFTQ+G RPVGFWT KN+V DTS++ N W+ NNSPYVEE DSI GFV
Sbjct: 234 NLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEEQDSISGFV 293

Query: 292 VFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSK 351
           VFQTHEEA EVLALNGR+ILSN+ANTKQPRVVEHV+E+QPSST VLDKA EILS FPQSK
Sbjct: 294 VFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSK 353

Query: 352 NKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPSN 385
           NKPRPGDW+CPSCGFSNFQRRTACFRCSFPAPSN
Sbjct: 354 NKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 387

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 43/81 (53%), Gaps = 8/81 (9%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTSTIYQQQXXXXXXXXXXXXXXVIEK--- 511
           IPFRAGDW C++CTYHNFAKNV+CLRCGGPK+      +               I     
Sbjct: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPGSHIHSDNG 639

Query: 512 -----PKDESTRKVDLLEFVS 527
                 KD   R + L+E+VS
Sbjct: 640 SNRTDGKDNKGRDISLMEYVS 660

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 18/32 (56%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489
           R GDWNC SC + NF +   C RC  P  S I
Sbjct: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNI 388

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 17/35 (48%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHIN 389
           R GDW C +C + NF +   C RC  P   N   N
Sbjct: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADAN 617

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  427 bits (1099), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 222/388 (57%), Positives = 272/388 (70%), Gaps = 5/388 (1%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALG--EVPTKVDQIVIDEQAESFKAA 58
           M YV+LEL   H   +PKD  RI  + +Q V+A  L        +  I +D +  S + A
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAETLACHYENNSLPNIEVDRETRSLETA 60

Query: 59  FEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQ 118
             +L+++I  I  +  F+L SL+STW IRVTL RQARD G  +  +LQ+PK+FDL KE+ 
Sbjct: 61  MIQLDKAIQDILGNDEFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKLFDLWKEFD 120

Query: 119 RWCLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEENDGAIDDKMFK 178
           RWC+NHPE++  + K  S+   N   K              +M    E +    +     
Sbjct: 121 RWCVNHPEILE-QMKTASNNN-NSGTKGNSGGLAKNAKDLDEMIRILEISSSTEEAVSVP 178

Query: 179 NERDMTI-STSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDT 237
            E  +   +T +L+ L  +C +S+D K VLT PYDS TD+R+FLQERS+VLYMNNLP DT
Sbjct: 179 EEYSLLRRTTDILIHLHRKCCSSEDMKFVLTQPYDSHTDIRTFLQERSKVLYMNNLPPDT 238

Query: 238 TQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHE 297
           TQSELESWFTQ+G RPVGFWT KN+V DTS++ N W+ NNSPYVE+ DSI GFVVFQTHE
Sbjct: 239 TQSELESWFTQYGVRPVGFWTVKNIVEDTSNINNNWSLNNSPYVEDQDSISGFVVFQTHE 298

Query: 298 EAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPG 357
           EA EVLALNGR+ILSN+ANTKQPRVVEHV+E+QPSST VLDKA EILS FPQSKNKPRPG
Sbjct: 299 EATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPG 358

Query: 358 DWSCPSCGFSNFQRRTACFRCSFPAPSN 385
           DW+CPSCGFSNFQRRTACFRCSFPAPSN
Sbjct: 359 DWNCPSCGFSNFQRRTACFRCSFPAPSN 386

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (96%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKT 486
           IPFRAGDW C++CTYHNFAKNV+CLRCGGPK+
Sbjct: 618 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 649

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 18/32 (56%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489
           R GDWNC SC + NF +   C RC  P  S I
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNI 387

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFP 381
           R GDW C +C + NF +   C RC  P
Sbjct: 621 RAGDWKCSTCTYHNFAKNVVCLRCGGP 647

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  414 bits (1065), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 222/391 (56%), Positives = 276/391 (70%), Gaps = 28/391 (7%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60
           M+YV+LE +T+H  E PKDHTR++++ +Q ++++ L  V  +   I+++      +    
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQ--PIIVEVGPGQLREQVA 58

Query: 61  KLNESITS-ITRDS-SFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQ 118
           +L++ +TS IT D+  F L SL STW IRVT+ RQARD G  +P +LQ+PK+FDL KEY 
Sbjct: 59  QLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYD 118

Query: 119 RWCLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEENDGAIDDKMFK 178
           RWC+NHPE +  +      K  N+ KK              D+     E    ++  +  
Sbjct: 119 RWCVNHPETLPLR------KNSNLGKKSR------------DL----PELSRVLEAPLQT 156

Query: 179 NERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDTT 238
              D TI   +L QL  +C   +D   VLT PYDS  DVR+FLQERS+VLYMNNLP DTT
Sbjct: 157 FPLDQTIG--ILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTT 214

Query: 239 QSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHEE 298
           QSELESWFTQFG RPVGFWT KNVV +TS++ N W+ NNS YVEE DSI GFVVFQTHEE
Sbjct: 215 QSELESWFTQFGARPVGFWTVKNVVEETSNVNNNWSCNNSSYVEEQDSISGFVVFQTHEE 274

Query: 299 AIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPGD 358
           A E L+LNGR+ILSN+ANTKQPRVVEHVVE+QPSST VLD+AHE+LS FPQSKNKPRPGD
Sbjct: 275 ATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGD 334

Query: 359 WSCPSCGFSNFQRRTACFRCSFPAPSNGHIN 389
           W+CPSCGFSNFQRRTACFRCSFPA S  ++N
Sbjct: 335 WNCPSCGFSNFQRRTACFRCSFPATSAVNVN 365

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 30/32 (93%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKT 486
           +PFRAGDW C SCTYHNFAKNV+CLRCGGPKT
Sbjct: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKT 528

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489
           R GDWNC SC + NF +   C RC  P TS +
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAV 362

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 16/32 (50%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNG 386
           R GDW C SC + NF +   C RC  P    G
Sbjct: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGG 531

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score =  396 bits (1017), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 210/384 (54%), Positives = 259/384 (67%), Gaps = 28/384 (7%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60
           M+YV+ E D  H+ +TPKDH R++K+ +QL++   L  +P   D   I+      + A  
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPEL--LPLYADAREIEVGGGGVQMATG 58

Query: 61  KLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQRW 120
           +L  ++   T    F+LCSL STW +RVTL RQA D G  +P FL + K+FDL KE  RW
Sbjct: 59  QLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRW 118

Query: 121 CLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEENDGAIDDKMFKNE 180
           C NH           S++  N   K              +++   +     +D+++  + 
Sbjct: 119 CANH----------VSERACNAGAKGDVA----------ELFRVLD-----LDEQLVSHA 153

Query: 181 RDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDTTQS 240
             +  +T VLLQL  +CTT++D   VLT PYDS  D+ SF+QERS VLYMNNLP DTTQS
Sbjct: 154 Y-IQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQS 212

Query: 241 ELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHEEAI 300
           ELESWFTQFG RPVGFWT KNVV DTS++ N W+SNNS YVEE DSI GFVVFQ+HE A 
Sbjct: 213 ELESWFTQFGARPVGFWTVKNVVEDTSNVNNNWSSNNSRYVEEHDSISGFVVFQSHEAAS 272

Query: 301 EVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPGDWS 360
           E L LNGR+ILSN+ANTKQPRVVEHVVE++PSS+ VLD A EILS FPQSKNKPRPGDW+
Sbjct: 273 EALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWN 332

Query: 361 CPSCGFSNFQRRTACFRCSFPAPS 384
           CPSCGFSNFQRR ACFRCSFPA S
Sbjct: 333 CPSCGFSNFQRRIACFRCSFPATS 356

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 24/33 (72%), Positives = 30/33 (90%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487
           +PFRAGDW C +C+YHNFAKN++CLRCG PKT+
Sbjct: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489
           R GDWNC SC + NF + + C RC  P TS +
Sbjct: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSAV 358

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 350 SKNKP-RPGDWSCPSCGFSNFQRRTACFRCSFPAPSN 385
           S N P R GDW C +C + NF +   C RC  P  +N
Sbjct: 498 SSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score =  393 bits (1010), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 197/390 (50%), Positives = 256/390 (65%), Gaps = 43/390 (11%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANAL-GEVPTKVDQIVIDEQAESFKAAF 59
           M+Y ++EL T H  E PKDHT+I  +++Q +N + L    P        D++  +     
Sbjct: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFP--------DDKIPNIDCTT 52

Query: 60  EKLNESITSITRD--------SSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIF 111
             L+ESI  + +D          F+LCSL STWD+RVT++RQA+D   ++P F +YP+IF
Sbjct: 53  LPLSESIALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIF 112

Query: 112 DLMKEYQRWCLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEENDGA 171
           DL KE+ RWC+NH E++  +           D +K             D+          
Sbjct: 113 DLWKEFDRWCVNHKELVQTR-----------DPRKLK-----------DLKQLA----TL 146

Query: 172 IDDKMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMN 231
           +     +    +++++ VL+QL  +CTT DD + VLT PYDS  D   F++  S VLYMN
Sbjct: 147 LHIPSVETLSSISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMN 206

Query: 232 NLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFV 291
           NLP DTTQSELE+WFTQFG RP+GFWT KN++ DTS + N W  NNSPYVEE+DSI GF+
Sbjct: 207 NLPPDTTQSELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFI 266

Query: 292 VFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSK 351
           VF TH+EAI+VL LNG +ILSN+ANTKQPRVVEHVVEIQPSS  V+++   IL+ FPQSK
Sbjct: 267 VFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSK 326

Query: 352 NKPRPGDWSCPSCGFSNFQRRTACFRCSFP 381
           NKPRPGDW+CPSCGFSNFQRRTACFRCSFP
Sbjct: 327 NKPRPGDWNCPSCGFSNFQRRTACFRCSFP 356

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 23/33 (69%), Positives = 28/33 (84%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487
           +PFRAGDW C +C YHNFAKN++CLRC GPK+ 
Sbjct: 477 VPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKSG 509

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTIYQQQ 493
           R GDWNC SC + NF +   C RC  P+   +   Q
Sbjct: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQQQAVGSSQ 365

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFP 381
           R GDW C +CG+ NF +   C RCS P
Sbjct: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  389 bits (1000), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 208/413 (50%), Positives = 276/413 (66%), Gaps = 29/413 (7%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANAL----GEVPTKVDQIVIDEQAESFK 56
           M+Y+++E DTLH VETPKDHTRI+K+++Q V+A +L    G+   KV  I  DE A SFK
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISI-DDESAISFK 59

Query: 57  AAFEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKE 116
              ++L+E I ++  D  F+ CSL S WD+RVT+ RQARD  V++P +LQ  K+FDL KE
Sbjct: 60  DMIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKE 119

Query: 117 YQRWCLNHPEVMSWK-PKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEE----NDGA 171
           + RW  NH + ++ K  K   D    +   +             +  + KE+    N GA
Sbjct: 120 FNRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKTTVETKEIEENSDKEDEVHANTGA 179

Query: 172 IDD-------------------KMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYD 212
            +                    +M +   ++   T +L  +  +CTT +D   VLT PYD
Sbjct: 180 EESGNATITTAADDDNNEDDSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYD 239

Query: 213 SDTDVRSFLQERSRVLYMNNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANT 272
           S++D ++F +E S++LYMNNLP DTTQSELESWF QFG++PV FWT KN+V +TS++ N 
Sbjct: 240 SNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETSNVNNN 299

Query: 273 WNSNNSPYVEELDSIPGFVVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPS 332
           W+ NNSPYVEE DSI GFV FQ+H+EA + L LNGR+ILSN+ANTKQPRVVEH+VEIQPS
Sbjct: 300 WSMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPS 359

Query: 333 STSVLDKAHEILSSFPQSKNKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPSN 385
           S +VL++  +I + FPQSKNKPRPGDW+C SCGFSNFQRRTACFRCS+PA SN
Sbjct: 360 SVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (93%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKT 486
           +PFRAGDW C +C+YHNFAKNV+CLRCGGPK+
Sbjct: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAP--SNGHINIKSQNNSH 397
           R GDW C +C + NF +   C RC  P    ++G IN  + NNS+
Sbjct: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDINSPTMNNSN 587

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 17/30 (56%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487
           R GDWNC SC + NF +   C RC  P  S
Sbjct: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAAS 411

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score =  384 bits (986), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 200/395 (50%), Positives = 256/395 (64%), Gaps = 12/395 (3%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60
           MFYV+ E +T++  E PKDHT I+ + +Q+++   L  +  +  +  ID    S K   +
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDA-THSLKNTIQ 59

Query: 61  KLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQRW 120
            +  ++        F+LCSL STWD+RVTL+RQARD    +P FLQ+PK+FDL +E  RW
Sbjct: 60  SMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDRW 119

Query: 121 CLNHPEVMSWKPKLESDKTINMDK--KKXXXXXXXXXXXXXDMYNFKEENDGAIDDKM-- 176
             NHPE              N +   ++                N   +N    D +M  
Sbjct: 120 YRNHPEQYEKGTDRGGGNVANTNTTTQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRMEQ 179

Query: 177 -------FKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLY 229
                  F+    +     VL +L   CT+ +D   VLT P+DS  D+++FL E+S VLY
Sbjct: 180 VNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTVLY 239

Query: 230 MNNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPG 289
           MNNLP DTTQSELESWF QFG+RPVGFWT KNVV DTS++ N W++NN+ YV+E DSI G
Sbjct: 240 MNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNNNWSTNNNLYVDEQDSISG 299

Query: 290 FVVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQ 349
           FVV+Q HEEA++ L LNGR+ILSN++NTKQPRVVEHVVEIQPSS SVLD+A EIL++FPQ
Sbjct: 300 FVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAFPQ 359

Query: 350 SKNKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPS 384
           SKNKPRPGDW+CPSC FSNFQRRTACFRCSFP  S
Sbjct: 360 SKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSS 394

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489
           +PFRAGDW CA+CTYHNFAKNV+CLRCGGPKT+ +
Sbjct: 505 VPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANV 539

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489
           R GDW C SC++ NF +   C RC  P +S +
Sbjct: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSAL 396

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHIN 389
           R GDW C +C + NF +   C RC  P  +N   N
Sbjct: 508 RAGDWKCANCTYHNFAKNVVCLRCGGPKTANVSAN 542

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  370 bits (949), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 187/385 (48%), Positives = 257/385 (66%), Gaps = 16/385 (4%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQI-VIDEQAESFKAAF 59
           MFYV++EL +    ++ KD T++ ++ +Q+++A++L +     ++I  +  +  + +   
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDADSLEKRKINGNEIRQLAVEGSNLQDTV 60

Query: 60  EKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQR 119
               + I S+     F+LCS+FSTW++RV L R+A D  V +P  L+YP + DL KE+ R
Sbjct: 61  LLFEKEINSVINGEEFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIVLDLWKEFDR 120

Query: 120 WCLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEENDGAIDDKMFKN 179
           WC NHP+       L+S K  N   K               +   ++  + +++   +  
Sbjct: 121 WCTNHPDA------LQSVKGYNRKCKNLPMVH--------QVLGVEQRLNESVNANGY-T 165

Query: 180 ERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDTTQ 239
            +++ I++ +LLQL  +C++ DDT  VLT PY+S  D  +F +E+S VLY+NNLP DTTQ
Sbjct: 166 RKEVGITSDILLQLHKKCSSDDDTNTVLTQPYNSKLDYETFTEEQSTVLYLNNLPPDTTQ 225

Query: 240 SELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHEEA 299
            ELE+WF QFG+RPV FWTFKN+V DTS++ N WN NNS YVEE DS+ GF  FQT EEA
Sbjct: 226 GELETWFGQFGSRPVSFWTFKNIVEDTSNINNNWNLNNSYYVEEQDSVSGFATFQTFEEA 285

Query: 300 IEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPGDW 359
              L L+GR+ILSNVANTKQPR+VEHVVEI PSS  +L  + EILS+FPQSKNKPRPGDW
Sbjct: 286 FNALKLSGRSILSNVANTKQPRIVEHVVEIHPSSARILHSSEEILSAFPQSKNKPRPGDW 345

Query: 360 SCPSCGFSNFQRRTACFRCSFPAPS 384
           +CPSCGFSNFQRRTACFRCSFP PS
Sbjct: 346 NCPSCGFSNFQRRTACFRCSFPVPS 370

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 27/33 (81%), Positives = 30/33 (90%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487
           IPFRAGDW CA+C YHNFAKN++CLRC GPKTS
Sbjct: 442 IPFRAGDWKCAACAYHNFAKNIICLRCSGPKTS 474

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHINIKSQNNSHHPEITSEHNTEG 409
           R GDW C +C + NF +   C RCS P  S+ H N++S     H     E NT G
Sbjct: 445 RAGDWKCAACAYHNFAKNIICLRCSGPKTSHPH-NLRS-----HSNYGQEANTNG 493

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489
           R GDWNC SC + NF +   C RC  P  S +
Sbjct: 341 RPGDWNCPSCGFSNFQRRTACFRCSFPVPSAV 372

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score =  372 bits (955), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 194/403 (48%), Positives = 270/403 (66%), Gaps = 32/403 (7%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVP--TKVDQIVIDEQAES---- 54
           M+Y+ +E +TLH++ETPKDHT+I  +++QL+N     ++    K + +VI    +S    
Sbjct: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60

Query: 55  ----FKAAFEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKI 110
               FK   E+ + ++     +   +LCSL STWD+RVT+ RQ+ D G+ +P FL+ P I
Sbjct: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120

Query: 111 FDLMKEYQRWC-LNHPEVMSWKPKLESD-----KTINMDKKKXXXXXXXXXXXXXDMYNF 164
           FDL KEYQRWC L+  E+ + K K   D     K + +++                  N 
Sbjct: 121 FDLWKEYQRWCNLHFSEINTMKTKKYKDSSELYKILEINQNSDAKT------------NN 168

Query: 165 KEEND--GAID-DKMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFL 221
           ++ ND  G I+ D+ +K + D+  +  V + ++ +C+T +D ++VLT PY+S+ D ++F+
Sbjct: 169 EKLNDRSGNINMDRGYK-KNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFI 227

Query: 222 QERSRVLYMNNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYV 281
           QE S+++YMNNLP DTTQSELESWF QFG +P   WT +N++  TS   +  NSNNSPYV
Sbjct: 228 QETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILESTSYTNSNGNSNNSPYV 287

Query: 282 EELDSIPGFVVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAH 341
           EE DSI GF VFQTH+EA + L LNGR+ILSN+ANTKQPRVVEH+VE+QPSS  +L++  
Sbjct: 288 EEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQ 347

Query: 342 EILSSFPQSKNKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPS 384
           EI S FPQSKNKPRPGDW+C SCGFSNFQRRT+CFRCSFPA +
Sbjct: 348 EISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPAAT 390

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489
           +PFRAGDW C++C+YHNFAKN++CLRCGGPKT  I
Sbjct: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKTQAI 581

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 24/61 (39%), Gaps = 18/61 (29%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPS------------------NGHINIKSQNNS 396
           R GDW C +C + NF +   C RC  P                     NGH N KSQ N 
Sbjct: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKSMSHNSGQKYNGHSNHKSQYND 609

Query: 397 H 397
           H
Sbjct: 610 H 610

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTST 488
           R GDWNC SC + NF +   C RC  P  ++
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAATS 391

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  328 bits (841), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/513 (37%), Positives = 280/513 (54%), Gaps = 53/513 (10%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNAN--ALGEVPTKVDQIVIDEQAESFKAA 58
           M YV+LE+++ H+  T KD TRI  +++Q+VN +   L      V  I I   +E+F+ A
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60

Query: 59  FEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQ 118
             +L+  I +    + F++C+L S  ++RVTL RQA D+GV++P +L+YPK+FDL  E++
Sbjct: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120

Query: 119 RWCLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYNFKEENDGAIDDKMFK 178
           ++C NHPE +    ++ + K + +                 D+   +  N          
Sbjct: 121 KFCANHPE-LDLNEEMVTSKDVAI---------------LTDILGLQSNN---------T 155

Query: 179 NERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDTT 238
               + IST VLL L  +C++S+D K VLT PYD   D+++F +E +RV++++NLP D T
Sbjct: 156 ENYTIDISTDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDIT 215

Query: 239 QSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHEE 298
           Q+ELE+WF    ++P+ +WT K    D  S     N +N+ YV    SI GF++FQTHEE
Sbjct: 216 QNELETWFANHNSKPICYWTSK--TPDEYSR----NFHNNTYVMNQHSIIGFIIFQTHEE 269

Query: 299 AIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPGD 358
           A + L LNG++I S+  + KQ   VEH++E+ PSST VLD   +IL  FPQSKNKPR GD
Sbjct: 270 AKQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGD 329

Query: 359 WSCPSCGFSNFQRRTACFRCSFPAPSNGHINIKSQNNSHHPEITSEHNTEGSQQXXXXXX 418
           W+CPSCGFSNFQRRTACFRCSFPAP+N + N  +   S++   T+  +T  S        
Sbjct: 330 WNCPSCGFSNFQRRTACFRCSFPAPNNSNTNNTNNGESNNNTQTTGEHTNTSPHSSLQQA 389

Query: 419 XXXXXXXMYRYNTRYVXXXXXXXXXXXXXXXXXXXXI--------PFRAGDWNCASCTY- 469
                   Y      V                    I        PF +   N +S  + 
Sbjct: 390 VHHSPYQTYNKLNDSVTGSLNQQTYRYSNNNNSNIKIHNTANFNMPFTSYTGNGSSVPFR 449

Query: 470 -----------HNFAKNVLCLRCGGPKTSTIYQ 491
                      HNFAKN+ CLRCG PK S I+Q
Sbjct: 450 AGDWKCPSCTYHNFAKNIACLRCGDPKLSGIHQ 482

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  248 bits (634), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 144/402 (35%), Positives = 226/402 (56%), Gaps = 40/402 (9%)

Query: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60
           M YV+L++    Q+++      + ++ +Q+++  +L     + +  V+D   ES K    
Sbjct: 1   MHYVVLDV----QIDSSAVKPVLLRLGYQVIDPVSL---EARNEPYVVDVDGESIKEFIA 53

Query: 61  KLNESITSI--------TRDSS---------FILCSLFSTWDIRVTLNRQARDLGVSMPY 103
           KL+E + S         ++D S         F+ C+L  +W ++V L   A DLGV +P 
Sbjct: 54  KLDEDLKSHATVANHQESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVSSANDLGVELPE 113

Query: 104 FLQYPKIFDLMKEYQRWCLNHPEVMSWKPKLESDKTINMDKKKXXXXXXXXXXXXXDMYN 163
           +L+YP  FD+ KEY  W  NH +  S  P+ +++   ++D                  Y+
Sbjct: 114 YLRYPVFFDIWKEYSIWKKNHSD-SSESPQTQANGE-SIDSFAGKIEELVRTLDVSTEYD 171

Query: 164 -FKEENDGAIDDKMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQ 222
             K++ND    D  F    D+ ++T VL  L  +C T  D   VLT PYD   D ++F++
Sbjct: 172 ELKQKND----DPTF----DVRLATLVLTALHKKCVTPVDDTTVLTVPYDLGMDYKNFIE 223

Query: 223 ERSRVLYMNNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVE 282
           E+S++LY++N+PS+  Q++LE WF Q G   VGFWT KN+  D ++LA+    N+   + 
Sbjct: 224 EQSKILYISNIPSELNQTDLEGWFQQKGVASVGFWTLKNI-SDDATLAS--QRNHGKMLS 280

Query: 283 ELDSIPGFVVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHE 342
             DS+ GF +FQ+H +A   L L+G  +   +   K  + +E +++IQPSS  +L+K  +
Sbjct: 281 IPDSMFGFAIFQSHNDAEYALNLHGTVM--KIVAPKGNKHIEQLLDIQPSSMRLLEKVQD 338

Query: 343 ILSSFPQSKNKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPS 384
            L   PQ+KNKPRPGDW+CPSCGFSNFQRRTACFRC+FP P+
Sbjct: 339 NLILLPQNKNKPRPGDWNCPSCGFSNFQRRTACFRCAFPVPN 380

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%)

Query: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTST 488
           +PFRAGDW C  C YHNFAKN++CLRCGGPKT T
Sbjct: 532 VPFRAGDWKCPGCFYHNFAKNIVCLRCGGPKTKT 565

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 355 RPGDWSCPSCGFSNFQRRTACFRCSFP 381
           R GDW CP C + NF +   C RC  P
Sbjct: 535 RAGDWKCPGCFYHNFAKNIVCLRCGGP 561

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 458 RAGDWNCASCTYHNFAKNVLCLRCGGP 484
           R GDWNC SC + NF +   C RC  P
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFP 377

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 204 KNVLTCPYDSDTDVRSFLQERSRV---LYMNNLPSDTTQSELESWFTQFG 250
           + V   P+ S  D +S L+E       +Y+ N+  +TTQ E E+ FTQFG
Sbjct: 196 QEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFG 245

>NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON}
           Anc_2.167
          Length = 224

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 15/63 (23%)

Query: 214 DTDVRSFLQERSRVLYMNNLPSDTTQSELESWFTQFG---------------TRPVGFWT 258
           D++ +  L E S +LY++ LP    + EL  +F+QFG               +R  GF  
Sbjct: 82  DSNKKKPLAEYSSILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIE 141

Query: 259 FKN 261
           F N
Sbjct: 142 FAN 144

>KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 305

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query: 227 VLYMNNLPSDTTQSELESWFTQFGTRPVGFWTFKNV 262
           VL + NLP D TQ ELE  F   G + V   + +N+
Sbjct: 234 VLLVQNLPKDVTQQELEKLFVSDGFKEVRLVSVRNL 269

>CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {ON}
           similar to uniprot|P34761 Saccharomyces cerevisiae
           YNL197c WHI3 involved in regulation of cell size
          Length = 671

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 227 VLYMNNLPSDTTQSELESWFT-QFGTRPVGFWTFKNVVG 264
            LY+ NLPSD T+ EL   F+ QFG R + F   KN  G
Sbjct: 545 TLYVGNLPSDATEQELRQLFSNQFGFRRLSFRN-KNANG 582

>NCAS0C05920 Chr3 (1218910..1219773) [864 bp, 287 aa] {ON} Anc_4.7
           YHL034C
          Length = 287

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 55/126 (43%), Gaps = 19/126 (15%)

Query: 223 ERSR-VLYMNNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYV 281
           ERS+  LY+NNLP   T+ EL      FGT+P      K  + D ++    ++       
Sbjct: 168 ERSKDTLYVNNLPYSATKEELAEL---FGTKPELVVLPKRRMRDETTKKVVFS------- 217

Query: 282 EELDSIPGFVVFQT-------HEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSST 334
           E L+    F+ F+          E  +   L  R ++ +VA  K P+  EHV E  P + 
Sbjct: 218 ETLNRGIAFITFENLSGDIADKREEFQGKTLEERELVVDVAVVK-PKREEHVEEAHPDAE 276

Query: 335 SVLDKA 340
              ++A
Sbjct: 277 ESHEEA 282

>YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putative
           RNA-binding protein, interacts with Mex67p, which is a
           component of the nuclear pore involved in nuclear mRNA
           export
          Length = 659

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 224 RSRVLYMNNLPSDTTQSELESWFTQFG 250
           RS+ + + NLPSDTTQ E+  +F+  G
Sbjct: 311 RSKTILVKNLPSDTTQEEVLDYFSTIG 337

>KLLA0F23650g Chr6 (2210563..2211501) [939 bp, 312 aa] {ON} similar
           to uniprot|P53927 Saccharomyces cerevisiae YNL110C NOP15
           Constituent of 66S pre-ribosomal particles involved in
           60S ribosomal subunit biogenesis localizes to both
           nucleolus and cytoplasm
          Length = 312

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 48/118 (40%), Gaps = 2/118 (1%)

Query: 225 SRVLYMNNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEEL 284
           S +LY++ LP    + EL  +F+QFG             G++   A     N    V   
Sbjct: 182 SGILYISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEYINKDDAVVAQ 241

Query: 285 DSIPGFVVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHE 342
           +S+  +++   H   ++VL  NG +I       K+P V   V +         D+ HE
Sbjct: 242 ESMNNYLLM-GHLLKVKVLP-NGSSIDKLFRYKKKPFVTSKVTKSSAQLKKTADEKHE 297

>CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly
           similar to uniprot|P43607 Saccharomyces cerevisiae
           YFR032c
          Length = 443

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%)

Query: 228 LYMNNLPSDTTQSELESWFTQFGTRPVGFWTFKNV 262
           +Y   LP +TT ++L ++FT +G+R +  +  KNV
Sbjct: 185 VYCAFLPKETTDNDLRNYFTDYGSREIWIFRTKNV 219

>TBLA0A05720 Chr1 (1417989..1421912) [3924 bp, 1307 aa] {ON}
           Anc_1.110 YNL250W
          Length = 1307

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 55/135 (40%), Gaps = 32/135 (23%)

Query: 25  KVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFEKLNESITSITRDSSFILCSLFSTW 84
           +V    V+AN L  + T+  Q+++    ++FK     L   + +I +             
Sbjct: 79  QVKLAFVSANGLNMIVTRNMQLLVKRSTQTFKT----LEGQLVAINKAGD---------- 124

Query: 85  DIRVTLNRQARDLGVSMPYFLQYPK-IFDLM----KEYQRWCLNHP-----------EVM 128
             R TLN ++ DL   +P ++  PK I D +    +E   W L+ P           + M
Sbjct: 125 --RTTLNTRSTDLDAQVPQYMGVPKAILDYVIFCHQEDSLWPLSEPANLKKKFDEIFQAM 182

Query: 129 SWKPKLESDKTINMD 143
            +   L+S K I  D
Sbjct: 183 KFTKALDSLKAIKKD 197

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,239,909
Number of extensions: 2244535
Number of successful extensions: 7038
Number of sequences better than 10.0: 39
Number of HSP's gapped: 7192
Number of HSP's successfully gapped: 98
Length of query: 542
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 428
Effective length of database: 40,409,475
Effective search space: 17295255300
Effective search space used: 17295255300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)