Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B008607.348ON2281949631e-133
SAKL0F11330g7.348ON2081857631e-103
NDAI0A019107.348ON2141877561e-102
NCAS0A141407.348ON2241837561e-102
TDEL0C020007.348ON2131817359e-99
TPHA0F029507.348ON2161807341e-98
Kpol_530.337.348ON1951827234e-97
KLLA0D12386g7.348ON2111817192e-96
KNAG0C037707.348ON2231887021e-93
Smik_4.727.348ON1971846983e-93
YDL166C (FAP7)7.348ON1971846931e-92
Suva_4.807.348ON2061846853e-91
ACL150W7.348ON2191806863e-91
KLTH0H01298g7.348ON2141806837e-91
ZYRO0F11660g7.348ON1981816828e-91
Ecym_47257.348ON2341836832e-90
Skud_4.917.348ON1941846783e-90
Kwal_56.246357.348ON2261836803e-90
CAGL0I03366g7.348ON2121826793e-90
TBLA0E005207.348ON2091886775e-90
Suva_11.2022.667ON27649820.046
YKL024C (URA6)2.667ON20449770.13
Smik_11.2292.667ON20449760.21
TBLA0C004808.101ON36034730.70
Skud_11.2042.667ON27949711.1
Ecym_24956.337ON43533683.2
KNAG0H001402.667ON29748673.4
Smik_10.391.142ON51348674.2
CAGL0A04477g7.390ON77070649.1
KAFR0K008607.114ON46242649.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B00860
         (228 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   375   e-133
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   298   e-103
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   295   e-102
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   295   e-102
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   287   9e-99
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   287   1e-98
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   283   4e-97
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   281   2e-96
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   275   1e-93
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   273   3e-93
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   271   1e-92
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   268   3e-91
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   268   3e-91
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   267   7e-91
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   267   8e-91
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   267   2e-90
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   265   3e-90
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   266   3e-90
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   266   3e-90
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   265   5e-90
Suva_11.202 Chr11 complement(376372..376986,376995..377210) [831...    36   0.046
YKL024C Chr11 complement(392526..393140) [615 bp, 204 aa] {ON}  ...    34   0.13 
Smik_11.229 Chr11 complement(379526..380140) [615 bp, 204 aa] {O...    34   0.21 
TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101...    33   0.70 
Skud_11.204 Chr11 complement(373437..374051,374060..374284) [840...    32   1.1  
Ecym_2495 Chr2 complement(970589..971896) [1308 bp, 435 aa] {ON}...    31   3.2  
KNAG0H00140 Chr8 complement(19224..20117) [894 bp, 297 aa] {ON}        30   3.4  
Smik_10.39 Chr10 (67317..68858) [1542 bp, 513 aa] {ON} YJL194W (...    30   4.2  
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    29   9.1  
KAFR0K00860 Chr11 (184828..186216) [1389 bp, 462 aa] {ON} Anc_7....    29   9.3  

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  375 bits (963), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 181/194 (93%)

Query: 1   MVTETKESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDES 60
           MVTETKESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDES
Sbjct: 1   MVTETKESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDES 60

Query: 61  RKSHIVXXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRG 120
           RKSHIV             RRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRG
Sbjct: 61  RKSHIVDDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRG 120

Query: 121 YHESKIQENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQH 180
           YHESKIQENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQH
Sbjct: 121 YHESKIQENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQH 180

Query: 181 KNGVTNEYQGELPK 194
           KNGVTNEYQGELPK
Sbjct: 181 KNGVTNEYQGELPK 194

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  298 bits (763), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 157/185 (84%)

Query: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66
           E++R  PN+LVTGTPGCGKSTTCELL+RRL DYTY+NIS+FA +HKCYDGYDE RKSHIV
Sbjct: 2   ETKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHIV 61

Query: 67  XXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126
                        R+GKSI+DWHVNDVFPERLIDLVVVLRCDNSIL+DRLH RGYH+SKI
Sbjct: 62  DEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSKI 121

Query: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186
           +ENLDAEIMGVV+QDA +SY QEIVVELQS++ E MDANV+RIV WQEMWL QH NGVTN
Sbjct: 122 EENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVTN 181

Query: 187 EYQGE 191
           E + E
Sbjct: 182 ELEPE 186

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  295 bits (756), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 136/187 (72%), Positives = 160/187 (85%)

Query: 5   TKESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSH 64
           T  SRRY PNLL+TGTPG GKSTTCELL RRLP+Y Y+NIS+FA+++ CY+GYD+ RKSH
Sbjct: 3   TDNSRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSH 62

Query: 65  IVXXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHES 124
           IV             R+GKSI+DWHVND+FPERLIDLVVVLRCDNSIL+DRL+ RGYH+S
Sbjct: 63  IVDEDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDS 122

Query: 125 KIQENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGV 184
           KIQENLDAEIMGVVLQDA++SY+QEIVVELQS+ TE+M+ANVERIV W +MW+ QHKNGV
Sbjct: 123 KIQENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGV 182

Query: 185 TNEYQGE 191
           TNE QG+
Sbjct: 183 TNELQGK 189

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  295 bits (756), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 159/183 (86%)

Query: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66
           +SRRY PNLL+TGTPGCGKSTTCELL RRLP+Y Y+NIS+FA++H CYDGYD+ RKSHIV
Sbjct: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62

Query: 67  XXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126
                        R+GKSIIDWHVNDVFPERLIDLV VLRCDNS+L+DRLHGR YH++KI
Sbjct: 63  DEDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122

Query: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186
           +EN+DAEIMGVVLQDAL+SY +EIVVELQS++TE+MDANV+RIV WQ+MWL QH++GVTN
Sbjct: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182

Query: 187 EYQ 189
           E +
Sbjct: 183 ELE 185

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  287 bits (735), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 155/181 (85%)

Query: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66
           E RR+ PNLL+TGTPGCGKSTTCELL RRLPDY Y+NIS+FA++H C+DGYDE+RKS+IV
Sbjct: 2   EPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYIV 61

Query: 67  XXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126
                        R G +I+DWHVNDVFPERLIDLVVVLRCDN+IL+DRL  R YH++KI
Sbjct: 62  DEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAKI 121

Query: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186
           QENLDAEIMGVVLQDA DSYEQEIVVELQS+STE+M+ANV+RIV+W+++WL QHK+G TN
Sbjct: 122 QENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQTN 181

Query: 187 E 187
           E
Sbjct: 182 E 182

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  287 bits (734), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 152/180 (84%)

Query: 8   SRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIVX 67
           SRRY PNLL+TGTPGCGKSTTCELL RRL DYTY+NIS+FA++H CYDG+DE RKSHIV 
Sbjct: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVD 61

Query: 68  XXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKIQ 127
                       R+GK I+DWHVNDVFPERLIDLVVVLRCDNS+L+DRL  RGYH+SKI 
Sbjct: 62  EDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121

Query: 128 ENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTNE 187
           EN+DAEIMGVVLQDA +SY QEIVVELQS++TE+MD NV++IV W E+W+ QHKNGVTNE
Sbjct: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNE 181

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  283 bits (723), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 132/182 (72%), Positives = 151/182 (82%)

Query: 8   SRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIVX 67
           SRR  PNLL+TGTPGCGKST+CELL RRL DY Y+NIS+FA++H CY+GYDE RKSHIV 
Sbjct: 3   SRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHIVD 62

Query: 68  XXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKIQ 127
                       R G SI+DWHVNDVFPERLIDLVVVLRCDNSIL+DRLH R YH+SKIQ
Sbjct: 63  EDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSKIQ 122

Query: 128 ENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTNE 187
           ENLDAEIMGVVLQDA +SY +EIVVELQS++TE+M+ANV+RIV W E+WL QHK GVTNE
Sbjct: 123 ENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVTNE 182

Query: 188 YQ 189
            +
Sbjct: 183 LE 184

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  281 bits (719), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 153/181 (84%)

Query: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66
           E  R+ PN++V+GTPGCGKSTTCELL RRLP+YTY+NIS+FA++H CYDGYD++RKS+IV
Sbjct: 2   EPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNIV 61

Query: 67  XXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126
                        R+G  IIDWHVNDVFPERL+DLVVVLRCDN IL+DRL+ RGYH +KI
Sbjct: 62  DDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAKI 121

Query: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186
           +EN+DAEIMGVVLQDA DSY QEIVVELQS++TEEMD NV+RI+AWQE+WL QHK GVTN
Sbjct: 122 EENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVTN 181

Query: 187 E 187
           E
Sbjct: 182 E 182

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  275 bits (702), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 148/188 (78%)

Query: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66
           ESRR +PN+LVTGTPG GKSTTCELL+R LPDYTY+NIS+FA K+KCYDGYDE+RKSHIV
Sbjct: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62

Query: 67  XXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126
                          G +IIDWHVNDVFPERLIDLV VLRCD+S+LFDRL+ R YH SKI
Sbjct: 63  DEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122

Query: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186
            EN+DAEIMGVVLQDALDSYE++IVVELQS+ TE+M ANV+R+V W  MW  QH  GVTN
Sbjct: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182

Query: 187 EYQGELPK 194
           E      K
Sbjct: 183 ELSAHQAK 190

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  273 bits (698), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 149/184 (80%)

Query: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66
           ESRRY PN++VTGTPGCGKS+ CELL  +L DY Y+NIS+FA+ H C++GYDE RKSHIV
Sbjct: 2   ESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHIV 61

Query: 67  XXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126
                        R+G SI+DWHVND+FPERLIDLVVVLRCDNS L+ RLH RGYH+SKI
Sbjct: 62  DEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSKI 121

Query: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186
           +ENLDAEIMGVV QDA++SYE  IVVELQS++ E+M++NV RI+ W++MWL QH  GVTN
Sbjct: 122 EENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVTN 181

Query: 187 EYQG 190
           EYQG
Sbjct: 182 EYQG 185

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  271 bits (693), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 125/184 (67%), Positives = 150/184 (81%)

Query: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66
           E+RRY PN++VTGTPGCGKS+TCE L  +L DY Y+NIS+FA+ + C++GYDE RKSHIV
Sbjct: 2   EARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHIV 61

Query: 67  XXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126
                        R+G SI+DWHVNDVFPERLIDLVVVLRCDNS L+ RLH RGYH+SKI
Sbjct: 62  DEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKI 121

Query: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186
           +ENLDAEIMGVV QDA++SYE  IVVELQS++ E+M +NV RIVAW++MWL QH +GVTN
Sbjct: 122 EENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVTN 181

Query: 187 EYQG 190
           EYQG
Sbjct: 182 EYQG 185

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  268 bits (685), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 125/184 (67%), Positives = 148/184 (80%)

Query: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66
           ESRRY PN++VTGTPGCGKS+TCELL   L  Y Y+NIS+FA+ + C++GYDE RKSHIV
Sbjct: 2   ESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHIV 61

Query: 67  XXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126
                        R+G SIIDWHVNDVFPERLIDLVVVLRCDNS L+ RLH RGYH+SKI
Sbjct: 62  DEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSKI 121

Query: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186
           +ENLDAEIMGVV QDA+DSYE  IVVELQS++ +++ +NV RI+AW++MWL QH  GVTN
Sbjct: 122 EENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVTN 181

Query: 187 EYQG 190
           EYQG
Sbjct: 182 EYQG 185

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  268 bits (686), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 124/180 (68%), Positives = 145/180 (80%)

Query: 10  RYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIVXXX 69
           R  PN+LV+GTPGCGKSTTCELL R LPDY YFNIS+FA +H CYDGYDE+RKSHIV   
Sbjct: 5   RCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHIVDED 64

Query: 70  XXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKIQEN 129
                     RRG +I+DWHVND+FPERLIDLVVVLRCDN+IL DRL  RGYH SKI+EN
Sbjct: 65  RLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSKIEEN 124

Query: 130 LDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTNEYQ 189
           +DAEIMGVVLQDALDSY +EIVVELQS+ TE+M  NV+RI AW+  W+++H +GV+N  Q
Sbjct: 125 IDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVSNALQ 184

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  267 bits (683), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 148/180 (82%)

Query: 8   SRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIVX 67
           S R++PN+LVTGTPGCGK++TCELL RRL D  Y+NIS+FA++H+CYDGYDE+RKSHIV 
Sbjct: 3   STRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHIVD 62

Query: 68  XXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKIQ 127
                       R+G +I+DWHVND+FPERLIDLVVVLR DN++L+DRL  RGYHE+KIQ
Sbjct: 63  EDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAKIQ 122

Query: 128 ENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTNE 187
           EN+DAEIMGVV+QDA DSYE+EIVVELQS++ ++MD NV+RI +W   WL Q+  GVTNE
Sbjct: 123 ENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVTNE 182

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  267 bits (682), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 149/181 (82%)

Query: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66
           ESRRY PN+L+TGTPG GKSTT ELL RRL D+ Y+NIS+FA+++ C+DGYDE RKSHIV
Sbjct: 2   ESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHIV 61

Query: 67  XXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126
                        R+G +IIDWHVNDVFPERLIDLVVVLRC+NSILF RL  RGYH++KI
Sbjct: 62  DEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTKI 121

Query: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186
            EN+DAEIMGVV+QDALDSYE+EIVVEL S+STE+M+ NV+RIV+W E+W  QH +GVTN
Sbjct: 122 DENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVTN 181

Query: 187 E 187
           E
Sbjct: 182 E 182

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  267 bits (683), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 147/183 (80%)

Query: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66
           +S R  PN++VTGTPGCGK+TTCELL RRL D  Y+NIS+FA++H CY+GYDE RKSHIV
Sbjct: 16  DSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHIV 75

Query: 67  XXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126
                        R+G +IIDWHVNDVFPERLIDLVVVLRCDNS L+DRLH RGYH++KI
Sbjct: 76  DEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAKI 135

Query: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186
           +EN+DAEIMGVVLQDA+DSY  +IVVELQSN+  +M+ NV RIVAW+  W++QH  GVTN
Sbjct: 136 EENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVTN 195

Query: 187 EYQ 189
           E Q
Sbjct: 196 ELQ 198

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  265 bits (678), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 147/184 (79%)

Query: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66
           E RR+ PN++VTGTPGCGKS+TCELL   L  Y Y+NIS+FA+ + C++ YDE+RKSHIV
Sbjct: 2   ELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHIV 61

Query: 67  XXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126
                        R+G SIIDWHVNDVFPERLIDLVVVLRCDNS L+ RLH RGYH+SKI
Sbjct: 62  DEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKI 121

Query: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186
           +ENLDAEIMGVV QDA+DSYE  IVVELQ ++ E+M +NV RIVAW++MWL QH +GVTN
Sbjct: 122 EENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVTN 181

Query: 187 EYQG 190
           EYQG
Sbjct: 182 EYQG 185

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  266 bits (680), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 145/183 (79%)

Query: 8   SRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIVX 67
           S R SPN+LVTGTPGCGK++TCELL RRL    Y+NIS+FA+++KCYDGYDE+RKSHIV 
Sbjct: 3   STRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHIVD 62

Query: 68  XXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKIQ 127
                       R G +I+DWHVNDVFPERLIDLVVVLR DNS LFDRL  RGYHE+KIQ
Sbjct: 63  EDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAKIQ 122

Query: 128 ENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTNE 187
           EN+DAEIMGVV+ DA DSY QEIVVELQS++TE+MD NV+RIV W++ W  QH  GVTNE
Sbjct: 123 ENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVTNE 182

Query: 188 YQG 190
             G
Sbjct: 183 LNG 185

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  266 bits (679), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 147/182 (80%)

Query: 8   SRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIVX 67
           SRR+ PN++VTGTPGCGKSTTCELL RRL  Y Y+NISEFAE+HKCYDGYDE RKSHIV 
Sbjct: 3   SRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHIVD 62

Query: 68  XXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKIQ 127
                         GKSIIDWHVNDVFPERLIDLVVVLR +N  L+DRL  RGYH+SKI+
Sbjct: 63  EDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSKIE 122

Query: 128 ENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTNE 187
           ENLDAEIMGVVLQDA +SYE EIVVELQSN+TE+M+ NV+RI  W + W+ +HK+GV++E
Sbjct: 123 ENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVSSE 182

Query: 188 YQ 189
            +
Sbjct: 183 LK 184

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  265 bits (677), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 124/188 (65%), Positives = 150/188 (79%), Gaps = 1/188 (0%)

Query: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66
           +SRRY PNLL++GTPG GKS+TCELL R L DY Y NIS+FA++  CYDG+D+ RKSHIV
Sbjct: 2   KSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHIV 61

Query: 67  XXXXXXXXXXXXXRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126
                        R G +I+DWHVNDVFPERLIDLVV+LR DNS+L+DRL  R YH++K+
Sbjct: 62  DEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAKV 121

Query: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186
           QENLDAEIMGVVLQDA+DSY QEIV+ELQSN+TEEM +NV+RIV+W E+W  QH +GVTN
Sbjct: 122 QENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVTN 181

Query: 187 EYQGELPK 194
           E  GE+ K
Sbjct: 182 EL-GEIKK 188

>Suva_11.202 Chr11 complement(376372..376986,376995..377210) [831
           bp, 276 aa] {ON} YKL023C-A (REAL)
          Length = 276

 Score = 36.2 bits (82), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 7/49 (14%)

Query: 1   MVTETKESRRYSPN----LLVTGTPGCGKSTTCELLMRRLPDYTYFNIS 45
           M T TK    +SP+    + V G PG GK T CE L++   DY++ +++
Sbjct: 73  MTTATKTKPAFSPDQVSVVFVLGGPGAGKGTQCEKLVK---DYSFVHLA 118

>YKL024C Chr11 complement(392526..393140) [615 bp, 204 aa] {ON}
          URA6Uridylate kinase, catalyzes the seventh enzymatic
          step in the de novo biosynthesis of pyrimidines,
          converting uridine monophosphate (UMP) into
          uridine-5'-diphosphate (UDP)
          Length = 204

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query: 1  MVTETKESRRYSPN----LLVTGTPGCGKSTTCELLMRRLPDYTYFNIS 45
          M   T     +SP+    + V G PG GK T CE L++   DY++ ++S
Sbjct: 1  MTAATTSQPAFSPDQVSVIFVLGGPGAGKGTQCEKLVK---DYSFVHLS 46

>Smik_11.229 Chr11 complement(379526..380140) [615 bp, 204 aa]
          {ON} YKL024C (REAL)
          Length = 204

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 7/49 (14%)

Query: 1  MVTETKESRRYSPN----LLVTGTPGCGKSTTCELLMRRLPDYTYFNIS 45
          M   T+    +SP+    + V G PG GK T CE L++   D+++ ++S
Sbjct: 1  MTAATESQPAFSPDQVSVIFVLGGPGAGKGTQCERLVK---DFSFVHLS 46

>TBLA0C00480 Chr3 (88992..90074) [1083 bp, 360 aa] {ON} Anc_8.101
          YFR007W
          Length = 360

 Score = 32.7 bits (73), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 3  TETKESRRYSPNLLVTGTPGCGKSTTCELLMRRL 36
          ++T+    Y+ N+++ G PG GKST  E L   L
Sbjct: 15 SKTRAKDNYTINIIIVGPPGSGKSTIAEKLSANL 48

>Skud_11.204 Chr11 complement(373437..374051,374060..374284) [840
           bp, 279 aa] {ON} YKL024C (REAL)
          Length = 279

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 7/49 (14%)

Query: 1   MVTETKESRRYSPN----LLVTGTPGCGKSTTCELLMRRLPDYTYFNIS 45
           M         +SP+    + V G PG GK T CE L++   DY++ ++S
Sbjct: 76  MTAAATPQPAFSPDQVSVVFVLGGPGAGKGTQCEKLVK---DYSFVHLS 121

>Ecym_2495 Chr2 complement(970589..971896) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AAR044W
          Length = 435

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 3   TETKESRRYSPNLLVTGTPGCGKSTTCELLMRR 35
           TE KESR+  P  ++TG  G GKST  E ++ +
Sbjct: 77  TEEKESRQKIPVTVITGYLGSGKSTLLERIVLK 109

>KNAG0H00140 Chr8 complement(19224..20117) [894 bp, 297 aa] {ON} 
          Length = 297

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 2   VTETKESRRYSPN----LLVTGTPGCGKSTTCELLMRRLPDYTYFNIS 45
           +TET     ++P     + V G PG GK T C+ L+R   DY + ++S
Sbjct: 95  MTETAGRPIFTPEEVSVIFVLGGPGAGKGTQCDNLVR---DYHFVHLS 139

>Smik_10.39 Chr10 (67317..68858) [1542 bp, 513 aa] {ON} YJL194W
           (REAL)
          Length = 513

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 8   SRRYSPNLLVTGTPGCGKSTTCELLMRR----LPDYTYFNISEFAEKH 51
           S   S +L +TG PG GK+   ++++RR    LP       S  A+KH
Sbjct: 97  SEHRSDSLYITGPPGTGKTAQLDMIIRRKFQSLPLSLSMAKSNVAQKH 144

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 29.3 bits (64), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 7/70 (10%)

Query: 80  RRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKIQENLDAEIMGVVL 139
           RR    +   V+D+F   L + +  L CDN+   D        E  +QEN+D +I     
Sbjct: 475 RRNSGTVKNFVSDIFQGTLTNRIKCLTCDNTTARDEPFLDFPIE--VQENVDIDI----- 527

Query: 140 QDALDSYEQE 149
           Q+ L+S+ Q+
Sbjct: 528 QEILESFHQK 537

>KAFR0K00860 Chr11 (184828..186216) [1389 bp, 462 aa] {ON} Anc_7.114
           YOL030W
          Length = 462

 Score = 29.3 bits (64), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 5/42 (11%)

Query: 23  CGKSTTCELLMRRLPDYTY-----FNISEFAEKHKCYDGYDE 59
           CG  +   L M  + DY++     F +S ++EK K YDGY +
Sbjct: 214 CGNDSMARLDMFGVNDYSWCGHSSFTVSGWSEKVKLYDGYSK 255

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,239,215
Number of extensions: 775849
Number of successful extensions: 3292
Number of sequences better than 10.0: 35
Number of HSP's gapped: 3371
Number of HSP's successfully gapped: 35
Length of query: 228
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 122
Effective length of database: 41,326,803
Effective search space: 5041869966
Effective search space used: 5041869966
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)