Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B008507.347ON19219210371e-145
Suva_4.817.347ON1911929021e-125
Skud_4.927.347ON1911928921e-123
Smik_4.737.347ON1911928911e-123
YDL165W (CDC36)7.347ON1911928901e-123
TDEL0C020107.347ON1911928801e-122
ZYRO0F11638g7.347ON1911928781e-121
NDAI0A019207.347ON1931948581e-118
Kpol_530.347.347ON1911928521e-117
NCAS0A141307.347ON1911928471e-117
CAGL0I03388g7.347ON1911938451e-116
KNAG0C037607.347ON1911938431e-116
TPHA0F029407.347ON1911927801e-106
TBLA0E005107.347ON2871677801e-105
SAKL0F11308g7.347ON1911937651e-104
KLTH0H01320g7.347ON1901937521e-102
Kwal_56.246347.347ON1901937461e-101
KLLA0D12408g7.347ON1841926844e-92
Ecym_47267.347ON1911996691e-89
ACL151C7.347ON2081996641e-88
ZYRO0C16588g3.370ON60883993e-04
SAKL0B08052g3.370ON57687983e-04
Kwal_23.39623.370ON55385950.001
KAFR0H008603.370ON57882950.001
Smik_16.3163.370ON56082930.001
YPR072W (NOT5)3.370ON56082930.002
TPHA0A035003.370ON54882930.002
CAGL0D01342g3.370ON54883920.002
Kpol_1006.73.370ON54081920.002
KLTH0F11880g3.370ON56385920.002
Skud_16.3613.370ON56082900.003
Suva_16.4013.370ON56582900.004
NDAI0A050803.370ON57582900.004
TBLA0H014903.370ON55282860.012
KNAG0A072903.370ON50782840.019
Ecym_34563.370ON50887820.035
KLTH0A03652g7.214ON77265820.037
ADL364C3.370ON50487820.040
Kpol_1070.257.214ON686103800.066
KAFR0A007602.475ON437102780.11
TDEL0C051203.370ON56283780.13
KLLA0B09196g3.370ON59072740.35
NDAI0A026907.214ON84681720.71
ZYRO0D16302g7.214ON829116711.00
TDEL0H023307.214ON81281682.5
Kwal_47.181147.214ON76380682.6
TBLA0D042707.214ON84766682.6
KLLA0E04335g7.214ON75839664.6
Skud_15.393.60ON655106655.1
NDAI0C064208.43ON68962646.4
NCAS0A133507.214ON80066647.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B00850
         (192 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   404   e-145
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   352   e-125
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   348   e-123
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   347   e-123
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   347   e-123
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   343   e-122
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   342   e-121
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   335   e-118
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   332   e-117
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   330   e-117
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   330   e-116
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   329   e-116
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   305   e-106
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   305   e-105
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   299   e-104
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   294   e-102
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   291   e-101
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   268   4e-92
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   262   1e-89
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   260   1e-88
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    43   3e-04
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    42   3e-04
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    41   0.001
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    41   0.001
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    40   0.001
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    40   0.002
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    40   0.002
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    40   0.002
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    40   0.002
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    40   0.002
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    39   0.003
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    39   0.004
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    39   0.004
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    38   0.012
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    37   0.019
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    36   0.035
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    36   0.037
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    36   0.040
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    35   0.066
KAFR0A00760 Chr1 (135882..137195) [1314 bp, 437 aa] {ON} Anc_2.4...    35   0.11 
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    35   0.13 
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    33   0.35 
NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {O...    32   0.71 
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    32   1.00 
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    31   2.5  
Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038...    31   2.6  
TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa] ...    31   2.6  
KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} simila...    30   4.6  
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    30   5.1  
NDAI0C06420 Chr3 complement(1486617..1488686) [2070 bp, 689 aa] ...    29   6.4  
NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON} Anc_7...    29   7.5  

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  404 bits (1037), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 192/192 (100%), Positives = 192/192 (100%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60
           MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60

Query: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120
           WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH
Sbjct: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120

Query: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180
           PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC
Sbjct: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180

Query: 181 QRDFLLFYNAIM 192
           QRDFLLFYNAIM
Sbjct: 181 QRDFLLFYNAIM 192

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  352 bits (902), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/192 (86%), Positives = 179/192 (93%), Gaps = 1/192 (0%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60
           MDKFGL+AL+PL+KQ+ + E +  YDHSMTLGADLSSMLYSLGIPRD Q HRVLDTFQSP
Sbjct: 1   MDKFGLQALVPLLKQEDK-ELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSP 59

Query: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120
           WAETSRSEVEP+F  P+SF NI +VLQSNVTPPCF+SIQNDQQRVALFQDETLF+LFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119

Query: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180
           P TVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVS DGLSE+GSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179

Query: 181 QRDFLLFYNAIM 192
           QRDFLLFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  348 bits (892), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 165/192 (85%), Positives = 177/192 (92%), Gaps = 1/192 (0%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60
           M+KFGL+AL+PL+K + + E +  YDHSMTLGADLSSMLYSLGIPRD Q HRVLDTFQSP
Sbjct: 1   MEKFGLRALVPLLKLEDK-ELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSP 59

Query: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120
           WAETSRSEVEP+F  P+SF NI  VLQSNVTPPCF+SIQNDQQRVALFQDETLF+LFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119

Query: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180
           P TVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVS DGLSE+GSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179

Query: 181 QRDFLLFYNAIM 192
           QRDFLLFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  347 bits (891), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 165/192 (85%), Positives = 177/192 (92%), Gaps = 1/192 (0%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60
           M+KFGL+AL+PL+K + + E +  YDHSMTLGADLSSMLYSLGIPRD Q HRVLDTFQSP
Sbjct: 1   MEKFGLQALVPLLKLEDK-ELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSP 59

Query: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120
           WAETSRSEVEP+F  P+SF NI  VLQSNVTPPCF+SIQNDQQRVALFQDETLF+LFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119

Query: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180
           P TVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVS DGLSE+GSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179

Query: 181 QRDFLLFYNAIM 192
           QRDFLLFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  347 bits (890), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 165/192 (85%), Positives = 176/192 (91%), Gaps = 1/192 (0%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60
           M+KFGLKAL+PL+K + + E +  YDHSMTLGADLSSMLYSLGIPRD Q HRVLDTFQSP
Sbjct: 1   MEKFGLKALVPLLKLEDK-ELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSP 59

Query: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120
           WAETSRSEVEP+F  P+SF NI  VLQS VTPPCF+SIQNDQQRVALFQDETLF+LFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119

Query: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180
           P TVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVS DGLSE+GSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179

Query: 181 QRDFLLFYNAIM 192
           QRDFLLFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  343 bits (880), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 175/192 (91%), Gaps = 1/192 (0%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60
           M+KFGLKAL+PLIKQ+ + E    YDHS+TLGADLSSML+SLGIPRD + HRVLDTFQSP
Sbjct: 1   MEKFGLKALVPLIKQE-ERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSP 59

Query: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120
           WAETSRSEVEPKF IPDSF NI  VLQS  TPPCF+S+Q+DQQRVALFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKH 119

Query: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180
           P TVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS DGLSE+GSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179

Query: 181 QRDFLLFYNAIM 192
           QR+FLLFYNAIM
Sbjct: 180 QREFLLFYNAIM 191

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  342 bits (878), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 161/192 (83%), Positives = 177/192 (92%), Gaps = 1/192 (0%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60
           MDKFGL+AL+PL+KQ+ + E +G+YDHSMTLGADLSSML+SLGIPRD + H+VLDTFQSP
Sbjct: 1   MDKFGLEALVPLVKQEDR-ELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSP 59

Query: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120
           WAETSRSEVEP+F IP+SF NI NVL S  TPPCF+S+Q DQQRVALFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKH 119

Query: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180
           P TVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS DGLSE+GSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179

Query: 181 QRDFLLFYNAIM 192
           QRDFLLFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  335 bits (858), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 162/194 (83%), Positives = 175/194 (90%), Gaps = 3/194 (1%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60
           MDKFGL+AL+PLIK D + E +  YDHSMTLGADL+SML+SLGIPRD + HRVLDTFQSP
Sbjct: 1   MDKFGLEALVPLIKPDDK-ELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSP 59

Query: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNV--TPPCFDSIQNDQQRVALFQDETLFYLFY 118
           WAETSRSEVEP F IPDSF +I +VLQSN   TPP FDS+Q DQQRVALFQDETLFYLFY
Sbjct: 60  WAETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFY 119

Query: 119 KHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWE 178
           KHP TVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEP+VS DGLSE+GSYVFFDPQRWE
Sbjct: 120 KHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWE 179

Query: 179 KCQRDFLLFYNAIM 192
           KCQR+FLLFYNAIM
Sbjct: 180 KCQREFLLFYNAIM 193

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  332 bits (852), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 155/192 (80%), Positives = 175/192 (91%), Gaps = 1/192 (0%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60
           MDKFGL+AL+PLIKQD   E + +Y+H+MT+G DLSSML+SLGIPRD Q +R+LDTFQSP
Sbjct: 1   MDKFGLEALLPLIKQD-DTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSP 59

Query: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120
           WAETSRSEVEP+F  P+SF NI NVLQS VTPP F+SI+NDQQRV LFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKH 119

Query: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180
           P TVIQELTYLELRKRNWRYHKTLKAWLTKDPM+EP+VS DGLSE+GSY+FFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKC 179

Query: 181 QRDFLLFYNAIM 192
           QR+F+LFYNAIM
Sbjct: 180 QREFVLFYNAIM 191

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  330 bits (847), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 159/192 (82%), Positives = 171/192 (89%), Gaps = 1/192 (0%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60
           MDKFGLKAL+PL++QD + E +  YDHSMTLGADLSSM++SLGIPRD   HRVLDTFQSP
Sbjct: 1   MDKFGLKALVPLLRQDDK-ELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSP 59

Query: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120
           WAETSRSEVEP F IPDSF  IS VLQS VTPP FDS QNDQQRVALFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKH 119

Query: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180
           P TV+QELTYLELR RNWRYH TL+AWLTKDP+MEP VS DGLSE+GSYVFFDPQRWEKC
Sbjct: 120 PGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKC 179

Query: 181 QRDFLLFYNAIM 192
           Q+DFLLFYNAIM
Sbjct: 180 QKDFLLFYNAIM 191

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  330 bits (845), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 156/193 (80%), Positives = 172/193 (89%), Gaps = 3/193 (1%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQ-YDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQS 59
           M KFGL+ L+PLI+ D   EK+G+ YDHSMT+G DLSSML+SLGIPRD +HHRVLDTFQS
Sbjct: 1   MSKFGLQKLVPLIRAD--EEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQS 58

Query: 60  PWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYK 119
           PWAETSRSEVEPK+ IP+SF NI +VLQS  TPP FD +Q DQQRVALFQDETLFYLFYK
Sbjct: 59  PWAETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYK 118

Query: 120 HPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEK 179
           HP TVIQELTYLELRKRNWRYHK LKAWLTKDPMMEP+V+ DGLSE+GSYVFFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEK 178

Query: 180 CQRDFLLFYNAIM 192
           CQRDF LFY+AIM
Sbjct: 179 CQRDFPLFYSAIM 191

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  329 bits (843), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 168/193 (87%), Gaps = 3/193 (1%)

Query: 1   MDKFGLKALIPLIKQ-DPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQS 59
           MDKFGLKAL+PL++Q DP  E   +YDHSM LGADLSSML+SLGIPRD +   VL TFQS
Sbjct: 1   MDKFGLKALVPLVRQGDP--EVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQS 58

Query: 60  PWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYK 119
           PWAETSRSEVEP F IP SF  I  VLQS  TPPCFDS+Q DQQRVALFQDETLFYLFYK
Sbjct: 59  PWAETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYK 118

Query: 120 HPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEK 179
           HP TVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS DGLSE+GSYVFFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEK 178

Query: 180 CQRDFLLFYNAIM 192
           CQRDFLLFYNAIM
Sbjct: 179 CQRDFLLFYNAIM 191

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  305 bits (780), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 142/192 (73%), Positives = 168/192 (87%), Gaps = 1/192 (0%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60
           MDKFGL+AL+PLIKQD   E + +Y+H+MT+GADL+S+ +SLGIP + + +RVLDTFQSP
Sbjct: 1   MDKFGLEALLPLIKQD-DPEFSKKYNHAMTIGADLTSIQHSLGIPNNNKRYRVLDTFQSP 59

Query: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120
           WAETSRSEVEP++  P SF NI  VLQS  TP  F+S++ DQQR++LFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDETLFYLFYKH 119

Query: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180
           P TVIQELTYLELRKRNWRYHK LKAWLTKDP++EPIV+ DG SE+GSY+FFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEKC 179

Query: 181 QRDFLLFYNAIM 192
           QRDF+LFYNAIM
Sbjct: 180 QRDFVLFYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  305 bits (780), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 154/167 (92%)

Query: 26  DHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSPWAETSRSEVEPKFSIPDSFNNISNV 85
           DHS+T+GADLSSML+SLG+PRD + HR+LDTFQSPWAETSRSEV+P+F IP SF+NISNV
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISNV 180

Query: 86  LQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKHPATVIQELTYLELRKRNWRYHKTLK 145
           LQ N TPP F++I+ DQQRVALFQDETLFYLFYKHP TVIQELTYLELRKRNWR+HK LK
Sbjct: 181 LQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILK 240

Query: 146 AWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKCQRDFLLFYNAIM 192
            WLTKDPMMEPIV+ DG SE+GSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 241 TWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 15/16 (93%)

Query: 1  MDKFGLKALIPLIKQD 16
          MD+FGLKAL+PLI+ D
Sbjct: 1  MDRFGLKALVPLIRLD 16

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  299 bits (765), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 167/193 (86%), Gaps = 5/193 (2%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHH-RVLDTFQS 59
           ++K+GLKAL+PLIKQ+     N +YD +MT+G DLSSML+SLGI  ++++  RVLDTF S
Sbjct: 3   VEKYGLKALLPLIKQE---TGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPS 59

Query: 60  PWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYK 119
           PW ETSRSEVEPKF  P+SF NI NVLQS  +PP F+S+Q D  ++ALFQDETLFYLFYK
Sbjct: 60  PWVETSRSEVEPKFFTPESFVNIPNVLQSP-SPPSFNSVQQDHPKIALFQDETLFYLFYK 118

Query: 120 HPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEK 179
           HP TV+QE+TYLELRKRNWRYHKTLK WLTKDPMMEP+VSQDGLSE+GSYVFFDPQRWEK
Sbjct: 119 HPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEK 178

Query: 180 CQRDFLLFYNAIM 192
           CQRDF+LFYNAIM
Sbjct: 179 CQRDFVLFYNAIM 191

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  294 bits (752), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 137/193 (70%), Positives = 164/193 (84%), Gaps = 4/193 (2%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDK-QHHRVLDTFQS 59
           M+K+GL AL+PLI+++   +++  YD SMTLG DLS +L+SLGIP ++   +RVLDTFQS
Sbjct: 1   MEKYGLSALLPLIRRE---DQSPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQS 57

Query: 60  PWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYK 119
           PW ETSRSEVEPKF +P+SF NI NVLQS   PP F+S+Q D  +++LFQDETLFYLFYK
Sbjct: 58  PWVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYK 117

Query: 120 HPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEK 179
           HP +V+QELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+  G SE+GSYVFFDPQRWEK
Sbjct: 118 HPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEK 177

Query: 180 CQRDFLLFYNAIM 192
           CQRDF+LFYNAIM
Sbjct: 178 CQRDFVLFYNAIM 190

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  291 bits (746), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 163/193 (84%), Gaps = 4/193 (2%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQ-HHRVLDTFQS 59
           M+K+GL AL+PLI+++ Q   + +YD SMTLG DLS +L+SLGI  ++   +RVLDTFQS
Sbjct: 1   MEKYGLSALLPLIRREDQ---SPEYDSSMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQS 57

Query: 60  PWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYK 119
           PW ETSRSEVEPKF +P+SF NI NVLQ+   PP F+S+Q D  +++LFQDETLFYLFYK
Sbjct: 58  PWVETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYLFYK 117

Query: 120 HPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEK 179
           HP +V+QELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+  G SE+GSYVFFDPQRWEK
Sbjct: 118 HPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEK 177

Query: 180 CQRDFLLFYNAIM 192
           CQRDF+LFYNAIM
Sbjct: 178 CQRDFVLFYNAIM 190

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  268 bits (684), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 126/192 (65%), Positives = 152/192 (79%), Gaps = 8/192 (4%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60
           M+K+GLK L+P+++ DP       YD +MTLG DL+S+L SL I +D + H  LD F+SP
Sbjct: 1   MEKYGLKDLVPVLRHDPT------YDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESP 54

Query: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120
           W ETSRSEV+P F IP+SF NI  +L ++     F S+  DQ R++L QDETLFYLFYKH
Sbjct: 55  WVETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKH 112

Query: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180
           P +VIQELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+QD +SE+GSYVFFDPQRWEKC
Sbjct: 113 PGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKC 172

Query: 181 QRDFLLFYNAIM 192
           QRDF+L YNAIM
Sbjct: 173 QRDFVLHYNAIM 184

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  262 bits (669), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 150/199 (75%), Gaps = 15/199 (7%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIP-RDKQH------HRV 53
           M K+GLK+L+P+IK D       QYD SMTLG DL S+L+SL +  RD  +      H  
Sbjct: 1   MSKYGLKSLLPVIKHD------KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHT 54

Query: 54  LDTFQSPWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETL 113
           LDTF SPW ETSRSEVEPKF IP+SF NI  VL    T   F S+  D  R++L QDETL
Sbjct: 55  LDTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETL 112

Query: 114 FYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFD 173
           FYLFYKHP TV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVSQD  SE+GSYVFFD
Sbjct: 113 FYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFD 172

Query: 174 PQRWEKCQRDFLLFYNAIM 192
           PQRWEKCQRDF+L YNAIM
Sbjct: 173 PQRWEKCQRDFILNYNAIM 191

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  260 bits (664), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 148/199 (74%), Gaps = 15/199 (7%)

Query: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQH-------HRV 53
           MDK+GLK L+P+IK +       QYD  MTLG D+SS+L+SL +     +       H  
Sbjct: 18  MDKYGLKGLLPVIKHE------KQYDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHA 71

Query: 54  LDTFQSPWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETL 113
           LDTF SPW ETSRSEVEPKF IP+SF NI  VL    T   F S+  D  R++L QDETL
Sbjct: 72  LDTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDETL 129

Query: 114 FYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFD 173
           FYLFYKHP TV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVSQD  SE+GSYVFFD
Sbjct: 130 FYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFD 189

Query: 174 PQRWEKCQRDFLLFYNAIM 192
           PQRWEKCQRDF+L Y+AIM
Sbjct: 190 PQRWEKCQRDFILNYSAIM 208

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 8/83 (9%)

Query: 108 FQDETLFYLFYKHPATVIQELTYLELRK-RNWRYHKTLKAWLTKD-PMMEPIVSQDGLSE 165
           F  +TLF++FY +  T  Q L   EL K R W+++K  + W  K+   + P ++Q   SE
Sbjct: 519 FDLDTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKEVEKLPPGMAQ---SE 575

Query: 166 KGSYVFFDPQR-W--EKCQRDFL 185
           + S+ +FD QR W   +C  DF+
Sbjct: 576 EESWRYFDYQRSWLARRCNSDFI 598

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 6/87 (6%)

Query: 105 VALFQDETLFYLFYKHPATVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMMEP--IVSQD 161
            + F  +TLF++FY +  T  Q L   EL + RNW+++K    W  K+    P  +VS +
Sbjct: 481 TSKFDLDTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVVSSE 540

Query: 162 GLSEKGSYVFFDPQR-W--EKCQRDFL 185
              E+ S+ +FD Q+ W   +C  DF+
Sbjct: 541 NKQEEISWRYFDYQKSWLARRCGSDFV 567

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 47/85 (55%), Gaps = 7/85 (8%)

Query: 105 VALFQDETLFYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKD-PMMEPIVSQDGL 163
           ++ F  +TLF++FY +  T  Q L   EL  R W+++K  + W  K+   + P + Q   
Sbjct: 463 MSKFDLDTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKEVEKLPPGMEQ--- 519

Query: 164 SEKGSYVFFDPQR-W--EKCQRDFL 185
           SE+ S+ +FD Q+ W   +C  DF+
Sbjct: 520 SEEISWRYFDYQKSWLARRCGTDFV 544

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 108 FQDETLFYLFYKHPATVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSQDGLSEK 166
           F  +TLF++FY +  T  Q L+  EL K RNW+++K  + W  K+  +E +      SE+
Sbjct: 490 FDLDTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--IEKLPPGMNKSEE 547

Query: 167 GSYVFFDPQR-W--EKCQRDFL 185
            S+ +FD ++ W   +C  DF+
Sbjct: 548 ESWRYFDYKKSWLARRCSPDFV 569

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 108 FQDETLFYLFYKHPATVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSQDGLSEK 166
           F  +TLF++FY +  +  Q L   EL K RNW ++K  + W  K+  +E +    G SE+
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 167 GSYVFFDPQR-W--EKCQRDFL 185
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 108 FQDETLFYLFYKHPATVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEK 166
           F  +TLF++FY +  +  Q L   EL + RNW ++K  + W  K+  +E +    G SE+
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 167 GSYVFFDPQR-W--EKCQRDFL 185
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 8/82 (9%)

Query: 108 FQDETLFYLFYKHPATVIQELTYLELRK-RNWRYHKTLKAWLTKDPMME-PIVSQDGLSE 165
           F  +TLF++FY +  T  Q L   EL K RNW+Y+K  + W  K+     P ++Q   +E
Sbjct: 460 FDLDTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKEVTKSAPDMAQ---TE 516

Query: 166 KGSYVFFDPQR-W--EKCQRDF 184
           + ++ +FD Q  W   +C  DF
Sbjct: 517 EETWRYFDYQNSWLARRCNHDF 538

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 46/83 (55%), Gaps = 6/83 (7%)

Query: 107 LFQDETLFYLFYKHPATVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSQDGLSE 165
           +F  +TLF++FY +  T  Q L   EL K RNW+++K  + W  K+  +E +      SE
Sbjct: 459 MFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKE--IEKLPPGMTKSE 516

Query: 166 KGSYVFFD-PQRW--EKCQRDFL 185
           + S+ +FD  + W   +C  DF+
Sbjct: 517 EESWRYFDFKKSWLSRRCGSDFV 539

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 108 FQDETLFYLFYKHPATVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSQDGLSEK 166
           F  +TLF++FY +  T  Q L   EL K RNW+++K  + W  K+    P   Q    E+
Sbjct: 452 FDLDTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYKEVTKSPPGMQQA--EE 509

Query: 167 GSYVFFDPQR-W--EKCQRDF 184
            ++ +FD Q  W   +C  DF
Sbjct: 510 ETWRYFDYQNSWLARRCNSDF 530

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 48/85 (56%), Gaps = 7/85 (8%)

Query: 105 VALFQDETLFYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKD-PMMEPIVSQDGL 163
           ++ F  +TLF++FY +  T  Q L+  EL  R W+++K  + W  K+   + P + Q   
Sbjct: 473 MSKFDLDTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKEVEKLPPGMEQ--- 529

Query: 164 SEKGSYVFFDPQR-W--EKCQRDFL 185
           SE+ S+ +FD Q+ W   +C  +F+
Sbjct: 530 SEEISWRYFDYQKSWLARRCGAEFV 554

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 108 FQDETLFYLFYKHPATVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSQDGLSEK 166
           F  +TLF++FY +  +  Q L   EL K RNW +++  + W  K+  +E +    G SE+
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 167 GSYVFFDPQR-W--EKCQRDFL 185
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 108 FQDETLFYLFYKHPATVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSQDGLSEK 166
           F  +TLF++FY +  +  Q L   EL K RNW +++  + W  K+  +E +    G SE+
Sbjct: 477 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 534

Query: 167 GSYVFFDPQR-W--EKCQRDFL 185
            S+ +FD ++ W   +C  DF+
Sbjct: 535 ESWRYFDYKKSWLARRCGNDFV 556

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 108 FQDETLFYLFYKHPATVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSQDGLSEK 166
           F  +TLF++FY +  T  Q L   EL K R+W+Y+K    W  K+    P  +     E+
Sbjct: 485 FDLDTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGANYNKDEE 544

Query: 167 GSYVFFDPQR-W--EKCQRDFL 185
            S+ +FD ++ W   +C  DF+
Sbjct: 545 ESWRYFDYKKSWLSRRCGNDFV 566

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 8/82 (9%)

Query: 108 FQDETLFYLFYKHPATVIQELTYLELRK-RNWRYHKTLKAWLTKD-PMMEPIVSQDGLSE 165
           F  +TLF++FY +  T  Q L+  EL K RNW ++K  + W  ++   + P + Q   SE
Sbjct: 463 FDLDTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYREVEKLPPGLPQ---SE 519

Query: 166 KGSYVFFDPQR-W--EKCQRDF 184
           + S+ +FD Q+ W   +C  +F
Sbjct: 520 EISWRYFDYQKSWLSRRCNSNF 541

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 37.0 bits (84), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 108 FQDETLFYLFYKHPATVIQELTYLELR-KRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEK 166
           F  +TLF++FY +  T  Q L   EL   R+W+++K  + W  K+  +E +      SE+
Sbjct: 419 FDLDTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNKSEE 476

Query: 167 GSYVFFDPQR-W--EKCQRDFL 185
            S+ +FD ++ W   +C  DF+
Sbjct: 477 ESWRYFDYKKSWLARRCNSDFV 498

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 36.2 bits (82), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 103 QRVALFQDETLFYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKD-PMMEPIVSQD 161
           Q +  F  +TLF++FY +  T  Q L   EL  R W +++  + W  ++   + P + Q 
Sbjct: 416 QILTKFDLDTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYREVEKLPPGMEQ- 474

Query: 162 GLSEKGSYVFFDPQR-W--EKCQRDFL 185
              E+ S+ +FD Q+ W   +C  DF+
Sbjct: 475 --KEEVSWRYFDYQKSWLARRCGPDFV 499

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 113 LFYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFF 172
           LFY FY     + QE+ Y  L +RNW+  KT + W ++  +  P  S + L E   +  F
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSRHSL--PKFSNE-LCEVADFKIF 723

Query: 173 DPQRW 177
           +   W
Sbjct: 724 NLDDW 728

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 36.2 bits (82), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 5/87 (5%)

Query: 103 QRVALFQDETLFYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDG 162
           Q +  F  +TLF++FY +  T  Q L   EL  R W +++  + W  K+  +E +     
Sbjct: 412 QIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKE--VEKLPPGMD 469

Query: 163 LSEKGSYVFFDPQR-W--EKCQRDFLL 186
             E+ S+ +FD Q+ W   +C  DF+ 
Sbjct: 470 QKEEVSWRYFDYQKSWLARRCGPDFVF 496

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 35.4 bits (80), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 52/103 (50%), Gaps = 9/103 (8%)

Query: 96  DSIQNDQQRVAL--FQDETLFYLFYKH--PATVIQ-ELTYLELRKRNWRYHKTLKAWLTK 150
           D+   D+ R+ L  F+   +F LFY +  P T +Q +++ + L +R+W+  K    W  K
Sbjct: 543 DNTNEDKLRLVLERFRPTEIFTLFYHYYFPLTPLQKQISSILLIERDWKLLKNGTMWFLK 602

Query: 151 DPMMEPIVSQDGLSEKGSYVFFDPQRWEKCQR-DFLLFYNAIM 192
               EP  S +   E G+Y  F    W   ++ +F L +N++M
Sbjct: 603 --QGEPKFSNESF-EVGNYKIFKADDWTVIEKFNFKLDFNSLM 642

>KAFR0A00760 Chr1 (135882..137195) [1314 bp, 437 aa] {ON} Anc_2.475
           YKL106W
          Length = 437

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 46/102 (45%), Gaps = 33/102 (32%)

Query: 2   DKFGLKALIPLIKQDPQGEKNGQY-DHSM--TLGADLSSMLYSLGIPRDKQHHRVLDTFQ 58
           D + L+AL+ +IKQDP    NG Y  HS+  ++G D S ++ SL +P             
Sbjct: 258 DAYALRALLDVIKQDPDAFPNGVYVCHSLSSSIGFD-SDIVGSLSVPL------------ 304

Query: 59  SPWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQN 100
                       P+     +  NI+ VLQ+     CFDS+ N
Sbjct: 305 ------------PRSCTISAKGNINEVLQN-----CFDSMYN 329

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 8/83 (9%)

Query: 108 FQDETLFYLFYKHPATVIQELTYLELRK-RNWRYHKTLKAWLTKD-PMMEPIVSQDGLSE 165
           F  +TLF++FY +  T  Q L   EL K R W+++K  + W  K+   + P + Q   +E
Sbjct: 473 FDLDTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKEVEKLPPGMLQ---AE 529

Query: 166 KGSYVFFDPQ-RW--EKCQRDFL 185
           + S+ +FD Q  W   +C  D +
Sbjct: 530 EESWRYFDYQGSWLARRCNNDVV 552

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 105 VALFQDETLFYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLS 164
           ++ F  +TLF++FY +  +  Q L   EL  R W ++K  + W  K+  +E +       
Sbjct: 499 MSKFALDTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKE--VEKLPPGIEGK 556

Query: 165 EKGSYVFFDPQR 176
           E+ ++ +FD Q+
Sbjct: 557 EEVTWRYFDYQK 568

>NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {ON}
           Anc_7.214
          Length = 846

 Score = 32.3 bits (72), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 4/81 (4%)

Query: 112 TLFYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVF 171
           TLFY +Y     + +E+  + L +RNW+       W  +     PI  Q+ L E G Y  
Sbjct: 719 TLFYNYYFAVTPLEKEIANVILNERNWKVSFDETMWFLR---QGPIKFQNELCELGDYKI 775

Query: 172 FDPQRWEKCQR-DFLLFYNAI 191
           F    W    + +F L Y+++
Sbjct: 776 FKLDEWLVVDKINFKLDYSSL 796

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 32.0 bits (71), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 49/116 (42%), Gaps = 11/116 (9%)

Query: 84  NVLQSNVTPPCFDSIQNDQQRVALFQDE-------TLFYLFYKHPATVIQELTYLELRKR 136
           ++L+ ++ P   +S  NDQ++     +        TLFY +Y     + QE+  + L +R
Sbjct: 677 DILRCSLRPIIQNSELNDQEKYEAILENFRSLEMFTLFYNYYFAVTPLEQEIASIILSER 736

Query: 137 NWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKCQR-DFLLFYNAI 191
           +W+  K    W  +    +     + L E   Y  F    W    R +F L Y A+
Sbjct: 737 DWKVSKNCAMWFLRQSETK---FANELCEVADYKIFKLDDWTVIDRLNFKLDYAAL 789

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 112 TLFYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVF 171
           TLFY +Y     + Q +  L L +RNW+  K+   W  +    EP  + + + E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLR--QGEPKFANE-VCEVADYKI 748

Query: 172 FDPQRWEKCQR-DFLLFYNAI 191
           F    W    + +F L Y A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

>Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038C
           (NOT3) - CCR4 trascriptional complex component [contig
           198] FULL
          Length = 763

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 4/80 (5%)

Query: 113 LFYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFF 172
           LFY FY     + +E+ Y  L +R+W+  K+  +W ++  +  P  S + L E   +  F
Sbjct: 674 LFYCFYYSITPLEREIAYTLLIERSWKVSKSGDSWFSRHGV--PKFSNE-LCEVADFKIF 730

Query: 173 DPQRWEKCQR-DFLLFYNAI 191
           +   W   ++ +F L Y+ +
Sbjct: 731 NLDDWTVSEKLNFKLDYSIL 750

>TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa]
           {ON} Anc_7.214 YIL038C
          Length = 847

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 112 TLFYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVF 171
           TLFY +Y     + +E++ + L +R+WR       W ++    E  +S D L E G Y  
Sbjct: 725 TLFYNYYFSVTPLEKEVSMVVLAERDWRITNNETMWFSR--QGEAKLS-DELYEIGDYRI 781

Query: 172 FDPQRW 177
           F  + W
Sbjct: 782 FSLEDW 787

>KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q75AN0 Ashbya gossypii ADL108C ADL108Cp and
           some similarites with YIL038C uniprot|P06102
           Saccharomyces cerevisiae YIL038C NOT3 Subunit of the
           CCR4- NOT complex which is a global transcriptional
           regulator with roles in transcription initiation and
           elongation and in mRNA degradation
          Length = 758

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%)

Query: 112 TLFYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTK 150
           TLFY +Y     + Q +  L L++R WR  KT   W  +
Sbjct: 641 TLFYHYYFSVTPLEQRICALLLKQREWRVLKTGDCWFLR 679

>Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W
           (REAL)
          Length = 655

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 45/106 (42%), Gaps = 10/106 (9%)

Query: 70  EPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKHPATVIQELT 129
           EP  S+  +  +ISNV +  +   CF+ ++   QR  L    + FY      +  +   T
Sbjct: 45  EPVLSV--ALTSISNVSRIQLKQNCFEILRATDQRDNLSAINSYFYESNSKRSIFVSTGT 102

Query: 130 YLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQ 175
             +L       H  L A   K P++  + S    + K  +V FDP+
Sbjct: 103 ERDL-------HGWLDAIFAKCPLLSGVSSPTNFTHK-VHVGFDPK 140

>NDAI0C06420 Chr3 complement(1486617..1488686) [2070 bp, 689 aa]
           {ON} Anc_8.43 YLR055C
          Length = 689

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 47  DKQHHRVLDTFQSPWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVA 106
           D Q+ ++++ F+   +E S  E+ P FS  D  N+I +   SN      +S  ND +  +
Sbjct: 410 DLQNGKIVNEFKGTTSELSSLELRPLFSTVDINNDIISA-DSNTKMSTTNSENNDDEMES 468

Query: 107 LF 108
           LF
Sbjct: 469 LF 470

>NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON}
           Anc_7.214 YIL038C
          Length = 800

 Score = 29.3 bits (64), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 3/66 (4%)

Query: 112 TLFYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVF 171
           TLFY +Y     + +E++ + L +R+WR  K    W  +      +  Q+   E G Y  
Sbjct: 671 TLFYNYYFAVTPLEKEISNVILNERSWRISKDETLWFLR---QGSVKLQNEFCEIGDYKI 727

Query: 172 FDPQRW 177
           F    W
Sbjct: 728 FKLDDW 733

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,023,079
Number of extensions: 933969
Number of successful extensions: 2568
Number of sequences better than 10.0: 61
Number of HSP's gapped: 2548
Number of HSP's successfully gapped: 62
Length of query: 192
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 89
Effective length of database: 41,670,801
Effective search space: 3708701289
Effective search space used: 3708701289
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)