Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0B008307.343ON71071032830.0
NDAI0A019407.343ON76572023950.0
TDEL0C020407.343ON70569823940.0
NCAS0A141107.343ON75363723860.0
KNAG0C037407.343ON72763623810.0
Smik_4.747.343ON84563323520.0
YDL164C (CDC9)7.343ON75562223480.0
CAGL0I03410g7.343ON72469723400.0
Suva_4.827.343ON75573323350.0
Skud_4.937.343ON75561223290.0
ZYRO0F11572g7.343ON73163022260.0
Kpol_2001.717.343ON72670822110.0
SAKL0F10912g7.343ON69370421940.0
Kwal_56.246167.343ON71570621850.0
KLTH0H01408g7.343ON72363121250.0
KLLA0D12496g7.343ON70062720900.0
TPHA0D045707.343ON73671620330.0
TBLA0E020507.343ON72068320170.0
ACL155W7.343ON69769419710.0
TPHA0M002606.18ON9664212405e-20
Smik_15.1746.18ON9452442272e-18
TBLA0G010406.18ON9722402263e-18
CAGL0E02695g6.18ON9463812235e-18
YOR005C (DNL4)6.18ON9444172229e-18
KNAG0F028706.18ON9542442164e-17
ACR008W6.18ON9812422165e-17
Skud_15.1666.18ON9472442155e-17
ZYRO0C07854g6.18ON9443982084e-16
Suva_15.1806.18ON9484152066e-16
KLLA0D01089g6.18ON9073732067e-16
NCAS0D026506.18ON9502412031e-15
KLTH0C11286g6.18ON9513941995e-15
TDEL0G045106.18ON9694131932e-14
KAFR0A050506.18ON9482441861e-13
Kwal_56.224146.18ON9632611852e-13
NDAI0I022606.18ON9672711782e-12
Kpol_1032.76.18ON9652161744e-12
TPHA0D020605.348ON49671950.009
KLTH0E11352g8.488ON98596708.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0B00830
         (710 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...  1269   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   927   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   926   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...   923   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   921   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   910   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   909   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   905   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   904   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   901   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   862   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   856   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   849   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   846   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   823   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   809   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   787   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   781   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   763   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...    97   5e-20
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...    92   2e-18
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...    92   3e-18
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    91   5e-18
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...    90   9e-18
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...    88   4e-17
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...    88   5e-17
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    87   5e-17
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...    85   4e-16
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    84   6e-16
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    84   7e-16
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    83   1e-15
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    81   5e-15
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...    79   2e-14
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    76   1e-13
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    76   2e-13
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    73   2e-12
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    72   4e-12
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...    41   0.009
KLTH0E11352g Chr5 (1014490..1017447) [2958 bp, 985 aa] {ON} simi...    32   8.0  

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 1269 bits (3283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/710 (88%), Positives = 631/710 (88%)

Query: 1   MLKLLCCNKYPAQRLTPLVYIYSGIMSSNSKRQATLARFFTSIKPSADDQNXXXXXXXXX 60
           MLKLLCCNKYPAQRLTPLVYIYSGIMSSNSKRQATLARFFTSIKPSADDQN         
Sbjct: 1   MLKLLCCNKYPAQRLTPLVYIYSGIMSSNSKRQATLARFFTSIKPSADDQNSKTSSSPVP 60

Query: 61  XXXXXXXXXXXXXXXXLKKPKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENI 120
                           LKKPKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENI
Sbjct: 61  PPSSSSSSTTANGSSPLKKPKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENI 120

Query: 121 SSRLQIIKLCSEFFTKAMKQNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISES 180
           SSRLQIIKLCSEFFTKAMKQNTANLIPLTYLFINKLGPDY              KTISES
Sbjct: 121 SSRLQIIKLCSEFFTKAMKQNTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISES 180

Query: 181 CGKSLQQVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQX 240
           CGKSLQQVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQ 
Sbjct: 181 CGKSLQQVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQL 240

Query: 241 XXXXXXXXXXTACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDME 300
                     TACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDME
Sbjct: 241 KKIRLIKKLLTACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDME 300

Query: 301 LIEKAEQKIRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEV 360
           LIEKAEQKIRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEV
Sbjct: 301 LIEKAEQKIRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEV 360

Query: 361 FDRFQNIHFTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTK 420
           FDRFQNIHFTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTK
Sbjct: 361 FDRFQNIHFTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTK 420

Query: 421 SLIIDCEAVAWDREEKKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKS 480
           SLIIDCEAVAWDREEKKILPFQVLST               CLFAFDILCHNDEKLINKS
Sbjct: 421 SLIIDCEAVAWDREEKKILPFQVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEKLINKS 480

Query: 481 LRERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHY 540
           LRERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHY
Sbjct: 481 LRERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHY 540

Query: 541 EPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETA 600
           EPSKRSRNWLKLKKDYLDGVGDSLDLCVLGA              LLGCYNQDTGEFETA
Sbjct: 541 EPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETA 600

Query: 601 CKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSP 660
           CKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSP
Sbjct: 601 CKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSP 660

Query: 661 IYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHVAK 710
           IYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHVAK
Sbjct: 661 IYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHVAK 710

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/720 (64%), Positives = 533/720 (74%), Gaps = 39/720 (5%)

Query: 26  MSSNSKRQATLARFFTSI---KPSAD------------DQNXXXXXXXXXXXXXXXXXXX 70
           +S   K+QATL RFF+SI   KP+ D            ++N                   
Sbjct: 44  VSKGRKQQATLGRFFSSINHKKPTKDTALKNESKEETKEENKDDSDSIPRKKIRLSTSSS 103

Query: 71  XXXXXXLKKPKLSPIE----------------------SSKTDSSETTVKQEFVCDIPYA 108
                   KPK SPI+                      +  T   +T V + F+C IPY 
Sbjct: 104 SPSIMAESKPK-SPIKLNTERSSSPASASASTTPTPIVADHTLDPKTAVSKPFLCAIPYK 162

Query: 109 DVCVLFQEIENISSRLQIIKLCSEFFTKAMKQNTANLIPLTYLFINKLGPDYXXXXXXXX 168
           +VC LFQEIE  SSRL IIKLCS+F  K MKQ+  NLIP+TYLFINKLGPDY        
Sbjct: 163 EVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPGLELGL 222

Query: 169 XXXXXXKTISESCGKSLQQVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLK 228
                 KTISESCGKSL Q++  Y+++GDLG IA+ ARNVQPTMFKPKPLTVG VF NLK
Sbjct: 223 GEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVFNNLK 282

Query: 229 LIAKSSGKDSQXXXXXXXXXXXTACK-GIEAKYLIRSLESKLRIGLAEKSVLISLSKALL 287
           +IAK++GKDSQ           TAC+ G+EAK+LIRSLESKLRIGLAEK+VLISLSKALL
Sbjct: 283 MIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLSKALL 342

Query: 288 INEYNNTLDPDMELIEKAEQKIRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLK 347
           + E++   D DMEL+E AE KIRDAFCQ+PNYEIVINSCL+YGIMNL+EHCSLRPGIPLK
Sbjct: 343 VKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLK 402

Query: 348 PMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEI 407
           PMLAKPTK I E+ DRFQ   FTSEYKYDGERAQVHL+ DG+MRIYSRNGENMTERYPEI
Sbjct: 403 PMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEI 462

Query: 408 NVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTXXXXXXXXXXXXXXXCLFAFD 467
           ++ DF+KD N TK+LI+DCEAVAWD+E++KILPFQVLST               CLFAFD
Sbjct: 463 HIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCLFAFD 522

Query: 468 ILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEG 527
           ILCHN  KLIN SL+ERREILH VT    GEF YA EL+T+NLDELQ FLDQSV DSCEG
Sbjct: 523 ILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEG 582

Query: 528 LMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAXXXXXXXXXXXXXXLL 587
           LMVK+L+GE+SHYEPSKRSRNWLKLKKDYL+G+GDSLDLCVLGA              LL
Sbjct: 583 LMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGGFLL 642

Query: 588 GCYNQDTGEFETACKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTL 647
           GCYN +TGEFET CKIGTGFSDE+LQ L+++LK+T IDGPKATYIYDSSA+PDVWFEP+L
Sbjct: 643 GCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWFEPSL 702

Query: 648 LFEVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSH 707
           LFEVLTADLS+SPIYKAG+S Y KG+SLRFPRFIR+REDK VE+ATSSEQIIELYENQSH
Sbjct: 703 LFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSH 762

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/698 (64%), Positives = 530/698 (75%), Gaps = 5/698 (0%)

Query: 17  PLVYIYSGIMSSNSKRQATLARFFTSIKPSADDQ----NXXXXXXXXXXXXXXXXXXXXX 72
           PLV +      S+ K+QATLARFF++++     +    +                     
Sbjct: 8   PLVELLINKGMSSGKKQATLARFFSAVQKDDTKEKVNGDVKIIESRDNQDEPVTKKFKSS 67

Query: 73  XXXXLKKPKLSPIESSKTDSSETTVKQE-FVCDIPYADVCVLFQEIENISSRLQIIKLCS 131
               L+   LSP++S+  +S +  V  + +   +PY+DVC +FQEIE  SSRL IIK+CS
Sbjct: 68  SPVKLQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRLSIIKICS 127

Query: 132 EFFTKAMKQNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQQVKLD 191
           EFF++ MK N  NLIP TYLFIN+LGPDY              KTISE+CGKSL QVK  
Sbjct: 128 EFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGLGEGLLMKTISEACGKSLVQVKNR 187

Query: 192 YKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXT 251
           Y+++GDLG IA+ ARNVQPTMFKPKPLTVG VF+NL+ IA S GKDSQ           T
Sbjct: 188 YREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLT 247

Query: 252 ACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRD 311
           AC+G+EAK+LIRSLESKLRIGLAEK+VLISLSKALL NE     +P MEL+E+AE KIRD
Sbjct: 248 ACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVEQAEAKIRD 307

Query: 312 AFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTS 371
           AFCQ+PNYEIVIN+CL YGIM LD+HC LRPGIPLKPMLAKPTK+I EV DRFQ   FTS
Sbjct: 308 AFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTS 367

Query: 372 EYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAW 431
           EYKYDGERAQVHL+ DG+MRIYSRNGENMTERYPEI++ DF+ DL  TK+LI+DCEAVAW
Sbjct: 368 EYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHTKTLILDCEAVAW 427

Query: 432 DREEKKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSV 491
           D+ ++KILPFQVLST               CLFAFDI+CHN E+ INKSLRERRE+L  V
Sbjct: 428 DKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQV 487

Query: 492 TREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLK 551
           T+ V GEF YA EL+T++++ELQ FLDQSVKDSCEGLMVK+LDG +SHYEPSKRSRNWLK
Sbjct: 488 TKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLK 547

Query: 552 LKKDYLDGVGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEV 611
           LKKDYLDGVGDSLDLCVLGA              LLGCYNQD+GEFET CKIGTGFSDE+
Sbjct: 548 LKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEFETCCKIGTGFSDEM 607

Query: 612 LQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSK 671
           LQ LY+R   TT+DGPKATY++DSSA+PDVWFEPT LFEVLTADLS+SP+YKAGASTY K
Sbjct: 608 LQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDK 667

Query: 672 GISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHVA 709
           G+SLRFPRF+RLR+DKSVE+ATSS QI+ELY++QSHVA
Sbjct: 668 GVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHVA 705

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score =  923 bits (2386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/637 (71%), Positives = 510/637 (80%), Gaps = 5/637 (0%)

Query: 77  LKKPKL--SPIESSKTDSSETTVK---QEFVCDIPYADVCVLFQEIENISSRLQIIKLCS 131
           LKK KL  S +E SK  + E   +   + +   IPY +VC LFQEIE+ SSRL IIKLCS
Sbjct: 116 LKKQKLEESNLEPSKEPTIENVTQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCS 175

Query: 132 EFFTKAMKQNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQQVKLD 191
           +FF K MK+N  NLIP+TYLFINKLGPDY              KTISESCGKSL QV+  
Sbjct: 176 DFFIKIMKENPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSLAQVRNK 235

Query: 192 YKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXT 251
           Y+++GDLG IAM+ARNVQPTMFKPKPLTVG VF+NL+LIAKS GKDSQ           T
Sbjct: 236 YRELGDLGQIAMDARNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLT 295

Query: 252 ACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRD 311
           AC+G EAK+LIRSLESKLRIGLAEK+VLISLSKALL++E  +  D DMEL+E AEQKIRD
Sbjct: 296 ACEGTEAKFLIRSLESKLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRD 355

Query: 312 AFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTS 371
           AFCQ+PNYEIVINSCLKYGIM L+ HCSLRPGIPLKPMLAKPTK I E+ DRFQ   FTS
Sbjct: 356 AFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTS 415

Query: 372 EYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAW 431
           EYKYDGERAQVHL++DG+MRIYSRNGENMTERYPEI++ DFI D  +T +LI+DCEAVAW
Sbjct: 416 EYKYDGERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAW 475

Query: 432 DREEKKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSV 491
           D E+ KILPFQVLST               CLFAFDILCHNDEKLINKSLRERR+IL  V
Sbjct: 476 DNEQNKILPFQVLSTRKRKDVDLKDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEV 535

Query: 492 TREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLK 551
           T+ V GEF YA E++++NLDELQ FLDQSV DSCEGLMVK+LDG +SHYEPSKRSRNWLK
Sbjct: 536 TKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLK 595

Query: 552 LKKDYLDGVGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEV 611
           LKKDYL+G+GDSLDLCV+GA              LLGCYNQDTGEFET CKIGTGFSDE+
Sbjct: 596 LKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEM 655

Query: 612 LQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSK 671
           LQ LY RL  T +DGPKAT++YDSSA+PDVWFEPTLLFEVLTADLS+SPIYKAG+STY K
Sbjct: 656 LQQLYTRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDK 715

Query: 672 GISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHV 708
           GISLRFPRFIR REDK VE+ATSSEQIIELYENQ+H 
Sbjct: 716 GISLRFPRFIRTREDKGVEDATSSEQIIELYENQAHT 752

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  921 bits (2381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/636 (69%), Positives = 511/636 (80%), Gaps = 2/636 (0%)

Query: 77  LKKPKLSPIESSKTD-SSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFT 135
           L  P  +P+ S K     E    +EF   +PYAD+C LFQEIE ISSRL IIKLCS F  
Sbjct: 92  LTSPSPTPVVSKKIKIQDENNDTKEFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLI 151

Query: 136 KAMKQNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQQVKLDYKDI 195
             MK +  NLIP+TYLFINKLGPDY              KTI+ESCG+SLQQ+K  Y +I
Sbjct: 152 SVMKLDPRNLIPMTYLFINKLGPDYMPGLELGLGENLLIKTIAESCGRSLQQIKTKYHEI 211

Query: 196 GDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXTACKG 255
           GDLG IA+ AR VQPTMFKPKPLTVG VFQNLK IA S GKDSQ           T+C+G
Sbjct: 212 GDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQG 271

Query: 256 IEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNT-LDPDMELIEKAEQKIRDAFC 314
           +EAK+LIRSLESKLRIGLAEK+VLISLSKALL+ EY  +  D DME +E AEQKIRDAFC
Sbjct: 272 VEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYEYGESDKDIDMETVENAEQKIRDAFC 331

Query: 315 QIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYK 374
           Q+PNYE+VI+SCLK+GIMNLD+HCSLRP IPLKPMLAKPTK+I E+FDRFQ+  FT EYK
Sbjct: 332 QVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYK 391

Query: 375 YDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDRE 434
           YDGERAQVHL+ DG+MRIYSRNGENMTERYPEI++ DF+ DL+ TKSLI+DCEAVAWD+E
Sbjct: 392 YDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKE 451

Query: 435 EKKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTRE 494
           + KILPFQVLST               CLFAFDIL HNDEKLINKSL+ERR+ILHS+T+E
Sbjct: 452 QNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKE 511

Query: 495 VHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKK 554
           V GEF +A E++T NL+ELQ FLDQSVK+SCEGLMVK+L+GE+SHYEPSKRSRNWLKLKK
Sbjct: 512 VTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKK 571

Query: 555 DYLDGVGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEVLQS 614
           DYL GVGDSLDLCVLGA              LLGCYNQDTGEFETACKIGTGFSDEVLQ 
Sbjct: 572 DYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQ 631

Query: 615 LYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGIS 674
           L++RLKST ID PKATY++D SA+PDVWFEPTLLFEVLTADLS+SP+YKAG+STY KG+S
Sbjct: 632 LHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVS 691

Query: 675 LRFPRFIRLREDKSVEEATSSEQIIELYENQSHVAK 710
           LRFPRF+RLREDK VE+ATSSEQI+E+YENQ+++ +
Sbjct: 692 LRFPRFLRLREDKGVEDATSSEQIVEMYENQANLQQ 727

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/633 (69%), Positives = 511/633 (80%), Gaps = 10/633 (1%)

Query: 80  PKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMK 139
           PK+   E +  DS        +  +IPY+DVC +F +IE ISSRL+II++CS+FF K MK
Sbjct: 217 PKVEDFEMNSNDSDH------YSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMK 270

Query: 140 QNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQQVKLDYKDIGDLG 199
           Q++ NLIP TYLFIN+LGPDY              KTISESCGKS+ Q+KL YK+IGDLG
Sbjct: 271 QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDLG 330

Query: 200 TIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXTACKGIEAK 259
            IAM ARNVQPTMFKPKPLTVG VF+NL+ IAK+ GKDSQ           TAC+G+EAK
Sbjct: 331 EIAMGARNVQPTMFKPKPLTVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAK 390

Query: 260 YLIRSLESKLRIGLAEKSVLISLSKALLINEYN--NTLDPD--MELIEKAEQKIRDAFCQ 315
           +LIRSLESKLRIGLAEK+VLISLSKALL+++ N  N+ D D  M+++E A+QKIRDAFCQ
Sbjct: 391 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQ 450

Query: 316 IPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKY 375
           +PNYEIVINSCL++GIMNLD++C+LRPGIPLKPMLAKPTK I EV DRFQ   FTSEYKY
Sbjct: 451 VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 510

Query: 376 DGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREE 435
           DGERAQVHL+NDG+MRIYSRNGENMTERYPEI +TDFI+DL++TK+LI+DCEAVAWD+++
Sbjct: 511 DGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQ 570

Query: 436 KKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTREV 495
            KILPFQVLST               CLFAFDILCHNDE+LIN SLRERRE L  VT+ V
Sbjct: 571 AKILPFQVLSTRKRKDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVV 630

Query: 496 HGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKD 555
            GEF YA ++ TNNLDELQ FLD+SV  SCEGLMVK+LDG +SHYEPSKRSRNWLKLKKD
Sbjct: 631 PGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKD 690

Query: 556 YLDGVGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEVLQSL 615
           YL+GVGDSLDLCVLGA              LLGCYNQDTGEFET CKIGTGFSDE+LQ L
Sbjct: 691 YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 750

Query: 616 YDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISL 675
           + RL  T IDGPKATY++DSSA+PDVWFEPT LFEVLTADLS+SPIYKAG++T+ KG+SL
Sbjct: 751 HARLTPTIIDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSL 810

Query: 676 RFPRFIRLREDKSVEEATSSEQIIELYENQSHV 708
           RFPRF+R+REDK VE+ATSS+QI+ELYENQSHV
Sbjct: 811 RFPRFLRIREDKGVEDATSSDQIVELYENQSHV 843

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/622 (69%), Positives = 508/622 (81%), Gaps = 4/622 (0%)

Query: 91  DSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMKQNTANLIPLTY 150
           D+  +     +  +IPY++VC +F +IE ISSRL+II++CS+FF K MKQ++ NLIP TY
Sbjct: 132 DALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTY 191

Query: 151 LFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQQVKLDYKDIGDLGTIAMNARNVQP 210
           LFIN+LGPDY              KTISE+CGKS+ Q+KL YKDIGDLG IAM ARNVQP
Sbjct: 192 LFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQP 251

Query: 211 TMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXTACKGIEAKYLIRSLESKLR 270
           TMFKPKPLTVG VF+NL+ IAK+ GKDSQ           TACKGIEAK+LIRSLESKLR
Sbjct: 252 TMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLR 311

Query: 271 IGLAEKSVLISLSKALLINEYNNTLDPD----MELIEKAEQKIRDAFCQIPNYEIVINSC 326
           IGLAEK+VLISLSKALL+++ N    PD    M+++E A+QKIRDAFCQ+PNYEIVINSC
Sbjct: 312 IGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSC 371

Query: 327 LKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMN 386
           L++GIMNLD++C+LRPGIPLKPMLAKPTK I EV DRFQ   FTSEYKYDGERAQVHL+N
Sbjct: 372 LEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLN 431

Query: 387 DGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLST 446
           DG+MRIYSRNGENMTERYPEIN+TDFI+DL+ TK+LI+DCEAVAWD+++ KILPFQVLST
Sbjct: 432 DGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLST 491

Query: 447 XXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELS 506
                          CLFAFDILC+NDE+LINKSL+ERRE L  VT+ V GEF YA +++
Sbjct: 492 RKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQIT 551

Query: 507 TNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDL 566
           TNNLDELQ FLD+SV  SCEGLMVK+L+G +SHYEPSKRSRNWLKLKKDYL+GVGDSLDL
Sbjct: 552 TNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 611

Query: 567 CVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDRLKSTTIDG 626
           CVLGA              LLGCYNQDTGEFET CKIGTGFSDE+LQ L+DRL  T IDG
Sbjct: 612 CVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDG 671

Query: 627 PKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLRED 686
           PKAT+++DSSA+PDVWFEPT LFEVLTADLS+SPIYKAG++T+ KG+SLRFPRF+R+RED
Sbjct: 672 PKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIRED 731

Query: 687 KSVEEATSSEQIIELYENQSHV 708
           K VE+ATSS+QI+ELYENQSH+
Sbjct: 732 KGVEDATSSDQIVELYENQSHM 753

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/697 (63%), Positives = 523/697 (75%), Gaps = 19/697 (2%)

Query: 31  KRQATLARFFTSIKPSADDQNXXXXXXXXXXXXXXXXXXXXXXXXXLKKPKLSPI----- 85
           KRQATLARFF+S+K  AD                            LKK KL        
Sbjct: 28  KRQATLARFFSSVKKDADGDKKGEQADVKTAAVDLNSHEVDANKSPLKKMKLESTGSLTA 87

Query: 86  -----------ESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFF 134
                      E +   S+   V  +F C +PY+D+C LF+EIE  SSRL IIKLCS+FF
Sbjct: 88  TKNGNQGKEEHEGTPIASTPRQVDSKFFCKVPYSDLCNLFEEIEGTSSRLAIIKLCSDFF 147

Query: 135 TKAMKQNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQQVKLDYKD 194
            K MK++  NLIP+TYLFINKLGPDY              KTISESCGKS+QQ+K  Y++
Sbjct: 148 IKIMKEDPQNLIPVTYLFINKLGPDYEPGLELGLGENLLMKTISESCGKSMQQIKNQYRE 207

Query: 195 IGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXTACK 254
           IGDLG IA+ ARNVQPTMFKPKPL VG VF+NLK IAKS GKDSQ           TAC+
Sbjct: 208 IGDLGQIALEARNVQPTMFKPKPLVVGEVFENLKTIAKSQGKDSQTKKMKLIKRMLTACQ 267

Query: 255 GIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINE--YNNTLDPDMELIEKAEQKIRDA 312
           G EAK+LIRSLESKLRIGLAEK+VLI+LSKALLI++  Y+N  +P M+++E+AEQKIRDA
Sbjct: 268 GTEAKFLIRSLESKLRIGLAEKTVLIALSKALLIHDEKYSNK-EPSMDVVEQAEQKIRDA 326

Query: 313 FCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSE 372
           FCQ+PNYE+VIN+CL YGIM LDEHC+++PGIPLKPMLAKPTK I EV DRFQ   FTSE
Sbjct: 327 FCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTFTSE 386

Query: 373 YKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWD 432
           YKYDGERAQVHL+ DG+MRIYSRNGENMTERYPEI + DF+ D   T SLI+DCEAVAWD
Sbjct: 387 YKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIKDFLADPASTTSLILDCEAVAWD 446

Query: 433 REEKKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVT 492
           +E+ KILPFQVL+T               CLFAFDIL HND +LIN+ L +RRE+LH VT
Sbjct: 447 KEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDILLHNDMRLINEPLSKRREVLHEVT 506

Query: 493 REVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKL 552
           + V GEF YA +++T+NLDELQ FLD+SVK+SCEGLMVK++DG +S+YEPSKRSRNWLKL
Sbjct: 507 KPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYYEPSKRSRNWLKL 566

Query: 553 KKDYLDGVGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEVL 612
           KKDYL+GVGDSLDLCVLGA              LLGCYN D+ +FET CKIGTGFS+E+L
Sbjct: 567 KKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSEDFETCCKIGTGFSEEML 626

Query: 613 QSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKG 672
           Q+LY++L  T IDGPK TY++DSSA+PDVWFEPT+LFEVLTADLS+SPIYKAG+S Y KG
Sbjct: 627 QTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGSSVYDKG 686

Query: 673 ISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHVA 709
           ISLRFPRF+R+R+DKSVE+ATSSEQIIE+Y+NQSHVA
Sbjct: 687 ISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHVA 723

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/733 (62%), Positives = 538/733 (73%), Gaps = 42/733 (5%)

Query: 18  LVYIYSGIMSSNSKR--QATLARFFTSIKPSADDQNXXXXXXXXXXXXXXXXXXXXXXXX 75
           L+++ S + SS  K+  QATLARFFTS+K      +                        
Sbjct: 21  LLFMSSSLPSSAGKKPKQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISSEGAS 80

Query: 76  XLKKPK-----LSPIESS---------------------KTDSSETTVKQE--------- 100
            +KK K      +P+E S                        S E T K E         
Sbjct: 81  AIKKLKHLSAVQTPVEQSDMSSSSSPLPSSAPSSSGVDASQKSRELTPKVEEEQGPIDND 140

Query: 101 -FVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMKQNTANLIPLTYLFINKLGPD 159
            +  +IPY++VC +F EIE ISSRL+II++CS+FF K MKQ++ NLIP TYLFIN+LGPD
Sbjct: 141 HYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPD 200

Query: 160 YXXXXXXXXXXXXXXKTISESCGKSLQQVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLT 219
           Y              KTISESCGKS+ Q+KL YK+IGDLG IAM ARNVQPTMFKPKPLT
Sbjct: 201 YEPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLT 260

Query: 220 VGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXTACKGIEAKYLIRSLESKLRIGLAEKSVL 279
           VG VF+NL+ IAK+ GKDSQ           TAC+G+EAK+LIRSLESKLRIGLAEK+VL
Sbjct: 261 VGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVL 320

Query: 280 ISLSKALLIN----EYNNTLDPDMELIEKAEQKIRDAFCQIPNYEIVINSCLKYGIMNLD 335
           ISLSKALL++    E ++  D  M+++E A+QKIRDAFCQ+PNYEIVINSCL++GIMNLD
Sbjct: 321 ISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLD 380

Query: 336 EHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGSMRIYSR 395
           + C+L+PGIPLKPMLAKPTK I EV DRFQ   FTSEYKYDGERAQVHL++DG+MRIYSR
Sbjct: 381 KFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSR 440

Query: 396 NGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTXXXXXXXXX 455
           NGENMTERYPEI +TDFI+DL+ TK+LI+DCEAVAWD+E+ KILPFQVLST         
Sbjct: 441 NGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELS 500

Query: 456 XXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQL 515
                 CLFAFD+LCHN E+LINKSLRERRE L  VT+ V GEF YA ++ T+NLDELQ 
Sbjct: 501 DVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQK 560

Query: 516 FLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAXXXX 575
           FLD+SV  SCEGLMVK+L+G +SHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVLGA    
Sbjct: 561 FLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGR 620

Query: 576 XXXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDS 635
                     LLGCYNQDTGEFET CKIGTGFSDE LQ L++RL  T IDGPKAT+++DS
Sbjct: 621 GKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDS 680

Query: 636 SAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSS 695
           SA+PDVWFEPT LFEVLTADLS+SPIYKAG++T++KG+SLRFPRF+R+REDK VE+ATSS
Sbjct: 681 SAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSS 740

Query: 696 EQIIELYENQSHV 708
           EQI+ELYENQSHV
Sbjct: 741 EQIVELYENQSHV 753

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/612 (70%), Positives = 502/612 (82%), Gaps = 4/612 (0%)

Query: 101 FVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMKQNTANLIPLTYLFINKLGPDY 160
           +  +IPY++VC +F +IE ISSRL+II++CS+FF K M Q++ NLIP TYLFIN+LGPDY
Sbjct: 142 YSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDY 201

Query: 161 XXXXXXXXXXXXXXKTISESCGKSLQQVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLTV 220
                         KTISESCGKS+ Q+KL YK++GDLG IAM ARNVQPTMFKPK LTV
Sbjct: 202 EAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTV 261

Query: 221 GYVFQNLKLIAKSSGKDSQXXXXXXXXXXXTACKGIEAKYLIRSLESKLRIGLAEKSVLI 280
           G VF+NL+ IAK+ GKDSQ           TAC+G+EAK+LIRSLESKLRIGLAEK+VLI
Sbjct: 262 GEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 321

Query: 281 SLSKALLINEYNNTLDPD----MELIEKAEQKIRDAFCQIPNYEIVINSCLKYGIMNLDE 336
           SLSKALL+++ N    PD    M+++E A+Q+IRDAFCQ+PNYEIVINSCL +GIMNLD+
Sbjct: 322 SLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDK 381

Query: 337 HCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGSMRIYSRN 396
           +C+LRPGIPLKPMLAKPTK I EV DRFQ   FTSEYKYDGERAQVHL+NDG+MRIYSRN
Sbjct: 382 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 441

Query: 397 GENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTXXXXXXXXXX 456
           GENMTERYPEI +TDFI+DLN TK+LI+DCEAVAWD+E+KKILPFQ+LST          
Sbjct: 442 GENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHD 501

Query: 457 XXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQLF 516
                CLFAFDILC+NDE+LINKSLRERRE L  VT+ V GEF YA ++ TNNLDELQ F
Sbjct: 502 VKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKF 561

Query: 517 LDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAXXXXX 576
           LD+SV +SCEGLMVK+LDG +SHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVLGA     
Sbjct: 562 LDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRG 621

Query: 577 XXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSS 636
                    LLGCYNQDTGEFET CKIGTGFSDE+LQ L++RL  T IDGPKAT+++D+S
Sbjct: 622 KRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDAS 681

Query: 637 AQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSE 696
           A+PDVWFEPT LFEVLTADLS+SPIYKAG++T+ KG+SLRFPRF+R+REDK VE+ATSS+
Sbjct: 682 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSD 741

Query: 697 QIIELYENQSHV 708
           QIIELYENQSHV
Sbjct: 742 QIIELYENQSHV 753

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/630 (66%), Positives = 491/630 (77%), Gaps = 2/630 (0%)

Query: 80  PKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMK 139
           PK   +ES    +S+      F   +PYADVC +FQEIE+ SSRL IIK+CS+FFT+ +K
Sbjct: 104 PKKLKMESDSNSTSKNNQDDHF-STVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVK 162

Query: 140 QNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQQVKLDYKDIGDLG 199
           +++ NL+P TYLFINKLGPDY              KTISESCGKSL QVK  Y+++GDLG
Sbjct: 163 EDSRNLVPTTYLFINKLGPDYEPGMELGLGEGLLMKTISESCGKSLAQVKNRYREMGDLG 222

Query: 200 TIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXTACKGIEAK 259
            IAM ARNVQPTMFKPKPLTVG VF NL+ IA + GKDSQ           TAC+G+EAK
Sbjct: 223 QIAMEARNVQPTMFKPKPLTVGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAK 282

Query: 260 YLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRDAFCQIPNY 319
           +LIRSLESKLRIGLAEK+VLISLS ALL +E    ++P  E ++KAEQ IRDAFCQ+PNY
Sbjct: 283 FLIRSLESKLRIGLAEKTVLISLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNY 342

Query: 320 EIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGER 379
           EIVIN+CL++GI  L +HC L PGIPLKPMLAKPTK I EV DRFQ   F SEYKYDGER
Sbjct: 343 EIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGER 402

Query: 380 AQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKIL 439
           AQ+HL+ DG+MRIYSRNGENMTERYPEI++ DF+ D + T+SLI+DCEAVAWD+E+ KIL
Sbjct: 403 AQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFLSDPS-TESLILDCEAVAWDKEQGKIL 461

Query: 440 PFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEF 499
           PFQVLST               CLFAFD+LCHN E LINKSLRER++ L  VT+ V GEF
Sbjct: 462 PFQVLSTRKRKDVDAKDVKVRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEF 521

Query: 500 TYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDG 559
            YA +L T N++ELQ FLDQSVKDSCEGLMVK+LDG +SHYEPSKRSRNWLKLKKDYL+G
Sbjct: 522 RYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNG 581

Query: 560 VGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDRL 619
           VGDSLDLCVLGA              LLGCYNQDTGE+ET CKIGTGFS+E+LQ LYDRL
Sbjct: 582 VGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRL 641

Query: 620 KSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFPR 679
           K T ++ P A Y+YDS+ QPDVWFEPTLLFEVL ADLS+SP+YKAG++ Y KGISLRFPR
Sbjct: 642 KPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPR 701

Query: 680 FIRLREDKSVEEATSSEQIIELYENQSHVA 709
           F+R+R+DKSVEEATSSEQ+++LYE Q+H++
Sbjct: 702 FLRIRDDKSVEEATSSEQVVDLYEAQAHLS 731

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/708 (61%), Positives = 508/708 (71%), Gaps = 24/708 (3%)

Query: 23  SGIMSSNSKRQATLARFFTSI-----------------KPSADDQNXXXXXXXXXXXXXX 65
           S +    +K+QATLARFF+S+                 K    D +              
Sbjct: 19  SAVNGGGAKKQATLARFFSSMPKRKIDDDSSTDSTTINKDDDSDTSKKIKLNSDETPTTS 78

Query: 66  XXXXXXXXXXXLKKPKLSPIES-SKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRL 124
                      L      PI + +K  S+   VK  F   +PYAD+C +FQE+E+ SSRL
Sbjct: 79  AGSVTSKDEPSLTSSPQKPIVTPAKVPSNTKPVK--FFSTVPYADLCEVFQEVESTSSRL 136

Query: 125 QIIKLCSEFFTKAMKQNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKS 184
            IIK+CS+F  K MKQ+  NL+P+TYLFINKLGPDY              KTISESCGKS
Sbjct: 137 SIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKS 196

Query: 185 LQQVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXX 244
           +QQ+K  Y++IGDLG IA +ARNVQPTMFKPKPLTVG VFQNLK IA+S GKDSQ     
Sbjct: 197 MQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMR 256

Query: 245 XXXXXXTACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEK 304
                 TACKG+EAK+LIRSLESKLRIGLAEK+VLISLSKALL+NEY  + DP MELIE 
Sbjct: 257 LIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMELIET 316

Query: 305 AEQKIRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRF 364
           AE+KIRDAFCQ+PNYEI+I SCL  GIM LD +C LRPGIPLKPMLAKPTK I EV D F
Sbjct: 317 AEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAF 376

Query: 365 QNIHFTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDF-IKDLNLTK--- 420
           Q   FT EYKYDGER QVHL+++G MRIYSRNGENMTERYPE+++ DF +KD + T    
Sbjct: 377 QGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEV 436

Query: 421 SLIIDCEAVAWDREEKKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKS 480
           SLI+DCE VAWD E+ KILPFQVLST               CLFAFDIL +N E LI K+
Sbjct: 437 SLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKT 496

Query: 481 LRERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHY 540
           LRERR+ILH VT+ V GEF YA  L T  LDE+Q FLDQ++KDSCEGLMVK+LDGE+S Y
Sbjct: 497 LRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRY 556

Query: 541 EPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETA 600
           EPSKRSRNWLKLKKDYL GVGDSLDLCV+GA              LLGCYNQD+GE+ET 
Sbjct: 557 EPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCYNQDSGEYETC 616

Query: 601 CKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSP 660
           CKIGTGFSDE+L  LY+  +   I+ PK+ Y +DSSA+PD+WFEP +LFEVLTADLS+SP
Sbjct: 617 CKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSP 676

Query: 661 IYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHV 708
           IYKAG++TY KGISLRFPRF+R+R+DKSVE+ATSS+QIIE+YENQSH+
Sbjct: 677 IYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHI 724

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/704 (59%), Positives = 508/704 (72%), Gaps = 36/704 (5%)

Query: 25  IMSSNSKRQATLARFFTSIKPSADDQNXXXXXXXXXXXXXXXXXXXXXXXXXLKK----- 79
           IMS+  K+Q TLARFF+S K   + ++                          +      
Sbjct: 8   IMST--KKQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDPANTSELITNEAVARSVSPPT 65

Query: 80  -------------PKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQI 126
                        P ++P+  SK               IPY+DVC +F EIE+ SSRL I
Sbjct: 66  PVVPVAPIISTSTPVMAPVHHSK---------------IPYSDVCNIFSEIESTSSRLSI 110

Query: 127 IKLCSEFFTKAMKQNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQ 186
           +K+CS FF   +KQN +NL+P+TYLFIN+LGPDY              KTI+ESCGKSLQ
Sbjct: 111 VKICSNFFYSVLKQNPSNLVPITYLFINRLGPDYEPGLELGLGEGLLMKTIAESCGKSLQ 170

Query: 187 QVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXX 246
           QV+  Y++IGDLG +A  AR VQPTMFKPKPLTVG VF NLK IAKS GKDSQ       
Sbjct: 171 QVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLI 230

Query: 247 XXXXTACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAE 306
               TAC+G+EAK+LIRSLESKLRIGLAEK+VLISLSKALL  E++   +P  EL+E AE
Sbjct: 231 KRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHDGE-EPSSELVENAE 289

Query: 307 QKIRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQN 366
           Q++RDAFCQ+PNYEIVIN+CL++GIM +++HC L+PGIPLKPMLAKP+K+I EV DRF  
Sbjct: 290 QRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHG 349

Query: 367 IHFTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDC 426
             FT EYKYDGERAQVHL+ DGSM IYSRNGENMTERYPE+++ D++ D   T SLI+DC
Sbjct: 350 EKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDC 409

Query: 427 EAVAWDREEKKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERRE 486
           EAVAWD E+ KILPFQ+LST               CLFAFD+LC+N + LIN SL ERRE
Sbjct: 410 EAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERRE 469

Query: 487 ILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRS 546
            L  V + V G+F +A EL+++NL+++Q +L+QSVKD+CEGLMVKVL+GE+SHYEPSKRS
Sbjct: 470 YLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRS 529

Query: 547 RNWLKLKKDYLDGVGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACKIGTG 606
           RNWLKLKKDYL GVGDSLDLCVLGA              LLGCYNQDTGEFET CKIGTG
Sbjct: 530 RNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTG 589

Query: 607 FSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGA 666
           FSDE+L SLY++LK ++++ PKA Y+YDSSA+PDVWFEPT+LFEVLTADLS+SPIYKAG 
Sbjct: 590 FSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGN 649

Query: 667 STYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHVAK 710
           S Y KGISLRFPRFIR+R+DK VE+ATSSEQI+ELYE+Q ++ K
Sbjct: 650 SAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNLQK 693

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/706 (59%), Positives = 506/706 (71%), Gaps = 26/706 (3%)

Query: 28  SNSKRQATLARFFTSIKPSADDQNXXXXXXXXXXXXXXXXXXXXXXXX----------XL 77
           S++K+QATLA+FF+S K S D++                                    L
Sbjct: 10  SSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHETL 69

Query: 78  KKPKLSP---------------IESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISS 122
           +KP+LS                +E S  D ++  +      ++ Y+++C +F EIE  SS
Sbjct: 70  QKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSVFNEIEGTSS 129

Query: 123 RLQIIKLCSEFFTKAMKQNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCG 182
           RLQI+KLCS+F    + +   +L+P+TYL INKLGPDY              KTISESCG
Sbjct: 130 RLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPGLELGLGEGLLMKTISESCG 189

Query: 183 KSLQQVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXX 242
           KSLQQVK  Y+++GDLG IA  AR+VQPTMFKPKPLT G VF NL+ IA++ GKDSQ   
Sbjct: 190 KSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQGKDSQLRK 249

Query: 243 XXXXXXXXTACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELI 302
                   TAC+G+EAK+LIRSLESKLRIGLAEKSVL++LSKA+L +E+    +P  +L+
Sbjct: 250 VQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGGK-EPSSDLV 308

Query: 303 EKAEQKIRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFD 362
           + AEQKIRDAFCQ+PNYEIVIN+ L++GIM L++HC L PGIPLKPMLAKP+K+I EV D
Sbjct: 309 DAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSKSISEVLD 368

Query: 363 RFQNIHFTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSL 422
           RFQ   FT EYKYDGERAQVHL+ DGSMRIYSRNGENMTERYPEIN++DF+   + T +L
Sbjct: 369 RFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVAHPDETHTL 428

Query: 423 IIDCEAVAWDREEKKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLR 482
           I+DCEAVAWD+++  ILPFQVLST               CLFAFDILC+NDE LINKSL 
Sbjct: 429 ILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEPLINKSLA 488

Query: 483 ERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEP 542
           ERR  L  + + V GE   A E++T +LDE+QL+LDQSVKD CEGLMVKVLDGE+SHYEP
Sbjct: 489 ERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEESHYEP 548

Query: 543 SKRSRNWLKLKKDYLDGVGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACK 602
           SKRSRNWLKLKKDYL GVGDSLDLCVLGA              LLGCYNQDTGEFET CK
Sbjct: 549 SKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCK 608

Query: 603 IGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIY 662
           IGTGFSDE+LQ+LY++L  T I  PKA Y+Y  SAQPDVW EP++LFEVLTADLS+SP+Y
Sbjct: 609 IGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTADLSLSPVY 668

Query: 663 KAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHV 708
           KAG S+Y KGISLRFPRFIR+R+DKSVE+ATSSEQ+IE YE+QSH+
Sbjct: 669 KAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/631 (62%), Positives = 471/631 (74%), Gaps = 1/631 (0%)

Query: 79  KPKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAM 138
           +P    + ++K D ++          I YA++C +F EIE  SSRLQI+KLC +F    +
Sbjct: 94  EPAKRAVAATKGDPAKLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVL 153

Query: 139 KQNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQQVKLDYKDIGDL 198
            +   +++P+TYL INKLGPDY              KTISESCGKSLQQ+K  Y+++GDL
Sbjct: 154 LKARKDIVPITYLLINKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQIKARYRELGDL 213

Query: 199 GTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXTACKGIEA 258
           G IA  AR VQPTMFKPKPLT G VF NL+ IA+S GKDSQ           TAC+G+EA
Sbjct: 214 GRIAQEARAVQPTMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEA 273

Query: 259 KYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRDAFCQIPN 318
           K+LIRSLESKLRIGLAEKSVL++LSKALL  E+N   +P  EL++ AEQKIRDAFCQ+PN
Sbjct: 274 KFLIRSLESKLRIGLAEKSVLVALSKALLTYEHNGK-EPSSELVDTAEQKIRDAFCQVPN 332

Query: 319 YEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGE 378
           Y+IVI + L++GIM LD+HC L PGIPLKPMLAKP+K+I EV DRFQ   FT EYKYDGE
Sbjct: 333 YQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGE 392

Query: 379 RAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKI 438
           RAQVHL+ DGSMRIYSRNGENMTERYPEI ++DFI D   T +LI+DCEAVAWD+E+  I
Sbjct: 393 RAQVHLLPDGSMRIYSRNGENMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTI 452

Query: 439 LPFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTREVHGE 498
           LPFQVLST               CLFAFDILC+NDE LI + L ERR  L      V GE
Sbjct: 453 LPFQVLSTRKRKGVAVEDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGE 512

Query: 499 FTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLD 558
              A E++T +LDELQ +LDQ+V+D CEGLMVK+L+GE+SHYEPSKRSRNWLKLKKDYL 
Sbjct: 513 LQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQ 572

Query: 559 GVGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDR 618
           GVGDSLDLCVLGA              LLGCYNQD+GE+ET CKIGTGFS+E+LQ+L+DR
Sbjct: 573 GVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDR 632

Query: 619 LKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFP 678
           L  T I  PKA Y++  SA PDVWFEPTLLFEVLTADLS+SP+YKAG S+Y KGISLRFP
Sbjct: 633 LSPTAIPTPKAFYVHSESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFP 692

Query: 679 RFIRLREDKSVEEATSSEQIIELYENQSHVA 709
           RFIRLR+DK+ EEATSSEQ++E YE+QSHV+
Sbjct: 693 RFIRLRDDKTPEEATSSEQVVEFYESQSHVS 723

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/627 (62%), Positives = 473/627 (75%), Gaps = 1/627 (0%)

Query: 82  LSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMKQN 141
           ++P +S     +    K +F  +IP+A++C  FQ IE  SSRL I  +CS+F    ++++
Sbjct: 74  ITPPKSRGETLTPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERD 133

Query: 142 TANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQQVKLDYKDIGDLGTI 201
             +L+P+TYLFI+KLGPDY              KTISE+CGKS+QQ++  Y++IGDLG I
Sbjct: 134 PESLVPITYLFIHKLGPDYEPGLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGEI 193

Query: 202 AMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXTACKGIEAKYL 261
           AM ARNVQPTMFKPKPLTVG VF NL  IAKS+GKDSQ           TACKG EAK+L
Sbjct: 194 AMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFL 253

Query: 262 IRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRDAFCQIPNYEI 321
           IRSLESKLRIGLAEK+VLIS+SKA+L +E+N   +P  E++E+AE  IRDAFCQ+PNYE+
Sbjct: 254 IRSLESKLRIGLAEKTVLISVSKAILTHEHNGQ-EPSTEMVEQAESLIRDAFCQVPNYEM 312

Query: 322 VINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQ 381
           +IN  L+YGIMNL++H  LRPGIPL+PMLAKPTK+I EV DRFQ   FT EYKYDGERAQ
Sbjct: 313 IINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQ 372

Query: 382 VHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPF 441
           VHL  DGSM+IYSRNGE+MTERYPEI+V  ++KDL  TKS I+D EAVAWD+E+ KILPF
Sbjct: 373 VHLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPF 432

Query: 442 QVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTY 501
           QVLST               CL+AFDILC NDE LINKS  ERR+IL        G+F +
Sbjct: 433 QVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDF 492

Query: 502 AKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVG 561
           A EL+T N DELQ +LDQSVKDSCEGLMVK+L+GE+SHYEPSKRSRNWLKLKKDYL+GVG
Sbjct: 493 ANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVG 552

Query: 562 DSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDRLKS 621
           DSLDL VLGA              LLGCYN D+ EFET CKIGTGFSDE+LQ LY +LK 
Sbjct: 553 DSLDLVVLGAYYGRGKRTGTYGGFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKD 612

Query: 622 TTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFI 681
           TT++ P    IYDSSA  DVWFEP++LFEVLTADLS+SP+YKAG   + KGISLRFPRF+
Sbjct: 613 TTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFV 672

Query: 682 RLREDKSVEEATSSEQIIELYENQSHV 708
           R+R+DK+V +ATSS+Q+IE YE+Q+H+
Sbjct: 673 RIRDDKNVTDATSSDQVIEFYESQAHM 699

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/716 (56%), Positives = 498/716 (69%), Gaps = 41/716 (5%)

Query: 21  IYSGIMSSN---SKRQATLARFFTSI---KPSADDQNXXXXXXXXXXXXXXXXXXXXXXX 74
           +Y+  MS++   SK+QATLARFFTS+    P A                           
Sbjct: 32  LYTRTMSNSLEPSKKQATLARFFTSMGKKTPPA-------------VEVATKQESPENHV 78

Query: 75  XXLKKPKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFF 134
              +K ++ P +S        +   +    + Y++VC LFQ+IE  SSRL IIKLCSEFF
Sbjct: 79  DKKRKVEVHPSQSVGASEKAESPPDQTKSTVLYSEVCNLFQQIEETSSRLAIIKLCSEFF 138

Query: 135 TKAMKQNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQQVKLDYKD 194
            + +K N +++I + YLFIN+LGPDY              KTISE+ GKS++Q+KL+ K+
Sbjct: 139 IRVIKNNPSDIIIVAYLFINRLGPDYEPGLELGLGENLLIKTISEAYGKSIKQIKLELKE 198

Query: 195 IGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXTACK 254
            GDLGTIA +ARN+QPTMFKPKPLT+  VF NLK IA ++GKDSQ           +A K
Sbjct: 199 TGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASK 258

Query: 255 GIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEY-----NNTLDPD----MELIEKA 305
           G+EAK+LIRSLESKLRIGLAEK+VLISLSKALL++E+      +  D +    M+LIE+A
Sbjct: 259 GLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQA 318

Query: 306 EQKIRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQ 365
           E K+R+A CQ+PNYEIVIN CL+ GI+N+D+ C+LRPGIPLKPMLAKPTK I EV + FQ
Sbjct: 319 EAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQ 378

Query: 366 NIHFTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFI------------ 413
              F SEYKYDGERAQVHL+  G MRIYSRNGENMTERYPE++V DF+            
Sbjct: 379 GKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEG 438

Query: 414 -KDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHN 472
              +   K +I+DCE VAWD E+KKILPFQVL+T               CLFAFD+L  N
Sbjct: 439 ENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLN 498

Query: 473 DEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKV 532
           +E +INKSLRER+EIL  VT  V GEF YA  L T+++DELQ FLDQ+VK+SCEGLMVK+
Sbjct: 499 NEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKM 558

Query: 533 LDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQ 592
           LDGE+SHYEPSKRSRNWLKLKKDYLDGVGDSLDL V+GA              LLGCYN+
Sbjct: 559 LDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNE 618

Query: 593 DTGEFETACKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVL 652
           DT EFET CKIGTGFSDE+L +L+  L+ T ID P  TYIYDSSA+PDVWF+  +LFEVL
Sbjct: 619 DTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVL 678

Query: 653 TADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHV 708
           TADLS+SP+YKAG S Y KGISLRFPRF+R+REDK V + T+SE IIE YE+QSH+
Sbjct: 679 TADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHI 734

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/683 (57%), Positives = 484/683 (70%), Gaps = 6/683 (0%)

Query: 30  SKRQATLARFFTSIKPSADDQNXXXXXXXXXXXXXXXXXXXXXXXXXLKKPKLSPIE-SS 88
           SK+Q TLARFF   +P  +++                           +K  + P E ++
Sbjct: 38  SKKQVTLARFFAKREPKDEEKQSSSPVKEQVQIQGQPQQEQVKIQPQEQKQIVVPQEVTT 97

Query: 89  KTDSSETTVKQE-FVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMKQNTANLIP 147
            T +   T K +     +PYAD+C LF+ IE+ SSRL I  LC+ FF++ ++ + + L+P
Sbjct: 98  STQTPRPTKKSKPATSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLDPSLLVP 157

Query: 148 LTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQQVKLDYKDIGDLGTIAMNARN 207
           +TYL INKLGPDY              K I  +CG S QQ+KL Y+ +GDLG +AM+ R 
Sbjct: 158 VTYLCINKLGPDYSGVELGLGEGLLL-KAIGSACGVSQQQLKLQYRKLGDLGQLAMSTRV 216

Query: 208 VQPT--MFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXTACKGIEAKYLIRSL 265
           +QPT  MFK +PLT+  VF  L  IA S GKDSQ           T+C+G+EAK+LIRSL
Sbjct: 217 LQPTITMFKLEPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGVEAKFLIRSL 276

Query: 266 ESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRDAFCQIPNYEIVINS 325
           ESKLRIGLAEK+VL SL++AL+I+E  N    D +    AEQ I+D+FCQIPNYEI+I +
Sbjct: 277 ESKLRIGLAEKTVLTSLARALVIHEKGNDNIQDDDY-SNAEQIIKDSFCQIPNYEIIITT 335

Query: 326 CLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLM 385
            L+YG+  L  H  L PGIPLKPMLAKPTK+I EV D FQNI FTSEYKYDGERAQVHL+
Sbjct: 336 SLQYGVSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLL 395

Query: 386 NDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLS 445
            DGSMRIYSRNGE+MT+RYPE+N+ D++ D   T  LI+DCEAVAWD E +KILPFQVLS
Sbjct: 396 PDGSMRIYSRNGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLS 455

Query: 446 TXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKEL 505
           T               CLFAFDIL HN++ LIN +LRERR+ILHS+T+   G+F +A EL
Sbjct: 456 TRKRKSVDLKDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATEL 515

Query: 506 STNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLD 565
           +T+NLDELQ FLD+++KDSCEGLMVK LDG DSHYEPSKRSRNWLKLKKDYL G+GDSLD
Sbjct: 516 TTSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLD 575

Query: 566 LCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDRLKSTTID 625
           LCVLGA              LL CYNQDT EFET CKIGTGFSDE+LQ+LY+ LK T I+
Sbjct: 576 LCVLGAYYGRGKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYNGLKETAIE 635

Query: 626 GPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLRE 685
            P+A +++DSSA+PDVWF PT++FEVLTADLS+SPIYKAG++ Y KGISLRFPRFIR+R 
Sbjct: 636 SPRANFVFDSSAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRFPRFIRIRT 695

Query: 686 DKSVEEATSSEQIIELYENQSHV 708
           DKSV +ATSSEQ+I+ YENQSH+
Sbjct: 696 DKSVNDATSSEQVIDFYENQSHL 718

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/694 (55%), Positives = 473/694 (68%), Gaps = 15/694 (2%)

Query: 28  SNSKRQATLARFFTSIKPSADDQNXXXXXXXXXXXXXXXXXXXXXXXXXLKK----PKLS 83
           S  K+QATL RFFT++K   D                             +     P+L+
Sbjct: 2   SAPKKQATLGRFFTALKRPQDGATAAATVKKSKVEAAECLAAPAGHEQDAEVKNSLPELA 61

Query: 84  ---------PIESSKTDSSETT-VKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEF 133
                    P  +S    ++++ VK      + YAD+C +F+ +E  SSRL I KLC++F
Sbjct: 62  DKPAPGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCADF 121

Query: 134 FTKAMKQNTANLIPLTYLFINKLGPDYXXXXXXXXXXXXXXKTISESCGKSLQQVKLDYK 193
               +K +  +LIP+TYLFIN+LGPDY              KTIS++CGKS  QV+  Y+
Sbjct: 122 MYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKTISDACGKSAAQVRSSYR 181

Query: 194 DIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQXXXXXXXXXXXTAC 253
           + GDLGT+A  AR VQPTMFKPKPLTV  VF  L+ IA++ GKDSQ           TAC
Sbjct: 182 ECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTAC 241

Query: 254 KGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRDAF 313
           +G+EAKYLIRSLESKLRIGLAEK+VL++LSKA+L +E++   +P  E ++ AE  +RD F
Sbjct: 242 QGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGK-EPSPEQVDAAEALVRDTF 300

Query: 314 CQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEY 373
           CQ+PNYE++IN+ L+YGIMNL +HC L PGIPLKPMLAKPTK+I EV DRFQ   FT EY
Sbjct: 301 CQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEY 360

Query: 374 KYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDR 433
           KYDGERAQVHLM DG++RIYSRN ENMTERYPEI    F+ +   T+SLIIDCEAVAWD 
Sbjct: 361 KYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDN 420

Query: 434 EEKKILPFQVLSTXXXXXXXXXXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTR 493
           E++KILPFQVLST               CLFAFD+L  N E L+  SL +RR+ L+SV +
Sbjct: 421 EKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLK 480

Query: 494 EVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLK 553
            V GE  +A E++T  L ELQ +L+QSV  SCEGLMVK+LDGE+S YEPSKRSRNWLKLK
Sbjct: 481 VVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLK 540

Query: 554 KDYLDGVGDSLDLCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFETACKIGTGFSDEVLQ 613
           KDYL+GVGDSLDL VLGA              LLGCYN D  EFET CKIGTGFS+EVLQ
Sbjct: 541 KDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLEEFETCCKIGTGFSEEVLQ 600

Query: 614 SLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGI 673
           SL+ +LK T I  P+    YD S+ PDVWFEP +LFEVLTADLS+SP+YKAG   Y KGI
Sbjct: 601 SLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGI 660

Query: 674 SLRFPRFIRLREDKSVEEATSSEQIIELYENQSH 707
           SLRFPRF+R+REDKSV +ATSS+QI+E Y+ Q++
Sbjct: 661 SLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 109/421 (25%), Positives = 169/421 (40%), Gaps = 63/421 (14%)

Query: 346 LKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIYSRNGENMTERY 404
            +P LAK      EV  R  N  FT E K DGER Q+H M+ G  ++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 405 PEINVTDFI-KDLNL---TKSLIIDCEAVAWDREEKKILPFQVLSTXXXXXXXXXXXXXX 460
            +   T  I K L L    K  I+D E V++D+    ILPF ++ +              
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 461 XC---LFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQLFL 517
            C      FD+L  N   L N  L +R+E L ++           K    ++ + ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 518 DQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAXXXXXX 577
             ++    EG+   VL   DS Y    R+ +W+K+K +YL+  G++LDL V+G       
Sbjct: 444 QAAISVGSEGI---VLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGRDPGKKD 500

Query: 578 XXXXXXXXL----------------LGCYNQDT---------------GEFETACKIGTG 606
                   L                L   + D+                +F + C I  G
Sbjct: 501 SLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISFCVIANG 560

Query: 607 FSDEVLQSLYDR-----LKSTTIDGPKATYIYDSSAQPDVWFEP--TLLFEVLTADLSMS 659
            S+E  + + DR      K  + + P   Y+   +  P  W  P  +++ EV    L  +
Sbjct: 561 ISNEEFKEI-DRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVKARSLENN 619

Query: 660 PIYKAGASTYSKGISLRFPRFIRLREDKSVEEA-TSSEQII---------ELYENQSHVA 709
              +A    +  G +L      R+R DK   +  T S+ +I         ELY N SH+ 
Sbjct: 620 ---EALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKKRSSSELYGNHSHIK 676

Query: 710 K 710
           K
Sbjct: 677 K 677

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 116/244 (47%), Gaps = 11/244 (4%)

Query: 335 DEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIY 393
           ++  +++ G    P LAK      E   R  +  F  E K DGER QVH MN G S+R Y
Sbjct: 243 NDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFY 302

Query: 394 SRNGENMTERY-PEINVTDFIKDLNLTKSL---IIDCEAVAWDREEKKILPFQVL--STX 447
           SR G + T  Y   ++       L+ T ++   ++D E V +D   K ILPF ++  S  
Sbjct: 303 SRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAK 362

Query: 448 XXXXXXXXXXXXXXCLFA-FDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELS 506
                          L+  FD+L  N   L    L +R+E L S+   V       +   
Sbjct: 363 DALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSR 422

Query: 507 TNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDL 566
             N++ ++  L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL
Sbjct: 423 CYNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDL 479

Query: 567 CVLG 570
            ++G
Sbjct: 480 VIIG 483

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 110/240 (45%), Gaps = 11/240 (4%)

Query: 339 SLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIYSRNG 397
           S++ G    P LAK      +      N  F  E K DGER Q+H MN G +++ +SR+G
Sbjct: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHG 327

Query: 398 ENMTERY----PEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTXXXXXXX 453
            + T  Y        +  F++     K  ++D E V +D   KK+LPF ++ +       
Sbjct: 328 TDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLN 387

Query: 454 XXXXXXXX---CLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNL 510
                          FDIL  N   LI+  L +R+E L++V             +   + 
Sbjct: 388 KKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDS 447

Query: 511 DELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLG 570
            +++  LD ++    EG+   VL    S Y P+ R  NW+K+K +YL+  G+++DL V+G
Sbjct: 448 IQIKKGLDAAISVGSEGI---VLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIVIG 504

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 93/381 (24%), Positives = 159/381 (41%), Gaps = 48/381 (12%)

Query: 343 GIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGS-MRIYSRNGENMT 401
           G+   P LA       +         F  E K DGER Q+H  N GS ++ YSR   + T
Sbjct: 266 GLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYT 325

Query: 402 ERYPEINVTDFIKD-LNLTKSL---IIDCEAVAWDREEKKILPFQVLSTXXXXXXXXXXX 457
             Y     T  + + +NL K++   ++DCE V +D   K +LPF ++ +           
Sbjct: 326 YLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGI 385

Query: 458 XXXX---CLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQ 514
                   L  FD+L  N   L++    +RRE L  +           K +  N+   ++
Sbjct: 386 DTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIK 445

Query: 515 LFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAXXX 574
             L++++    EG+++K  D   S Y  + RS +W+K+K +YL+  G+++DL ++G    
Sbjct: 446 KSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLMG---- 498

Query: 575 XXXXXXXXXXXLLGC-------------YNQDTGE--------FETACKIGTGFSDEVLQ 613
                      +LG               N  + E        F + C I  G S+E  +
Sbjct: 499 --RDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYK 556

Query: 614 SLYDRLKSTTIDG---PKATYIYDSSAQPDVWFEP--TLLFEVLTADLSMSPIYKAGAST 668
            +  + K    D    P   Y+   S  P  W +P  +L+ E+    L  +   ++    
Sbjct: 557 EIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT---RSSERK 613

Query: 669 YSKGISLRFPRFIR-LREDKS 688
           ++ G +L F  + R +REDK+
Sbjct: 614 FAAGCTL-FGGYCRQIREDKN 633

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 99/417 (23%), Positives = 173/417 (41%), Gaps = 61/417 (14%)

Query: 335 DEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIY 393
           D+  S++ G    P LAK      E   R  +  F  E K DGER QVH MN G S++ +
Sbjct: 243 DDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFF 302

Query: 394 SRNGENMTERY----PEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVL--STX 447
           SR G + T  Y        ++  ++  +  K  ++D E V +D + + ILPF ++  S  
Sbjct: 303 SRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAK 362

Query: 448 XXXXXXXXXXXXXXCLF-AFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELS 506
                          L+  FD+L  N   L    L +R++ L+S+   +       +   
Sbjct: 363 EALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSR 422

Query: 507 TNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDL 566
              ++ ++  L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL
Sbjct: 423 CYGVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDL 479

Query: 567 CVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFE---------------------------- 598
            V+G               +LG    D  E++                            
Sbjct: 480 IVIG------RDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKK 533

Query: 599 --TACKIGTGFSDEVLQSLYDR-----LKSTTIDGPKATYIYDSSAQPDVWFEP--TLLF 649
             + C I  G S E  + + DR      K T+   P A+ +   S  P  W +P  +++ 
Sbjct: 534 ILSFCSIANGISQEEFKEI-DRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVL 592

Query: 650 EVLTADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQS 706
           E+ +  L  +   +     Y+   +L      R+R DK   E T    + +LYE+++
Sbjct: 593 EIKSRSLDNT---ETNMQKYATNCTLYGGYCKRIRYDK---EWTDCYTLNDLYESRT 643

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 115/244 (47%), Gaps = 11/244 (4%)

Query: 335 DEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGS-MRIY 393
           +E  +L+ G    P LAK      E   +     F+ E K DGER Q+H M+ G+ ++  
Sbjct: 244 NEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFL 303

Query: 394 SRNGENMTERYPEINVTD----FIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTXXX 449
           SR G + T  Y     T     ++K     K  I+D E V +D+E++ ILPF ++ +   
Sbjct: 304 SRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAK 363

Query: 450 XXXXXXXXXXXX---CLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELS 506
                             AFD++  N   L++  L +R++ L  +  + +G         
Sbjct: 364 NFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFAR 423

Query: 507 TNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDL 566
            NNL+ +   L  ++    EG+++K L+   S Y  + R+ +W+K+K  YL   G+++DL
Sbjct: 424 CNNLESITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWIKIKPQYLKQFGENMDL 480

Query: 567 CVLG 570
            ++G
Sbjct: 481 IIIG 484

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 111/242 (45%), Gaps = 13/242 (5%)

Query: 339 SLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIYSRNG 397
           S+R G    P +A+  K   E         F  E K DG+R QVH M+ G S+  +SRNG
Sbjct: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346

Query: 398 ENMTERYPE----INVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTXXXXXXX 453
            N T  Y E     ++++ +K +   K  I+D E V++D+E + ILPF +  +       
Sbjct: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406

Query: 454 XXXXXXXXCLF-----AFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTN 508
                     +      FD+L  N + L N+ + +R+E L  +                +
Sbjct: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466

Query: 509 NLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCV 568
           + + +   L  +V    EG+   VL    S Y   KR  +W+K+K +YL+  G+++DL V
Sbjct: 467 DAEAITAALGAAVAHGSEGI---VLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523

Query: 569 LG 570
           +G
Sbjct: 524 IG 525

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 112/244 (45%), Gaps = 11/244 (4%)

Query: 335 DEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIY 393
           ++  S++ G    P LAK      E   R  +  F  E K DGER QVH MN G S++ +
Sbjct: 243 NDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFF 302

Query: 394 SRNGENMTERY----PEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTXXX 449
           SR G + T  Y        ++ ++K  N  K  ++D E V +D   K ILPF ++     
Sbjct: 303 SRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAK 362

Query: 450 XXXX---XXXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELS 506
                              FD+L  N+  L    L +R++ L S+           +   
Sbjct: 363 GVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTR 422

Query: 507 TNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDL 566
             ++  ++  L+ ++    EG+++K  +   S Y  + R+ NW+K+K +YL+  G++LDL
Sbjct: 423 CYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDL 479

Query: 567 CVLG 570
            ++G
Sbjct: 480 IIIG 483

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 95/398 (23%), Positives = 160/398 (40%), Gaps = 45/398 (11%)

Query: 343 GIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIYSRNGENMT 401
           G+P  P LAK      +         F  E K DGER Q+H M+ G  ++ +SR G + T
Sbjct: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDYT 312

Query: 402 ERYPE-INVTDFIKDLNL---TKSLIIDCEAVAWDREEKKILPFQVLSTXXXXXXXXXXX 457
             Y E I      K L L    +  ++D E +++D EE  +LPF ++ +           
Sbjct: 313 YLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGI 372

Query: 458 XXXX---CLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQ 514
                       D L  N   LIN  L  R++ L ++           + +   +   ++
Sbjct: 373 LTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIK 432

Query: 515 LFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAXXX 574
             L++++    EG+++K      S YE   R+ NW+K+K +YL+  G++LDL V+G    
Sbjct: 433 SSLEKAIMMGSEGIILKHFK---SKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPG 489

Query: 575 XXXXXXXXXXXLLG-----------CYNQDTGE----------FETACKIGTGFSDEVLQ 613
                      L G             N D+ E          F + C I  G S E  +
Sbjct: 490 KKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEFK 549

Query: 614 SL----YDRLKSTTIDGPKATYIYDSSAQPDVWFEP--TLLFEVLTADLSMSPIYKAGAS 667
            +      + K+T    P     +  S  P+ W  P  +++ EV    L  +   ++   
Sbjct: 550 QIERKTAGKWKNTEDHKPPKILEF-GSKLPEEWIYPEDSVVLEVKARSLDNT---ESSGR 605

Query: 668 TYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQ 705
            +  G +L      R+REDK+  E  +   + EL++ +
Sbjct: 606 KFKVGCTLHGGYCRRIREDKNWTECYT---LYELWQER 640

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 103/415 (24%), Positives = 168/415 (40%), Gaps = 58/415 (13%)

Query: 335 DEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIY 393
           ++  S++ G    P LAK      E         F  E K DGER QVH MN G S++ +
Sbjct: 243 NDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFF 302

Query: 394 SRNGENMTERYPEIN-----VTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVL--ST 446
           SR G + T  Y  +N     ++ ++K  +  K  ++D E V +D   K ILPF ++  S 
Sbjct: 303 SRRGIDYTYLY-GVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSA 361

Query: 447 XXXXXXXXXXXXXXXCLF-AFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKEL 505
                           L+  FD+L  N   L    L +R+E L S+           +  
Sbjct: 362 KEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYS 421

Query: 506 STNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLD 565
              + + ++  L+ ++    EG+   VL    S Y  + R+ NW+K+K +YL+  G++LD
Sbjct: 422 RCYDAESVKKSLEVAISLGSEGV---VLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLD 478

Query: 566 LCVLGAXXXXXXXXXXXXXXLLGCYNQDTGEFE--------------------------- 598
           L ++G               LL    Q+TG+ +                           
Sbjct: 479 LIIIG---RDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKV 535

Query: 599 -TACKIGTGFSDEVLQSLYDR-----LKSTTIDGPKATYIYDSSAQPDVWFEP--TLLFE 650
            + C I  G S E  + + DR      K T+   P  + +   S  P  W EP  +++ E
Sbjct: 536 LSFCSIANGISQEEFKEI-DRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLE 594

Query: 651 VLTADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQ 705
           + +  L  +   +     Y+   +L      R+R DK   E  + +   ELYEN+
Sbjct: 595 IKSRSLDNT---ETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLD---ELYENR 643

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 89/373 (23%), Positives = 156/373 (41%), Gaps = 37/373 (9%)

Query: 346 LKPMLAKPTKTIME-VFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIYSRNGENMTER 403
            +P LAK T    E V  + Q+  F  E K DGER Q+H +N G  ++  SR G + +  
Sbjct: 247 FEPQLAKRTHLSYERVASKLQH-DFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYL 305

Query: 404 YPEINVTDFIK-DLNL---TKSLIIDCEAVAWDREEKKILPFQVLSTXXXXXXXXX---- 455
           Y E + +  I   L L    K  I+D E + +D E+  +LPF ++ +             
Sbjct: 306 YGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGI 365

Query: 456 --XXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDEL 513
                      AFD++  N + L N +L  R++ L  +   V       + +   N + +
Sbjct: 366 APTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAI 425

Query: 514 QLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAXX 573
           +  L+Q++    EG+++K L    S Y    R+ +W+K+K +YL+  G+++DL ++G   
Sbjct: 426 KDSLEQAISMGSEGIVLKHLH---SKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIG--- 479

Query: 574 XXXXXXXXXXXXLLGCYNQDTGE------FETACKIGTGFSDEVLQSL----YDRLKSTT 623
                         G    D  E      F + C I  G S+E  + +    + +    +
Sbjct: 480 ---REQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFS 536

Query: 624 IDGPKATYIYDSSAQPDVWFEP--TLLFEVLTADLSMSPIYKAGASTYSKGISLRFPRFI 681
            D P    +   +  P  W  P  +++ EV    +      ++    Y  G +L F    
Sbjct: 537 EDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCK 593

Query: 682 RLREDKSVEEATS 694
           ++R DK  +   S
Sbjct: 594 QIRYDKDWKTVAS 606

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 113/241 (46%), Gaps = 15/241 (6%)

Query: 340 LRPGIPLKPMLAKPTKTIME-VFDRFQNIHFTSEYKYDGERAQVHLMNDGS-MRIYSRNG 397
           + PG    P LAK      E +  + +N  F  E K DGER Q+H  + G  ++ +SR G
Sbjct: 256 INPGFAFAPQLAKKLSISYEKICMKLKN-DFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314

Query: 398 ENMTERYPEINVTDFI-KDLNLTKSL---IIDCEAVAWDREEKKILPFQVLSTXXXXXXX 453
            + T  Y E     FI K L L K +   I+D E + +D+ +  ILPF ++ +       
Sbjct: 315 TDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374

Query: 454 X---XXXXXXXCLFAFDILCHNDEKLINKSLRERREILHSV-TREVHGEFTYAKELSTNN 509
                          FD++  N   L N  L  R+E L+ + T E H            N
Sbjct: 375 KDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPH-IIELLSSYHRFN 433

Query: 510 LDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVL 569
            D ++  L+ ++    EG+++K  D   S Y  + R+ +W+K+K +YL+  G+++DL V+
Sbjct: 434 EDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490

Query: 570 G 570
           G
Sbjct: 491 G 491

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 88/394 (22%), Positives = 157/394 (39%), Gaps = 47/394 (11%)

Query: 339 SLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGS-MRIYSRNG 397
           S+  G    P LAK      E         F  E K DGER Q+H +N GS ++  SR G
Sbjct: 258 SINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRG 317

Query: 398 ENMTERYPE----INVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTXXXXXXX 453
            + +  Y +      ++ ++K  +  +  ++D E V++D++ K ILPF ++ +       
Sbjct: 318 IDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELI 377

Query: 454 XXXXXXXX-----CLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTN 508
                            FD++  N   L    L  R+E L  +   V       K +   
Sbjct: 378 NSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRAC 437

Query: 509 NLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCV 568
           +   ++ F+ ++++   EG++VK      S YE   R+ +W+K+K +Y + +G+++DL V
Sbjct: 438 DAKAIKNFMQRAIEMGSEGVIVK---QASSTYEVGARNDHWVKIKPEYFEDLGETMDLVV 494

Query: 569 LGAXXXXXXXXXXXXXXLLGCYNQDT-------GEFETA------------CKIGTGFSD 609
           +G               + G    D+       G  E              C +  G SD
Sbjct: 495 IG------RDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSD 548

Query: 610 EVLQSLYDRLKSTTID----GPKATYIYDSSAQPDVWFEP--TLLFEVLTADLSMSPIYK 663
           E  + +  + + + +      P  + +   S  P  W +P  +++ EV    +  S   +
Sbjct: 549 EEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---E 605

Query: 664 AGASTYSKGISLRFPRFIRLREDKSVEEATSSEQ 697
             +  Y  G +L      R+R DK     TS  Q
Sbjct: 606 YSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 90/413 (21%), Positives = 159/413 (38%), Gaps = 55/413 (13%)

Query: 339 SLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGS-MRIYSRNG 397
           S+  G    P LAK      E      N  F  E K DGER QVH M+ G+ +R  SR G
Sbjct: 264 SINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRG 323

Query: 398 ENMTERYPE----INVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTXXXXXXX 453
            + T+ Y E      V +++   +  +  ++D E + +D +   +LPF ++ +       
Sbjct: 324 VDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALS 383

Query: 454 XX---XXXXXXCLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTNNL 510
                       L   D++  N   LI   L +R+E L+ V +           +  +  
Sbjct: 384 TEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEH 443

Query: 511 DELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLG 570
             ++  L++S+    EG+   VL    + YE   R+  W+K+K +YL+  G++LDL ++G
Sbjct: 444 TAIRKSLEKSISMGSEGI---VLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIG 500

Query: 571 AXXXXXXXXXXXXXXLLGCYNQDTGEFETA------------------------------ 600
                            G   +D  E E                                
Sbjct: 501 RTPGKKDSLMCGLAVYEG--EEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISF 558

Query: 601 CKIGTGFSDEVLQSLYDRLKSTTIDG----PKATYIYDSSAQPDVWFEP--TLLFEVLTA 654
           C I  G S +  + +  + +   +      P A  +   S  P+ W +P  +++ EV   
Sbjct: 559 CVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKAR 618

Query: 655 DLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSH 707
            L  +   ++    ++ G +L      R+R+DK   + T      EL++ + H
Sbjct: 619 SLDNT---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 113/244 (46%), Gaps = 13/244 (5%)

Query: 336 EHCSLRPGIPLKPMLAKP-TKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGS-MRIY 393
           +  S+  G    P LAK  + +  ++  + +N  F  E K DGER Q+H M+ G+ ++  
Sbjct: 244 DELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFL 302

Query: 394 SRNGENMTERYPEI----NVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTXXX 449
           SR G + T  Y E      +  ++K     K  ++D E V +D ++  +LPF ++ +   
Sbjct: 303 SRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAM 362

Query: 450 XXXXXXXXXXXX---CLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELS 506
                           L  FD++  N   L+   L +R++ L SV               
Sbjct: 363 NALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTR 422

Query: 507 TNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDL 566
            +N + ++  L+ ++    EG+   VL   +S Y    R+ +W+K+K +YL+  G+++DL
Sbjct: 423 CSNENIIRKSLEHAISVGSEGI---VLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDL 479

Query: 567 CVLG 570
            V+G
Sbjct: 480 IVIG 483

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 117/261 (44%), Gaps = 17/261 (6%)

Query: 320 EIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGER 379
           E + N  ++ G   L    S+  G    P LAK      E         F  E K DGER
Sbjct: 257 ETLWNPTMRLGKNEL----SINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312

Query: 380 AQVHLMNDGS-MRIYSRNGENMTERYPEI----NVTDFIKDLNLTKSLIIDCEAVAWDRE 434
            Q+H +  G+ +R  SR G + T  Y +      ++  +K  N  +  ++D E V++D+E
Sbjct: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372

Query: 435 EKKILPFQVLSTXXXXXXXXXXXXXXX-----CLFAFDILCHNDEKLINKSLRERREILH 489
           +  +LPF ++ +                        FD++  N   L    L  R+  L 
Sbjct: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432

Query: 490 SVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNW 549
           S+   V        ++  +  + +++ L+++++   EG+++K      S YE   R+ +W
Sbjct: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSW 489

Query: 550 LKLKKDYLDGVGDSLDLCVLG 570
           +K+K +Y + +G+++DL V+G
Sbjct: 490 IKIKPEYFEELGETMDLVVIG 510

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 120/271 (44%), Gaps = 15/271 (5%)

Query: 310 RDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHF 369
           +D    + + + V N      +   ++  ++  G P  P  AK      E         F
Sbjct: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293

Query: 370 TSEYKYDGERAQVHLMNDGS-MRIYSRNGENMTERYPEI----NVTDFIKDLNLTKSLII 424
             E K DGER Q+H  + G+ +   SR G + T  Y E      V+ ++   N  ++ ++
Sbjct: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVL 353

Query: 425 DCEAVAWDREEKKILPFQVLSTXXXXXXXXXXXXXXX---CLFAFDILCHNDEKLINKSL 481
           D E V +D+E   +LPF ++ +                   L  FD++  N   L+N  L
Sbjct: 354 DGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPL 413

Query: 482 RERREILHSV-TREVH-GEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSH 539
            +R+  L  + T E H  E   +K  S      ++  L+ ++    EG+   VL   +S 
Sbjct: 414 YQRKLYLEKIFTPERHIVELLRSKRCSDER--SIKNALEHAISIGSEGV---VLKHYNSR 468

Query: 540 YEPSKRSRNWLKLKKDYLDGVGDSLDLCVLG 570
           Y  + R+ +W+K+K +YL+  G+++DL V+G
Sbjct: 469 YTVASRNDDWIKVKPEYLEQFGENMDLIVIG 499

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 103/216 (47%), Gaps = 12/216 (5%)

Query: 363 RFQNIHFTSEYKYDGERAQVHLMNDGS-MRIYSRNGENMTERYPEINVTDFI-KDLNLTK 420
           R +N  F  E K DGER Q+H MN G+ ++  SR G + +  Y +      I + LN  K
Sbjct: 294 RLKNDFFIEE-KMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGAIGRYLNFHK 352

Query: 421 SL---IIDCEAVAWDREEKKILPFQVLSTXXXXXXXXXXXX---XXXCLFAFDILCHNDE 474
            +   I+D E V +D  +  ILPF ++ +                     AFD++  N  
Sbjct: 353 DVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMAFDLVYLNGS 412

Query: 475 KLINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLD 534
            L    L +R+  L  +             L  N+   ++  L+++++   EG+++K  D
Sbjct: 413 SLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGSEGIILKRFD 472

Query: 535 GEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLG 570
              S Y  +KRS +W+K+K +YL+  G+++DL V+G
Sbjct: 473 ---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIG 505

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 287 LINEYNNTLDPDMELIEKAEQKIRDAFCQIPNYEIVINSCLKYGIMN-LDEHCSLRPGIP 345
           LIN +NNT D  + +I    +KI   F +  NY++V+   LK  + N ++E   LRPG  
Sbjct: 322 LINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPG-- 379

Query: 346 LKPMLAKPTKT 356
             P++  P  T
Sbjct: 380 --PLVGTPMTT 388

>KLTH0E11352g Chr5 (1014490..1017447) [2958 bp, 985 aa] {ON} similar
           to uniprot|P48526 Saccharomyces cerevisiae YPL040C ISM1
           Mitochondrial isoleucyl-tRNA synthetase null mutant is
           deficient in respiratory growth
          Length = 985

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 605 TGFSDEVLQSLY-DRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYK 663
           +G +  VL+  Y  RLK T +  P A    + S Q   WF+ +LL ++ T++ + +P   
Sbjct: 578 SGSTWNVLEDFYTQRLKLTEMPYPLADVYLEGSDQHRGWFQSSLLTKIATSEQAAAPY-- 635

Query: 664 AGASTYSKGISLRFPRFIRLREDKSVEEATSSEQII 699
              +  + G +L   R I++   KS+    S E +I
Sbjct: 636 --GTVITHGFTLD-ERGIKM--SKSIGNTISPETVI 666

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,560,757
Number of extensions: 2610130
Number of successful extensions: 7351
Number of sequences better than 10.0: 42
Number of HSP's gapped: 7473
Number of HSP's successfully gapped: 42
Length of query: 710
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 593
Effective length of database: 40,065,477
Effective search space: 23758827861
Effective search space used: 23758827861
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)