Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A052406.45ON55355324950.0
ZYRO0C07194g6.45ON55844110261e-133
TDEL0G042506.45ON51755610061e-130
YOL013C (HRD1)6.45ON5515799661e-124
Suva_15.1596.45ON5504459531e-122
Skud_15.1486.45ON5484399441e-121
Smik_15.1576.45ON5505789431e-120
CAGL0E02299g6.45ON5454489111e-116
TPHA0F024806.45ON6054379131e-115
KNAG0E027406.45ON5564628941e-113
SAKL0E01958g6.45ON5245598831e-112
Kpol_1035.506.45ON6014108821e-111
TBLA0B005606.45ON4924328591e-108
NCAS0D020106.45ON5104348501e-107
NDAI0C027706.45ON6304588421e-104
KLTH0C10604g6.45ON5155537573e-93
Kwal_56.225226.45ON5134467495e-92
KLLA0C05874g6.45ON5534485422e-61
Ecym_30486.45ON6704114651e-49
ACL019C6.45ON5754414391e-46
AFR275W2.545ON753721296e-07
Suva_11.1892.545ON758731271e-06
Ecym_42508.317ON6571831251e-06
CAGL0L01947g2.545ON757651252e-06
SAKL0A09812g2.545ON751651252e-06
TDEL0B063402.545ON762651243e-06
Skud_11.1922.545ON758651233e-06
YKL034W (TUL1)2.545ON758651233e-06
Smik_11.2132.545ON759651216e-06
NCAS0A047602.545ON7611181216e-06
KAFR0B014602.545ON761651207e-06
KLLA0F25674g2.545ON757661181e-05
TBLA0I014902.545ON750651171e-05
KLTH0G12408g8.317ON603651172e-05
Kpol_1002.72.545ON754811172e-05
TPHA0C042602.545ON757651172e-05
KLLA0E04071g8.317ON704751162e-05
KLTH0D07216g2.545ON747701134e-05
ZYRO0E05632g2.545ON765651126e-05
Ecym_72412.545ON758671119e-05
Kwal_26.80992.545ON750651082e-04
KNAG0A070902.545ON762651082e-04
Kwal_27.105463.279ON10477973e-04
NCAS0C033108.317ON5701171063e-04
NDAI0K018102.545ON762621054e-04
Kpol_1052.193.279ON10379947e-04
AGR034W3.279ON15932960.001
KAFR0B030708.317ON643411000.001
CAGL0E01441g8.317ON717291000.002
TPHA0C008508.317ON78146980.003
TDEL0D034603.279ON14438910.004
Skud_2.1863.279ON17828920.004
KLTH0C05258g3.279ON15228910.005
Suva_4.3023.279ON15028910.005
SAKL0G07370g5.628ON32190950.005
SAKL0D03058g3.279ON15573910.005
Skud_4.4028.317ON61237950.007
NDAI0A074503.279ON173100910.007
YBR062C3.279ON18028910.007
NDAI0H008405.628ON34168930.008
Smik_4.3878.317ON63437940.010
TBLA0A096405.628ON325108920.010
KNAG0G023908.317ON68829930.011
Kwal_56.239008.317ON58937930.011
Suva_2.3048.317ON62437930.012
YDR143C (SAN1)8.317ON61029920.014
AER390W5.628ON31629910.016
CAGL0M08690g5.628ON32829910.016
ZYRO0C11176g5.628ON36829910.017
TDEL0F02870na 1ON260119900.018
CAGL0K02563g2.542ON58630910.020
TBLA0B087103.28ON12273840.022
Kpol_526.345.628ON32829890.022
NDAI0D02810na 1ON252107880.023
YDR265W (PEX10)5.628ON33729890.025
SAKL0H17116gsingletonON54437900.027
KLTH0E02464g5.628ON32929890.027
KAFR0H005605.628ON32735890.028
Ecym_13285.628ON32029880.033
NCAS0A113503.405ON42869880.034
KLLA0E16677g5.628ON30529880.036
CAGL0B05049g1.389ON147027890.038
Kpol_1036.668.317ON66831880.040
TPHA0A039903.279ON17528850.040
KNAG0A012803.28ON11473820.040
NDAI0G026308.317ON66129880.046
CAGL0H10274g3.279ON17528840.047
SAKL0H15686g8.317ON59937880.048
ABR104W3.405ON32829870.048
Kwal_55.199995.628ON15236830.048
Smik_2.1963.279ON18532840.054
ZYRO0E06996g3.279ON172138830.063
Skud_4.5285.628ON33729860.068
Suva_2.4335.628ON33729850.078
Smik_4.5165.628ON33729850.081
ZYRO0D05830g8.317ON78029860.088
KAFR0A019902.542ON56030850.091
Ecym_26583.279ON15928810.096
Ecym_54453.405ON32135840.11
KNAG0I013801.389ON149326850.13
TBLA0G023102.542ON67430840.13
TPHA0A033403.405ON38456830.15
TPHA0C003505.628ON27835820.15
TDEL0A004703.28ON11873780.15
NCAS0A04680singletonON27427810.19
TPHA0C042502.542ON55626830.19
TDEL0A049405.628ON32629820.19
KNAG0C056602.542ON50730820.21
TPHA0P014703.28ON11173760.22
TBLA0C013301.389ON145229830.23
KLLA0C15697g3.405ON30447810.23
SAKL0G13134g5.190ON193773820.25
KLLA0F18458g3.279ON14028770.25
KNAG0J008503.279ON16228780.26
NCAS0C052905.628ON33029810.27
Kpol_1002.82.542ON55826810.28
ZYRO0C03058g3.28ON11673760.29
NDAI0B018202.542ON62526810.30
NCAS0A082803.279ON11838760.31
Kpol_1014.163.28ON10773750.32
Suva_8.422.542ON58526810.33
Kwal_55.220543.28ON11164750.33
ZYRO0E05192g1.389ON152026810.33
YHL010C (ETP1)2.542ON58526800.35
CAGL0K08052g3.405ON30566790.36
NCAS0B009908.808ON39250800.36
ZYRO0B02244g2.542ON56326800.36
CAGL0I04576g3.190ON14995770.36
TBLA0I019603.279ON18434780.37
Skud_8.352.542ON58526800.38
NCAS0A125502.542ON57226800.38
Smik_8.322.542ON58526800.39
SAKL0C13178g3.28ON13864760.40
SAKL0C01760gsingletonON147427800.43
KLTH0F19228g3.28ON11060740.43
TDEL0A031802.542ON56726800.43
SAKL0C03586gsingletonON147424800.43
CAGL0E01567g3.28ON10273740.44
Kpol_1048.731.389ON154926800.46
KLTH0D07150g2.542ON54026790.51
SAKL0D08272g1.389ON149127790.53
NDAI0G038603.28ON12373740.54
SAKL0A09746g2.542ON54826790.57
TDEL0B061701.389ON147026790.58
Skud_15.203.28ON12173740.62
YPR093C (ASR1)3.405ON28827770.63
NCAS0A087801.389ON150227790.67
SAKL0A09526gna 2ON66230780.68
NCAS0C044803.28ON10973730.69
Kwal_56.231123.190ON13527740.73
Kwal_26.8030na 2ON66030780.79
KAFR0C017803.28ON11873720.85
Kpol_480.228.808ON42550770.92
Smik_15.203.28ON12173720.94
TDEL0F044408.317ON55426770.94
ZYRO0F09570g5.414ON83550770.96
KAFR0C004603.279ON15745740.97
YOL133W (HRT1)3.28ON12173721.0
KLLA0F12166g1.389ON152826771.0
Suva_15.263.28ON12273721.0
KNAG0J015605.628ON30929761.0
YOL138C (RTC1)3.22ON134125771.1
KLTH0D06886gna 2ON66430761.1
NDAI0E004408.808ON41632761.2
NCAS0G025202.157ON518149761.2
KLLA0F25740g2.542ON51725761.2
NDAI0G052001.389ON158626771.2
KLTH0G18150g1.389ON155427761.4
KLLA0E17711g3.190ON16227731.4
Suva_15.223.22ON133625761.5
TDEL0A03090na 2ON58630751.6
KLLA0E07151g3.28ON11026701.6
Kwal_26.80902.542ON52026751.6
Suva_10.3441.389ON156026751.7
CAGL0L11946g8.238ON2140131751.9
TPHA0I005908.799ON159152751.9
TBLA0A039008.317ON69829741.9
ZYRO0C17424g3.405ON27365732.0
KLLA0E18503gna 2ON65030742.0
AAL030C1.389ON153923742.1
YLR247C (IRC20)1.389ON155626742.1
NDAI0I004006.332ON48132742.1
KNAG0A012303.22ON132125742.1
CAGL0B02013g8.288ON112033742.2
KAFR0F028406.332ON44530732.5
Kwal_14.12871.389ON151827742.7
TPHA0I005608.808ON39439732.7
TPHA0I024802.571ON52962732.7
KAFR0I020901.389ON146626732.8
SAKL0D02354g8.808ON33150723.1
SAKL0B08976g3.405ON32229723.1
KLTH0C04664g8.808ON30636713.8
KLTH0F11044g3.405ON29140714.1
TDEL0B052002.157ON524152714.4
NDAI0G038103.22ON139325714.8
SAKL0A01474g6.332ON46830705.1
ZYRO0B02046gna 2ON44530705.2
Smik_16.3333.405ON29027705.3
Skud_15.1028.808ON40650705.6
TBLA0I023606.332ON64424705.6
Kwal_27.104198.808ON30031695.8
Smik_12.3201.389ON155326715.9
KLLA0C08756g6.332ON42724706.2
KLTH0A06556g6.332ON46030706.2
Skud_12.3281.389ON155726707.0
Ecym_7253na 2ON61730707.0
TDEL0B008908.808ON54052698.1
Skud_16.3793.405ON28827688.5
TPHA0B036501.389ON157626698.7
Kwal_55.21206singletonON27559688.8
KLLA0F17479g2.411ON111499699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A05240
         (553 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...   965   0.0  
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...   399   e-133
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...   392   e-130
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...   376   e-124
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...   371   e-122
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...   368   e-121
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...   367   e-120
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...   355   e-116
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...   356   e-115
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...   348   e-113
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...   344   e-112
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...   344   e-111
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...   335   e-108
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...   332   e-107
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...   328   e-104
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...   296   3e-93
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...   293   5e-92
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...   213   2e-61
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...   183   1e-49
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...   173   1e-46
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    54   6e-07
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    54   1e-06
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    53   1e-06
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    53   2e-06
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    53   2e-06
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    52   3e-06
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    52   3e-06
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    52   3e-06
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    51   6e-06
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    51   6e-06
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    51   7e-06
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    50   1e-05
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    50   1e-05
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    50   2e-05
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    50   2e-05
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    50   2e-05
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    49   2e-05
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    48   4e-05
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    48   6e-05
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    47   9e-05
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    46   2e-04
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    46   2e-04
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    42   3e-04
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     45   3e-04
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    45   4e-04
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    41   7e-04
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    42   0.001
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    43   0.001
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    43   0.002
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    42   0.003
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    40   0.004
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    40   0.004
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    40   0.005
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    40   0.005
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    41   0.005
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    40   0.005
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    41   0.007
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    40   0.007
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    40   0.007
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    40   0.008
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    41   0.010
TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [...    40   0.010
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    40   0.011
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    40   0.011
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    40   0.012
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    40   0.014
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    40   0.016
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    40   0.016
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    40   0.017
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      39   0.018
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    40   0.020
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    37   0.022
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    39   0.022
NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON}      39   0.023
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    39   0.025
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    39   0.027
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    39   0.027
KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}...    39   0.028
Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp...    39   0.033
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    39   0.034
KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa] ...    39   0.036
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    39   0.038
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    39   0.040
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    37   0.040
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    36   0.040
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     39   0.046
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    37   0.047
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    39   0.048
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    38   0.048
Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W...    37   0.048
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    37   0.054
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    37   0.063
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    38   0.068
Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W ...    37   0.078
Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W ...    37   0.081
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...    38   0.088
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    37   0.091
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    36   0.096
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    37   0.11 
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    37   0.13 
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    37   0.13 
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    37   0.15 
TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON} ...    36   0.15 
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    35   0.15 
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      36   0.19 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    37   0.19 
TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa...    36   0.19 
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    36   0.21 
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    34   0.22 
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    37   0.23 
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    36   0.23 
SAKL0G13134g Chr7 (1127910..1133723) [5814 bp, 1937 aa] {ON} sim...    36   0.25 
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    34   0.25 
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    35   0.26 
NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5....    36   0.27 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    36   0.28 
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    34   0.29 
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     36   0.30 
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    34   0.31 
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    33   0.32 
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    36   0.33 
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    33   0.33 
ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} simil...    36   0.33 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    35   0.35 
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    35   0.36 
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    35   0.36 
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    35   0.36 
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...    34   0.36 
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    35   0.37 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    35   0.38 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    35   0.38 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    35   0.39 
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    34   0.40 
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    35   0.43 
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    33   0.43 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    35   0.43 
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    35   0.43 
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    33   0.44 
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    35   0.46 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    35   0.51 
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    35   0.53 
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    33   0.54 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    35   0.57 
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    35   0.58 
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    33   0.62 
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    34   0.63 
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    35   0.67 
SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conser...    35   0.68 
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       33   0.69 
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...    33   0.73 
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    35   0.79 
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    32   0.85 
Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON} (52842..5...    34   0.92 
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    32   0.94 
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    34   0.94 
ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} simila...    34   0.96 
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    33   0.97 
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    32   1.0  
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    34   1.0  
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    32   1.0  
KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.6...    34   1.0  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    34   1.1  
KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conser...    34   1.1  
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    34   1.2  
NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.1...    34   1.2  
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    34   1.2  
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    34   1.2  
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    34   1.4  
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...    33   1.4  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    34   1.5  
TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON}               33   1.6  
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    32   1.6  
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    33   1.6  
Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] ...    33   1.7  
CAGL0L11946g Chr12 complement(1282266..1288688) [6423 bp, 2140 a...    33   1.9  
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    33   1.9  
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    33   1.9  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    33   2.0  
KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]...    33   2.0  
AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON} ...    33   2.1  
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    33   2.1  
NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}...    33   2.1  
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    33   2.1  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    33   2.2  
KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {O...    33   2.5  
Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247...    33   2.7  
TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.8...    33   2.7  
TPHA0I02480 Chr9 complement(551687..553276) [1590 bp, 529 aa] {O...    33   2.7  
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    33   2.8  
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    32   3.1  
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    32   3.1  
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    32   3.8  
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    32   4.1  
TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.1...    32   4.4  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    32   4.8  
SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {...    32   5.1  
ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conser...    32   5.2  
Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {O...    32   5.3  
Skud_15.102 Chr15 (187319..188539) [1221 bp, 406 aa] {ON} YOL054...    32   5.6  
TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.3...    32   5.6  
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    31   5.8  
Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] ...    32   5.9  
KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {...    32   6.2  
KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} simila...    32   6.2  
Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] ...    32   7.0  
Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}...    32   7.0  
TDEL0B00890 Chr2 (170522..172144) [1623 bp, 540 aa] {ON} Anc_8.8...    31   8.1  
Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa] {O...    31   8.5  
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    31   8.7  
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    31   8.8  
KLLA0F17479g Chr6 complement(1601287..1604631) [3345 bp, 1114 aa...    31   9.2  

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/553 (86%), Positives = 479/553 (86%)

Query: 1   MIVQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLF 60
           MIVQSRKQQLVIFSM          FTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLF
Sbjct: 1   MIVQSRKQQLVIFSMIIYLLTIITIFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLF 60

Query: 61  LLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKV 120
           LLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKV
Sbjct: 61  LLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKV 120

Query: 121 FHWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXX 180
           FHWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYD    
Sbjct: 121 FHWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDNNNS 180

Query: 181 XXXXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQR 240
                         KNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQR
Sbjct: 181 TNNNQNADSSNLMNKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQR 240

Query: 241 ATAHHNVNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQT 300
           ATAHHNVNAGT              ANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQT
Sbjct: 241 ATAHHNVNAGTDEESEEEADGDDDDANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQT 300

Query: 301 KLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDD 360
           KLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDD
Sbjct: 301 KLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDD 360

Query: 361 LVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFD 420
           LVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFD
Sbjct: 361 LVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFD 420

Query: 421 ENGNVKPFLHTTTNNNMQPNNDADVXXXXXXXXXXXXXXPMTDVXXXXXXXXXXXXXXXX 480
           ENGNVKPFLHTTTNNNMQPNNDADV              PMTDV                
Sbjct: 421 ENGNVKPFLHTTTNNNMQPNNDADVTSTTATNSRTDTSTPMTDVPTPTRTSASALTTSSI 480

Query: 481 XXQDFKNGITPIDSVEWYAFEIDSISDARNEVKFNVRNASSNNRSIPMKLLIERMEETAE 540
             QDFKNGITPIDSVEWYAFEIDSISDARNEVKFNVRNASSNNRSIPMKLLIERMEETAE
Sbjct: 481 ITQDFKNGITPIDSVEWYAFEIDSISDARNEVKFNVRNASSNNRSIPMKLLIERMEETAE 540

Query: 541 GQIVIPDSAFSRE 553
           GQIVIPDSAFSRE
Sbjct: 541 GQIVIPDSAFSRE 553

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score =  399 bits (1026), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 209/441 (47%), Positives = 285/441 (64%), Gaps = 30/441 (6%)

Query: 5   SRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFLLWE 64
           +R++Q+  F++          + S ++S +FLQ TIKLT G NV+IL +FT LN  +LW+
Sbjct: 6   TRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWK 65

Query: 65  FLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVFHWI 124
               ILFG L L+E+EHIFERLPFTIIN +FM S+F+E  FF   +F L+L  +KVFHWI
Sbjct: 66  LSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDFFTVTLFGLLLLYMKVFHWI 125

Query: 125 LKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXXXXXX 184
           LKDRLE+LLQSI+++T LK+LI +R+  NL + ++LD+ I S                  
Sbjct: 126 LKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGC---------------- 169

Query: 185 XXXXXXXXXXKNNLTPT--NKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQRAT 242
                      N+L+ +     ++ L+ GMEF +L +DL+NLAMHTVLNFYEFY +Q   
Sbjct: 170 ---------ITNSLSNSFGASTSVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDA 220

Query: 243 AHHNVNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQTKL 302
              +V+  T              ++F GLEGKFMYE++IDV T+F KT++H  +LI  ++
Sbjct: 221 HLSSVDTDTDGGDEENEDEDVNGSSFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRM 280

Query: 303 QIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDLV 362
            I+++KDV WD LTL Q   SLW+I++NNKQLDDKL T+S  ++ +  DNICIVCMD+L 
Sbjct: 281 SILLIKDVFWDVLTLCQIVSSLWRIWQNNKQLDDKLKTMSPVEL-SATDNICIVCMDELC 339

Query: 363 PSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDEN 422
             L  +E V+    +  + +   +PK+LPCGH+LHL CLKNWMERSQTCPICRLPVFDEN
Sbjct: 340 ADL--EEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDEN 397

Query: 423 GNVKPFLHTTTNNNMQPNNDA 443
           GNV     +TTN   Q  N +
Sbjct: 398 GNVVQSQSSTTNRTTQATNQS 418

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score =  392 bits (1006), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 217/556 (39%), Positives = 321/556 (57%), Gaps = 84/556 (15%)

Query: 2   IVQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFL 61
           I ++RK+Q ++FS+          + + ++S +FLQ  ++LT+G N++I+ +F  LN  L
Sbjct: 3   ISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVL 62

Query: 62  LWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVF 121
           LW+    +LFG LRLIE+EHIFERLPFTIIN + M S+F+E+ F    ++ L+L  +KVF
Sbjct: 63  LWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVF 122

Query: 122 HWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXXX 181
           HWIL+DRLE+LLQ+I ++T L +LIF+R+  NL + ++ D+ I S+              
Sbjct: 123 HWILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHC------------- 169

Query: 182 XXXXXXXXXXXXXKNNLTPT--NKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQ 239
                         N+L  +     ++ L+ GMEF +L +DL+N  +H  L FYEFY SQ
Sbjct: 170 ------------VSNSLDNSFGASASVHLMMGMEFALLLIDLLNTTLHAALCFYEFYQSQ 217

Query: 240 RATAHHNVNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQ 299
                + VN                   F+GLEGKF+YE++ID+ST+F KT++H  +L+ 
Sbjct: 218 THGRRNAVNDD------------EDDTQFSGLEGKFIYERVIDISTRFLKTVLHALLLVP 265

Query: 300 TKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMD 359
            ++ IM++KDV+WDCLTL+Q++  LWKI++NNKQLDDKLPT+S + + N  DN+CI+CMD
Sbjct: 266 FRMPIMLIKDVLWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRN-IDNMCIICMD 324

Query: 360 DLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVF 419
           +L+P           Q +  + +   +PK+LPCGH+LHL CLKNWMERSQTCPICRL VF
Sbjct: 325 ELIPE----------QDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVF 374

Query: 420 DENGNVKPFLHTTTNNNMQPNNDADVXXXXXXXXXXXXXXPMTDVXXXXXXXXXXXXXXX 479
           DE GNV      TT   + P ++ +V              P T V               
Sbjct: 375 DEMGNVVQSTVPTT-AEVTPTDEINV--------------PETVVERSQEQIQDNQQQMG 419

Query: 480 XXXQDFKNGITPIDSVEWYAFEIDSISDARNEVKFNVRNASSNNRSIPMKLLIERMEETA 539
                 +  +  +DS  WY+F ++  S+  N V F+++N S+ N ++P  LLIER   + 
Sbjct: 420 ------EGQVAVLDS--WYSFPVEETSE--NLVTFSMKN-SATNETVPASLLIERTNASE 468

Query: 540 E--------GQIVIPD 547
                      I+IPD
Sbjct: 469 RYDDDDDQVETIIIPD 484

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score =  376 bits (966), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 238/579 (41%), Positives = 324/579 (55%), Gaps = 66/579 (11%)

Query: 1   MIVQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLF 60
           M+ ++R++QL IF +          +++ K+S +FLQ T+KL +G N+++L+IF  LN  
Sbjct: 1   MVPENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNST 60

Query: 61  LLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKV 120
           LLW+ L  +LFGELRLIEHEHIFERLPFTIIN LFM S+F+E  FF    F L+L  LKV
Sbjct: 61  LLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKV 120

Query: 121 FHWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXX 180
           FHWILKDRLE+LLQSIND+T +K LIFSR+  NL + +V+D+ I +    +         
Sbjct: 121 FHWILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSI-------- 172

Query: 181 XXXXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQR 240
                          N  +     +L+L+  MEF +L +DL+NL + T LNF+EFY SQ+
Sbjct: 173 -------------YTNQKSDIESTSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQ 219

Query: 241 ATAHHN---VNAGTXXXXXXXXXXXXXXAN-----------FNGLEGKFMYEKLIDVSTK 286
           + ++ N   V+                  N           F GLEGKFMYEK IDV T+
Sbjct: 220 SLSNENNHIVHGDPTDENTVESDQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTR 279

Query: 287 FFKTIVHIFVLIQTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDV 346
           F KT +H+ +LI  ++ +M+LKDVVWD L LYQ   SLWKI++NNKQLDD L T++V  +
Sbjct: 280 FLKTALHLSMLIPFRMPMMLLKDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQL 339

Query: 347 EN--DNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           +N  ++DNICI+CMD+L+ S + +             +K+K+PK+LPCGH+LHLSCLKNW
Sbjct: 340 QNSANDDNICIICMDELIHSPNQQTWK----------NKNKKPKRLPCGHILHLSCLKNW 389

Query: 405 MERSQTCPICRLPVFDENGNVKPFLHTTTNNNMQPNNDADVXXXXXXXXXXXXXXPMTDV 464
           MERSQTCPICRLPVFDE GNV   + TT  +N        V                 D+
Sbjct: 390 MERSQTCPICRLPVFDEKGNV---VQTTFTSNSDITTQTTVTDSTGIATDQQGFANEVDL 446

Query: 465 XXXXXXXXXXXXXXXXXXQDF--KNGITPIDSVEWYAFEI-----DSISDARNEVKFNVR 517
                                  +   T   S  WY F +     +S+  +R+  +F + 
Sbjct: 447 LPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPTWYTFPLHKTGDNSVGSSRSAYEFLIT 506

Query: 518 NASSNNRSIPMKLLIERME---------ETAEGQIVIPD 547
           N+      IP+KL IE  E         E    +IVIPD
Sbjct: 507 NSDEKENGIPVKLTIENHEVNSLHGDGGEQIAKKIVIPD 545

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  371 bits (953), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 212/445 (47%), Positives = 286/445 (64%), Gaps = 49/445 (11%)

Query: 1   MIVQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLF 60
           M+ ++R++QLV F +          +++ K+S +FLQ T+KL +G N+++L+IF  LN  
Sbjct: 1   MVPENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNST 60

Query: 61  LLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKV 120
           LLW+ L  +LFGELRLIEHEHIFERLPFTIIN LFM S+F+E  FF    F L+L  LKV
Sbjct: 61  LLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV 120

Query: 121 FHWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXX 180
           FHWI+KDRLE+LLQSIND+T LK LIFSR+  NLA+ ++ D+ I +    +         
Sbjct: 121 FHWIIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSI-------- 172

Query: 181 XXXXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQR 240
                          N        +L+L+  MEF +L +DL+NL + T LNF+EFYCSQ+
Sbjct: 173 -------------YTNKNIDVVSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQ 219

Query: 241 ATAHHN-------------VNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKF 287
           + ++ N             V++G                 F GLEGKFMYEK IDV T+F
Sbjct: 220 SQSNENNHIVQDEVEDENEVDSG-EPHAELDDDDDDDDRQFTGLEGKFMYEKAIDVFTRF 278

Query: 288 FKTIVHIFVLIQTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVE 347
            KT +H+ +LI  ++ +M+LKDVVWD L LYQ + +LWKI++NNKQLDD L T+++  ++
Sbjct: 279 LKTALHLSMLIPFRMPMMLLKDVVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQ 338

Query: 348 N--DNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWM 405
           N  + DNICI+CMD+L+ S + +             +K+K+PK+LPCGH+LHLSCLKNWM
Sbjct: 339 NSANEDNICIICMDELIHSANQQAWK----------NKNKKPKRLPCGHILHLSCLKNWM 388

Query: 406 ERSQTCPICRLPVFDENGNV--KPF 428
           ERSQTCPICRLPVFDE GNV   PF
Sbjct: 389 ERSQTCPICRLPVFDEKGNVVQTPF 413

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score =  368 bits (944), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/439 (48%), Positives = 283/439 (64%), Gaps = 48/439 (10%)

Query: 1   MIVQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLF 60
           M+ ++R++QL++F +          +++ K+S +FLQ T+KL +G N+++L+IF  LN  
Sbjct: 1   MVPENRRKQLIVFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNST 60

Query: 61  LLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKV 120
           LLW+ L  +LFGELRLIEHEHIFERLPFTIIN LFM S+F+E  FF    F L+L  LKV
Sbjct: 61  LLWQLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV 120

Query: 121 FHWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWI---CSNTYRAFRGYDX 177
           FHWILKDRLE+LLQSIND+T +KNLI SR+  NL + +V+DF I   C ++    +  D 
Sbjct: 121 FHWILKDRLEALLQSINDSTTMKNLILSRFSFNLVLLAVVDFQILIRCISSIYTNQNIDI 180

Query: 178 XXXXXXXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYC 237
                                      +L+L+  MEF +L +DL+NL + T LNF+EFY 
Sbjct: 181 I------------------------STSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYR 216

Query: 238 SQRATAH---HNVN------AGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFF 288
           SQ++ ++   H V+       G                 F GLEGKFMYEK IDV T+F 
Sbjct: 217 SQQSQSNESNHIVHDDTPNGVGFEEAHAVLNDDDDDDRQFTGLEGKFMYEKAIDVFTRFL 276

Query: 289 KTIVHIFVLIQTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVEN 348
           KT +H+ +LI  ++ +M+LKDVVWD L LYQ   SLWKI++NNKQLDD L T++   ++N
Sbjct: 277 KTALHLSMLIPFRMPLMLLKDVVWDVLALYQSGTSLWKIWRNNKQLDDALITVTAEQLQN 336

Query: 349 --DNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWME 406
             + DNICI+CMD+L+ S          QAD    +K+K+PK+LPCGH+LHLSCLKNWME
Sbjct: 337 SANEDNICIICMDELMHS----------QADQTWKNKNKKPKRLPCGHILHLSCLKNWME 386

Query: 407 RSQTCPICRLPVFDENGNV 425
           RSQTCPICRL VFDE GNV
Sbjct: 387 RSQTCPICRLSVFDEKGNV 405

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  367 bits (943), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 233/578 (40%), Positives = 322/578 (55%), Gaps = 67/578 (11%)

Query: 1   MIVQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLF 60
           M+ ++R++QLV+F +          +++ K+S +FLQ T+KL +G N+++L+IF  LN  
Sbjct: 1   MVPENRRKQLVVFIVITYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFVLLNST 60

Query: 61  LLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKV 120
           LLW  L  +LFGELRLIEHEHIFERLPFTIIN LFM S+F+E  FF    F L+L  LKV
Sbjct: 61  LLWHLLTRLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKV 120

Query: 121 FHWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXX 180
           FHWILKDRLE+LLQSIND+T +K LIFSR+ LNL + + LD+ I  +   +         
Sbjct: 121 FHWILKDRLEALLQSINDSTTMKTLIFSRFSLNLVLLAALDYQIIVHCISSI-------- 172

Query: 181 XXXXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQR 240
                          N        +L+L+  MEF +L +DL+NL + T LNF+EFY SQ+
Sbjct: 173 -------------YTNQKIDIVSTSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQ 219

Query: 241 ATA-------HHNVNAGT------XXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKF 287
           + +       H +++ G                       F GLEGKFMYEK IDV T+F
Sbjct: 220 SQSDDGNHIVHDDLSDGNRVDFDGSQHALNDDGDDDDDRQFTGLEGKFMYEKAIDVFTRF 279

Query: 288 FKTIVHIFVLIQTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVE 347
            KT +H+ +LI  ++ +M+LKDV+WD L LYQ +  LWKI++NNKQLDD L T++V  ++
Sbjct: 280 LKTALHLSMLIPFRMPMMLLKDVIWDILALYQSATGLWKIWRNNKQLDDSLLTVTVEQLQ 339

Query: 348 N--DNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWM 405
           N  + DNICI+CMD+L+ S + +             +K+K+PK+LPCGH+LHLSCLKNWM
Sbjct: 340 NSANEDNICIICMDELIHSTNQQTWK----------NKNKKPKRLPCGHILHLSCLKNWM 389

Query: 406 ERSQTCPICRLPVFDENGNVKPFLHTTTNNN---MQPNNDADVXXXXXXXXXXXXXXPMT 462
           ERSQTCPICRLPVFD+ GNV     T+  N+   M   ++                 P  
Sbjct: 390 ERSQTCPICRLPVFDDKGNVVQTTFTSETNSSITMAATDNTRTIVNSQDFANETELLPTR 449

Query: 463 DVXXXXXXXXXXXXXXXXXXQDFKNGITPIDSVEWYAFEIDSISD----ARNEVKFNVRN 518
                                  +   T   S  W  F +    D    +R+  +F + +
Sbjct: 450 TTSPDVRILPNQNTNTFAS----RATSTSTSSTTWCKFPLQQTEDNDVESRSTYEFLMTS 505

Query: 519 ASSNNRSIPMKLLIERME----------ETAEGQIVIP 546
           +     SIP+KL IE  E          +TA+ +IVIP
Sbjct: 506 SDEKESSIPVKLTIESHEIDYLQGDGEGQTAQKKIVIP 543

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score =  355 bits (911), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 200/448 (44%), Positives = 276/448 (61%), Gaps = 22/448 (4%)

Query: 1   MIVQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLF 60
           M+    K++ +IF+            ++ +SS +FLQ  +KL++G N+LI+ +FT LN  
Sbjct: 1   MLTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNST 60

Query: 61  LLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKV 120
           LLW+FL  +LFGELR+IEHEHIFERLPF +IN +FM S FNE  FF     AL+L  +KV
Sbjct: 61  LLWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKV 120

Query: 121 FHWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXX 180
           FHWIL+DRL+ LLQ IN+ T  K+L+ +RY+ NL +  V+D ++ S  +     Y+    
Sbjct: 121 FHWILRDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVIS--FCVSTAYNIASS 178

Query: 181 XXXXXXXXXXXXXXKNNLTPTNKKAL-FLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQ 239
                             +P  ++AL +++  MEF  L +DL+NL ++T L FYEF+ S 
Sbjct: 179 IFTAGTNSIVL----GGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLS- 233

Query: 240 RATAHHNVNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQ 299
           R  + +N    +              + FNGLEGKFMYEKLIDV T+F +T+VH+ + + 
Sbjct: 234 RKFSQNNPTFNSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMV 293

Query: 300 TKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDN--DNICIVC 357
             L +M++KD+  D   LY +S SL  I+KN+KQLD KLPT++ +D+ ND   DN+CIVC
Sbjct: 294 LNLPLMLVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVC 353

Query: 358 MDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLP 417
           MD+LV      E     Q+D       K+PKKLPCGH+LHLSCLKNWMERSQTCPICRLP
Sbjct: 354 MDELV-----SENPHHHQSD------GKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLP 402

Query: 418 VFDENGNV-KPFLHTTTNNNMQPNNDAD 444
           VFDENG +  P     +  N+ P  + D
Sbjct: 403 VFDENGEILAPSSANVSQTNLNPGENPD 430

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score =  356 bits (913), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 186/437 (42%), Positives = 278/437 (63%), Gaps = 37/437 (8%)

Query: 5   SRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFLLWE 64
           +RK QL + +           + + +SS ++LQ TIKLT+G+NV+IL +F  LN+  +W+
Sbjct: 7   TRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWK 66

Query: 65  FLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALV-FALILSVLKVFHW 123
            L ++LF  LRLIE+EHI ERLPFTIIN   + S+FNE     ++  + +IL  +KV HW
Sbjct: 67  GLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHW 126

Query: 124 ILKDRLESLLQSINDATDLKNLIFS-RYMLNLAIFSVLDFWICSNTYRAFRGYDXXXXXX 182
           +LKDRLESLLQS+ND + +++LIFS R+ LNL +F+V+D+ +                  
Sbjct: 127 VLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQM------------------ 168

Query: 183 XXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQRAT 242
                       KN++  +   ++ LL G+EF +L +DL+NL +HT LN YEF+   ++ 
Sbjct: 169 ---MMQCVTNSIKNSMGAST--SIHLLLGVEFTMLLVDLVNLFLHTCLNLYEFH---KSI 220

Query: 243 AHHNVNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQTKL 302
              N+N                   FN LEGKFMYEK ID+ T+F KT++H+ + I  ++
Sbjct: 221 EDRNLN----IVGEDEDGLVDDEEEFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRM 276

Query: 303 QIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDLV 362
           +I++LKDV+WD +TLYQ ++SLWK ++N+KQLD+KLPT+S+ ++++ ++++CIVCMD L+
Sbjct: 277 KIVLLKDVIWDVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLI 336

Query: 363 -----PSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLP 417
                 +   +   +  Q    +I   ++PKKLPC H+LHL CLKNWMERSQTCPICRL 
Sbjct: 337 NIDFNSTEETENKEKEEQIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLS 396

Query: 418 VFDENGNVKPFLHTTTN 434
           VFD NGN+ PF +T ++
Sbjct: 397 VFDSNGNILPFNNTRSD 413

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score =  348 bits (894), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/462 (41%), Positives = 274/462 (59%), Gaps = 59/462 (12%)

Query: 3   VQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFLL 62
           ++SRKQQ  +  +            ++ +S TFL+ T  LTQG+N +I+A F+ LN+ LL
Sbjct: 6   LRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLL 65

Query: 63  WEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVFH 122
           W+   +++FG+LRLIE EHIFER+P T+IN++ + S+ ++   F+ ++   +L VLKV H
Sbjct: 66  WKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIVLLGGLLLVLKVSH 125

Query: 123 WILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICS----NTYRAFRGYDXX 178
           WIL+DRLE  LQ IND T L +L+FS++  NL IF +LD+++      N +  F  +   
Sbjct: 126 WILRDRLEGFLQRINDTTTLTSLLFSKFSRNLLIFGILDYFVTKICFFNHFGNFYHHGDF 185

Query: 179 XXXXXXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCS 238
                            +N+T        ++FG+E+ V+F+DLIN+  HTVLNFY F+ +
Sbjct: 186 -----------------SNITQ-------IMFGLEYAVVFIDLINILCHTVLNFYAFHRT 221

Query: 239 QRATAHHNVNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLI 298
           Q  +A  N+                      GLEGKF+YEKLID      +T +H  +LI
Sbjct: 222 QLQSARFNLEMMNDDFSEDENDSGVNADG--GLEGKFIYEKLIDFVAGVLRTGLHFTMLI 279

Query: 299 QTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCM 358
             + Q M++KD VWD   L  +  SLWKIYKNN+QL+ KLP +++ D+  D+DN+CIVCM
Sbjct: 280 PLRFQSMLVKDFVWDLFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDLL-DHDNMCIVCM 338

Query: 359 DDLV--------------------------PSLHGKE--AVEMTQADIDSISKSKRPKKL 390
           DDLV                          PS   ++   VE TQ DID ++ SK+PKKL
Sbjct: 339 DDLVLVHHPTKRRQSVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKL 398

Query: 391 PCGHMLHLSCLKNWMERSQTCPICRLPVFDENGNVKPFLHTT 432
           PCGHMLH SCLKNWMERSQTCPICR+PVFD++GNV+P +  T
Sbjct: 399 PCGHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRPSIAKT 440

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score =  344 bits (883), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 203/559 (36%), Positives = 301/559 (53%), Gaps = 71/559 (12%)

Query: 2   IVQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFL 61
           + Q+R+ Q +++S+          + S  SS TFLQ TIKL +G+N++IL  F  LN  L
Sbjct: 3   VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVL 62

Query: 62  LWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVF 121
           LW+ L  +LFGELRLIE+EH+FERL FTI+N +F+ S+F E  F   LVF  +L  LKVF
Sbjct: 63  LWKLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVF 122

Query: 122 HWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXXX 181
           HWILKDRLE + Q+ N+ T+LK ++FSR+  NL   + +D+ +           D     
Sbjct: 123 HWILKDRLEFVFQNANENTNLKKMLFSRFNFNLLFLASVDYQMVRYCLSNSISNDQW--- 179

Query: 182 XXXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQRA 241
                                  +++L+FG++F +L +D +++ +H V+NF E Y  Q  
Sbjct: 180 --------------------TSSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSH 219

Query: 242 TAHHNVNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQTK 301
            +H++                     F GLEGKFMYEKLID+  +  K ++HI +LI  +
Sbjct: 220 NSHYD-------------------EEFLGLEGKFMYEKLIDMGARLLKMLLHIALLIPFR 260

Query: 302 LQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDL 361
           + IM++KD++WD ++LYQ + SLWK +KN K+LD+KLP ++  ++ N  +N+CIVCMDD+
Sbjct: 261 MPIMIIKDIIWDAISLYQTATSLWKTWKNAKKLDEKLPDVTEEEL-NQGNNMCIVCMDDM 319

Query: 362 VPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDE 421
           +P+   + A             + +PKKLPCGH+LHLSCLK+WMERSQTCPICRLPVFDE
Sbjct: 320 LPNSETRNA-------------NLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDE 366

Query: 422 NGNVKPFLHTTTNNNMQPNNDADVXXXXXXXXXXXXXXPMTDVXXXXXXXXXXXXXXXXX 481
            GNV   + +++     P+N                    T                   
Sbjct: 367 RGNVTR-MDSSSQEQQLPHNLQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPTQANRSVI 425

Query: 482 XQDFKNGITPIDSVEWYAFEIDSISDARNEVKFNVRNASSNNRSIPMKLLI------ERM 535
                    P    +WYAF I++    +++V F +    S+N  I   LL       +++
Sbjct: 426 MPQ-----VPRVPQDWYAFPIEATQTTKDKVVFKL--VDSDNNEITANLLTKTRPQFQKV 478

Query: 536 EETAEGQ-IVIPDSAFSRE 553
            E + GQ I IP S   ++
Sbjct: 479 TEVSGGQRITIPQSCIEQK 497

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score =  344 bits (882), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 184/410 (44%), Positives = 261/410 (63%), Gaps = 42/410 (10%)

Query: 31  SSKTFLQCTIKLTQGINVLILAIFTALNLFLLWEFLRWILFGELRLIEHEHIFERLPFTI 90
           SS ++LQ TIKL+QG N ++L +F  LN   +W F  W+ FG LRLIE+EH+ ERLPFTI
Sbjct: 34  SSTSYLQVTIKLSQGFNAIVLVLFAILNGTYVWRFFIWLAFGNLRLIEYEHVMERLPFTI 93

Query: 91  INVLFMISIFNEYQF-FNALVFALILSVLKVFHWILKDRLESLLQSINDATDLKNLIFSR 149
           +N++   S+FN+    F   +F   L  +KV HWIL+DRL++++QS ND++ L ++I S 
Sbjct: 94  LNMVITYSMFNDKSIAFTGSIFGFFLIFMKVLHWILRDRLDAIVQSFNDSSTLTSIILSN 153

Query: 150 -YMLNLAIFSVLDF----WICSNTYRAFRGYDXXXXXXXXXXXXXXXXXXKNNLTPTNKK 204
            + LNL IF+++D+    +  SN+     G                              
Sbjct: 154 NFFLNLIIFTIVDYKMVSYCVSNSLSNSMGAST--------------------------- 186

Query: 205 ALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQRATAHHNVNAGTXXXXXXXXXXXXX 264
            + LL GMEF +L +DL+NL +HT LN YEF+ +    + + +                 
Sbjct: 187 TVHLLLGMEFTMLLIDLLNLFLHTCLNLYEFHLTTLERSSNIIQEDGEDDEEDDEL---- 242

Query: 265 XANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQTKLQI-MVLKDVVWDCLTLYQDSIS 323
              FN LEGKFMYEK IDV T+F KT +HI +LI  +++  ++LKDV+W+ ++LY+ + S
Sbjct: 243 --QFNSLEGKFMYEKTIDVFTRFLKTFIHILMLIPLRMKFFLLLKDVIWNVISLYKHTGS 300

Query: 324 LWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDLVPSLHGKEAVEMTQADI-DSIS 382
           LWK +KNNKQLDDKLPT S+ +++N ++NICIVCMDDL+P ++ ++     + ++ D I 
Sbjct: 301 LWKTWKNNKQLDDKLPTASIEELKNTDNNICIVCMDDLLPRINSEKYDSQREKELYDHIM 360

Query: 383 KSK-RPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDENGNVKPFLHT 431
           KSK +PKKLPCGH+LHL+CLKNWMERSQTCPICRLPVFD+ GNV P  H+
Sbjct: 361 KSKQKPKKLPCGHILHLNCLKNWMERSQTCPICRLPVFDDKGNVMPSTHS 410

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score =  335 bits (859), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/432 (43%), Positives = 277/432 (64%), Gaps = 57/432 (13%)

Query: 4   QSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFLLW 63
           QSR  Q V+F++          + +  SS +FLQ TIKLTQG N++I++IF+ +N  +LW
Sbjct: 5   QSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGFNIIIISIFSIINSIILW 64

Query: 64  EFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVFHW 123
           +F  ++LFGELRLIE+EH+ ERLPFT+IN++FM S+FNE+  F  ++ +L+L  +KV +W
Sbjct: 65  KFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIILSLLLLYMKVSNW 124

Query: 124 ILKDRLESLLQSINDATDLKNLIFS-RYMLNLAIFSVLDF----WICSNTYRAFRGYDXX 178
           IL+DRLESLLQ++ND+T + NLIFS ++  NL +FS++D+    +  SN+  +       
Sbjct: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCISNSLLS------- 177

Query: 179 XXXXXXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCS 238
                             N    +  +++LL GMEF +L +DL N+  H++LN YEFY S
Sbjct: 178 ------------------NSNIGSSASVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKS 219

Query: 239 QRATAHHNVNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLI 298
              +   ++ +                + FNGLEGKF+YEK+ID  T+F KTI+HI +LI
Sbjct: 220 SLVSLDTHLTS---------EDEEDDESGFNGLEGKFIYEKIIDTFTRFLKTIIHILLLI 270

Query: 299 QTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCM 358
              + +M+ KDVV D +TL Q+  ++WKI+ NN++LDD+LPT++ + +++  D ICI+CM
Sbjct: 271 PFAMPVMLSKDVVIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICM 330

Query: 359 DDLVPSLHGKEAVEMTQADIDSISKS---KRPKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           DDL                I+SI K+   ++PK LPCGH+LH++CLKNWMERSQTCP+CR
Sbjct: 331 DDL---------------SINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375

Query: 416 LPVFDENGNVKP 427
           LPVF+E G V P
Sbjct: 376 LPVFNEKGEVLP 387

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score =  332 bits (850), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 182/434 (41%), Positives = 256/434 (58%), Gaps = 34/434 (7%)

Query: 2   IVQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFL 61
           ++Q+R+ QL+ F+             S   S +FL  ++KL QG NV+I+ IF  LN  L
Sbjct: 1   MLQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALL 60

Query: 62  LWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVF 121
           LW+FL ++LF ELRLIE EHI ERLPFTIIN +F+ ++FNE  F     +  IL  +K+F
Sbjct: 61  LWKFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIF 120

Query: 122 HWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXXX 181
           +WILKDRLE L+QS N    +   IFS++ LNL I S ++  +          Y+     
Sbjct: 121 YWILKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPL--NYEFLKKL 177

Query: 182 XXXXXXXXXXXXXKNNLTPTNKKA---------LFLLFGMEFFVLFLDLINLAMHTVLNF 232
                         N  +P++  A         ++L+  MEF +L ++ INL +H++L+ 
Sbjct: 178 YLNSTSILQSLI--NYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSL 235

Query: 233 YEFYCSQRATAHHNVNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIV 292
           YE Y   ++  +  +NA                A+FNGLE KF+YEK+ID+ T+   T++
Sbjct: 236 YEIY---KSNQYDQLNAIIEDIEDENDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMI 292

Query: 293 HIFVLIQTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDN 352
           HI + +   L ++VLKD++WD ++LYQ+   L++I KNNK LD KLP +   D++ D+DN
Sbjct: 293 HISLALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQ-DSDN 351

Query: 353 ICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCP 412
           +CIVCMDDL+   H K                K+ K+LPCGH LHLSCLKNWMERSQTCP
Sbjct: 352 VCIVCMDDLLSEEHKK----------------KKAKRLPCGHFLHLSCLKNWMERSQTCP 395

Query: 413 ICRLPVFDENGNVK 426
           ICRLPVFDE+GNVK
Sbjct: 396 ICRLPVFDESGNVK 409

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 30/56 (53%), Gaps = 6/56 (10%)

Query: 492 IDSVEWYAFEIDSISDARNEVKFNVRNASSNNRSIPMKLLIERMEETAEGQIVIPD 547
           ID+  WY+F I  I+  ++ + F +R+   ++ ++ +      + ET    ++IPD
Sbjct: 456 IDNNTWYSFPITHINKDKSVISFELRDDKESSETVQL------IRETKTENVIIPD 505

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score =  328 bits (842), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/458 (39%), Positives = 270/458 (58%), Gaps = 34/458 (7%)

Query: 2   IVQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFL 61
           ++ S+K Q VIFS+            +  SS +FL   +KL +G N++I+ IF  LN  L
Sbjct: 7   MLNSKKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNEGFNIMIITIFILLNSLL 66

Query: 62  LWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVF 121
            W+ + W LF +LRLIE EHI ERLPFT+IN + M ++FNE  FF   ++ L+L  L+V+
Sbjct: 67  SWKLITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNERFFFTLTIYGLLLISLRVY 126

Query: 122 HWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTY-----RAFRGYD 176
           HWILKDRLE ++Q+IND+T +  +IFS++  NL   S+++  +  N         ++   
Sbjct: 127 HWILKDRLEFIIQTINDSTSMTKIIFSKFSFNLISLSLINLKLIQNCLTWDDINFWKNNQ 186

Query: 177 XXXXXXXXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFY 236
                              +N    +   ++L+ GMEF +L L+  N+  H++L+ +EFY
Sbjct: 187 NLFNSIMNYLINPISSTTISNGINNHSNPVYLMLGMEFSILLLEYFNVLFHSLLSLFEFY 246

Query: 237 CSQ----------------RATAHHN----VNAGTXXXXXXXXXXXXXXANFNGLEGKFM 276
            S+                RA    N    +N G                 FNGLEGKF+
Sbjct: 247 KSKQFSIQQQQIRQNNLINRAQTTQNDENEINIG--LDIDIDDDEEDDDETFNGLEGKFI 304

Query: 277 YEKLIDVSTKFFKTIVHIFVLIQTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDD 336
           YEK+ID+ T+F  TI+H+ +L+   + ++++KD++WD  +LY++++SL+KI+KNN++L+ 
Sbjct: 305 YEKIIDLFTRFLMTIIHVSLLLPLNIPMILVKDILWDFFSLYRNAMSLYKIWKNNQKLES 364

Query: 337 KLPTLSVNDVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDS------ISKSKRPKKL 390
            LP ++ +D+++  DN+CI+CMDDL+PSL   E      +   S      I K K+PKKL
Sbjct: 365 ALPNMTPDDLQHS-DNVCIICMDDLLPSLETLEHATNVSSTTPSSNHYLNIKKKKKPKKL 423

Query: 391 PCGHMLHLSCLKNWMERSQTCPICRLPVFDENGNVKPF 428
           PCGH LH SCLKNWMERSQTCPICRL VFD+NGNVK +
Sbjct: 424 PCGHFLHFSCLKNWMERSQTCPICRLDVFDKNGNVKVY 461

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score =  296 bits (757), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 176/553 (31%), Positives = 275/553 (49%), Gaps = 82/553 (14%)

Query: 1   MIVQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLF 60
           M ++ +++Q V +++              + S +FL   +KL +G+N+++L  F  +N  
Sbjct: 1   MALRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSI 60

Query: 61  LLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKV 120
           LLW+ L  +LFGELRL+E+EHIFERL FTI+N  FM S F EYQF   ++   +L+ ++V
Sbjct: 61  LLWKGLTRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRV 120

Query: 121 FHWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXX 180
           FHW+LKDRLE + Q  ++ T++  L+ SR+ LN+ IF+V+D+ +     R          
Sbjct: 121 FHWVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLR---------- 170

Query: 181 XXXXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQR 240
                          N   P+    +++LF ++F +L +D+  +AM +V+N  E    +R
Sbjct: 171 -----------NSLTNKHDPSPSAPVYILFCVDFSMLLVDVAEVAMKSVINLIELIQCKR 219

Query: 241 ATAHHNVNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQT 300
           A                         +F GL+GKFMYEKL+ +  +  K  + +  L   
Sbjct: 220 AFERDG-------------------DDFVGLDGKFMYEKLVQLVCQVLKLGLRVASLAPF 260

Query: 301 KLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDD 360
            + +M+ KD++WD + L+    S+W+ +K+N+Q+D+KLP ++   +    D +CIVCM+D
Sbjct: 261 SMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMED 320

Query: 361 LVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFD 420
           ++P               ++ S   +PKKLPC H LHL CLK+WMERSQTCPICR+ VFD
Sbjct: 321 MLPP-------------SEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFD 367

Query: 421 ENGNVKPFLHTTTNNNMQP-NNDADVXXXXXXXXXXXXXXPMTDVXXXXXXXXXXXXXXX 479
             GNV        N   QP + DA V              P++                 
Sbjct: 368 SKGNVA---LPNQNAAQQPISEDASV-----------AQQPLSAANESNSTSLASTHTGS 413

Query: 480 XXXQDFKNGITPIDSVEWYAFEIDSISDARNEVKFNVRNASSNNRSIPMKLLIERM---- 535
                  N   P     WY F + ++SD    V F VR+   N   I  KL+I++     
Sbjct: 414 LGAVSSSNPNFPT----WYTFPV-TLSDNDGAVDFKVRDI--NGVEINAKLIIKKRPGFD 466

Query: 536 ---EETAEGQIVI 545
              E+  E Q V+
Sbjct: 467 VPKEQDQESQRVV 479

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score =  293 bits (749), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 154/446 (34%), Positives = 247/446 (55%), Gaps = 56/446 (12%)

Query: 1   MIVQSRKQQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLF 60
           M V+ +++Q   +              + + S +FL+ + +L +G+N+++L  F A+N  
Sbjct: 1   MAVRVQRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNGV 60

Query: 61  LLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKV 120
           LLW+ L  +LFGELRL+E+EHIFERL FTI+N  FM S F+E +F + + F+  L  +KV
Sbjct: 61  LLWKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVKV 120

Query: 121 FHWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXX 180
           FHW+L+DRLE + Q  ++ T+   L+ SR+  N+ +   LDF +     +  R +     
Sbjct: 121 FHWVLRDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLDFQMTKFCIQGTRFFSRSGF 180

Query: 181 XXXXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQR 240
                               ++  ++ L+F +EF +L +D+  +AM +++N  E Y  +R
Sbjct: 181 Y-------------------SSSLSVHLMFAVEFAMLLVDVTEVAMKSIINLVEVYQCKR 221

Query: 241 ATAHHNVNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQT 300
           + A                       ++ GLEGKFMYEK++ +  +  +  +HI +++  
Sbjct: 222 SFARDG-------------------EDYTGLEGKFMYEKVVQLICQLTRMGLHIMLMMPF 262

Query: 301 KLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDD 360
            + +M+ KD++WD   ++  + SL   +K+N+Q+D+KLP +S   +   +D +CIVCMDD
Sbjct: 263 SMPLMIAKDILWDAFAVFHTAKSLLLTWKSNRQIDEKLPDVSEAQLAASDDKMCIVCMDD 322

Query: 361 -LVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVF 419
            L PS       E T A        ++PK+LPC H LHL CLK+WMERSQTCPICR+PVF
Sbjct: 323 MLAPS-------ECTNA-------KQKPKRLPCNHCLHLGCLKSWMERSQTCPICRVPVF 368

Query: 420 DENGNVKPFLHTTTNNNMQPNNDADV 445
           D+ GNV   + T+   N QP   + V
Sbjct: 369 DKKGNV---VVTSDQTNNQPGTSSAV 391

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score =  213 bits (542), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 144/448 (32%), Positives = 216/448 (48%), Gaps = 56/448 (12%)

Query: 8   QQLVIFSMXXXXXXXXXXFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFLLWEFLR 67
           Q+ + +S+               +S ++L    K+T+GI+ +I      LN  L+ + + 
Sbjct: 24  QKFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVI 83

Query: 68  WILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVL-KVFHWILK 126
            +LFG+LRLIE+EHI ER+ +T+I +L   S  N     + +    +L V  +  HWILK
Sbjct: 84  HMLFGQLRLIEYEHILERISYTVITLLLSCSSMN--GLISVMQIHCVLFVCCRTLHWILK 141

Query: 127 DRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXXXXXXXX 186
           DR+E   Q+ +    LK+++ SR+M NL + + +D  I +                    
Sbjct: 142 DRMEVTFQANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKI-------------- 187

Query: 187 XXXXXXXXKNNLTPTNKKALFLLFGM-EFFVLFLDLINLAMHTVLNFYEFYCSQ-----R 240
                      L  +N    + LF + ++ +L  DL+ + + T LN +E    Q     R
Sbjct: 188 -----------LYKSNIDVTYTLFIISQYAILGTDLLQVILRTGLNLFELSTIQNRARIR 236

Query: 241 ATAHHNV-----NAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIVHIF 295
             A H+V     N                     GLEGKF+YEKLIDV     K I+   
Sbjct: 237 RNADHHVDEPVINHEERPNAVAIEEDEDEDEENAGLEGKFIYEKLIDVFISTVKVIIKFA 296

Query: 296 VLIQTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICI 355
               T   +MV   V+W+ +T ++ +  LWK +K++K LD  L   +   +E+   +ICI
Sbjct: 297 SSFSTGRVMMV--TVLWEAITTFKSARGLWKNWKSSKSLDASLMDATDIQIESGEIDICI 354

Query: 356 VCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           VCM+D +PS   K             S  K+ K LPC H LHLSCLKNW+ RS TCPICR
Sbjct: 355 VCMEDFLPSHQRK-------------SDGKKVKILPCTHALHLSCLKNWIARSPTCPICR 401

Query: 416 LPVFDENGNVKPFLHTTTNNNMQPNNDA 443
           LP+FDENGNV P+   + + +  PN  A
Sbjct: 402 LPIFDENGNVMPYQDHSQSTD--PNTTA 427

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score =  183 bits (465), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 124/411 (30%), Positives = 208/411 (50%), Gaps = 42/411 (10%)

Query: 31  SSKTFLQCTIKLTQGINVLILAIFTALNLFLLWEFLRWILFGELRLIEHEHIFERLPFTI 90
           +S +FLQ   K T G++++I   F  ++ F+    +  +LFG L L+E+EHIFERL  T+
Sbjct: 31  TSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFGRLTLLEYEHIFERLHLTV 90

Query: 91  INVLFMISIFNEYQFFNALVFALILSVL-KVFHWILKDRLESLLQS-INDATDLKNLIFS 148
           ++ L ++ I  + +     V A+   VL +V HW+++DR+E +    I     +K+L+FS
Sbjct: 91  LSSLSVL-ITMDRKNSKIGVIAIPFHVLCQVLHWVVRDRMEFVFAPPIGTRMAMKDLLFS 149

Query: 149 RYMLNLAIFSVLDFWICSNTYR---AFRGYDXXXXXXXXXXXXXXXXXXKNNLTPTNKKA 205
           R+ML++ +  V+DF +    YR   A +GY                    +N   T++  
Sbjct: 150 RFMLSIVVLGVVDFKLMMYFYRQHQAEQGY-------------LYYLLFSDNGQNTSEDR 196

Query: 206 LFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQRATAHHNVNAGTXXXXXXXXXXXXXX 265
           L L  G++F +LFLD + + +   L F E + + R    H +                  
Sbjct: 197 LSLSLGVDFGLLFLDWLQVVLLNCLKFVELFKAGRRVQEHQLLDNNELENDIEDDGAFI- 255

Query: 266 ANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQTKLQIMVLKDVVWDCLTLYQDSISLW 325
                LE KF+YEK+++   +  K +++IF++       +V  ++    +   +  + L+
Sbjct: 256 -----LEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETCERCVLLF 310

Query: 326 KIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSK 385
             +KNN++L +KL  ++   ++   D  C +CMDD++PS              D    +K
Sbjct: 311 NYWKNNRRLHEKLLDVTAGHLDG-VDITCTICMDDMLPSK-------------DVKVNNK 356

Query: 386 RPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDENGNVKPFLHTTTNNN 436
           + K LPCGHMLH  CLK+WM+R+QTCPICR PVF   G+  P      N+N
Sbjct: 357 KAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF---GSSNPRAGQNANSN 404

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score =  173 bits (439), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 121/441 (27%), Positives = 208/441 (47%), Gaps = 56/441 (12%)

Query: 6   RKQQLVIFSMXXXXXXXXXXFTSYKSSKTF---LQCTIKLTQGINVLILAIFTALNLFL- 61
           R+    +++M          +++Y  + +F   L      + G++ +I   F  ++  L 
Sbjct: 3   REVSWPMWAMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLF 62

Query: 62  LWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVF 121
           +W  +R +LFG+L  IE++HIFERL   ++  L  I I     +    +  L  ++  V 
Sbjct: 63  VWAIIR-VLFGQLTAIEYDHIFERLHVVLVT-LASIVITMRKTYMAGHMTILFYTLCLVA 120

Query: 122 HWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDXXXXX 181
           HW+L+DR++ + Q     + L  ++ SR+M +L +  ++D       Y+  +        
Sbjct: 121 HWVLRDRMDFVFQVHGTDSSLLGILCSRFMFSLLVLGMVD-------YKMLK-------- 165

Query: 182 XXXXXXXXXXXXXKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQRA 241
                        +N      +  L+L+  + F  L LD++++ + T LN +E   S+R 
Sbjct: 166 ----------FCVQNTNVDGKRHELYLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRRT 215

Query: 242 TAHHNVNAGTXXXXXXXXXXXXXXANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQTK 301
            + + V  G                    LEGK++YE + D++    K I+ I   +   
Sbjct: 216 RSANLVYEGGTTDDDADDEVFI-------LEGKYIYETVFDLTITVLKVILDIIQEVFVP 268

Query: 302 LQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDL 361
             I V+  +    +   +  + ++  +KNNK+L +KL  +S   + +D D++CI+CMDD+
Sbjct: 269 WSITVVYSIFVRSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQL-DDTDSMCIICMDDM 327

Query: 362 VPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDE 421
           +P+    E  +M          ++R K LPCGHMLH  CLK+WMERSQTCPICRL VF  
Sbjct: 328 LPT---TETTKM----------NRRAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFAN 374

Query: 422 NGNVKPFLHTTTNNNMQPNND 442
           + N     H TT    Q   D
Sbjct: 375 DSNS----HATTQAREQTPPD 391

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 11/72 (15%)

Query: 350 NDNICI---VCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWME 406
           NDN C+   +CM +L  ++H ++  E  +A+I     +      PC H+ H  CL+NWM 
Sbjct: 687 NDNYCVSCAICMSEL--AIHVEDIPETHKANIHDYMVT------PCSHLFHTGCLENWMS 738

Query: 407 RSQTCPICRLPV 418
               CP+CR P+
Sbjct: 739 YKLQCPVCRAPL 750

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 39/73 (53%), Gaps = 10/73 (13%)

Query: 346 VENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWM 405
           VEN  D  C +CM D VP ++ +E  E  + D  S   +      PC H+ H SCL+NWM
Sbjct: 693 VENTVD--CAICMSD-VP-IYIEEIPETHKVDQHSYMVT------PCNHVFHTSCLENWM 742

Query: 406 ERSQTCPICRLPV 418
                CP+CR P+
Sbjct: 743 SYKLQCPVCRSPL 755

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 72/183 (39%), Gaps = 40/183 (21%)

Query: 277 YEKLIDVSTKF-FKTIVHIFVLIQT-------KLQIMVLKDVVWD----CLTLYQDSISL 324
           ++++I ++ +F    +   F L +        KL +  L ++  D    C   ++D  S+
Sbjct: 134 FQEVIGIAAQFAVSRVTRRFSLFRGLSKESFEKLPLKSLNEINGDICSICYEDFEDDASV 193

Query: 325 WKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKS 384
           W   K N+ LD +   +    VE ++    +       PS+   EA +    ++  +S S
Sbjct: 194 WS--KRNRSLDGETSVVKRQRVEGNS--TPLQNPSRSTPSVQSPEAADAGTNEVSEVSAS 249

Query: 385 KR------------------------PKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFD 420
                                     P +LPCGH+    C+  W +   +CPICR  + +
Sbjct: 250 GPFAPGADAPDTPAPETSNQMDYKHCPTELPCGHIFGRDCIFKWTKEHNSCPICRSRIVE 309

Query: 421 ENG 423
           + G
Sbjct: 310 DEG 312

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM +    ++ +E  E  Q D DS   +      PC HM H SCL++WM     CP+
Sbjct: 698 CAICMAEF--PVYVEELPETHQVDKDSYMIT------PCDHMFHTSCLESWMSYKLQCPV 749

Query: 414 CRLPV 418
           CR P+
Sbjct: 750 CRSPL 754

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 8/65 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM D VP ++  +  E  + DI+S   +      PCGH+ H  CL++WM     CP+
Sbjct: 692 CAICMTD-VP-IYVSDIEETHKVDINSYMVT------PCGHIFHTQCLESWMSYKLQCPV 743

Query: 414 CRLPV 418
           CR P+
Sbjct: 744 CRAPL 748

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 8/65 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM + VP ++ ++  E  + D+ +   +      PCGH+ H  CL+NWM     CP+
Sbjct: 703 CAICMSE-VP-VYVEDVPETHKVDLQTYMTT------PCGHVFHTQCLENWMSYKLQCPV 754

Query: 414 CRLPV 418
           CR P+
Sbjct: 755 CRSPL 759

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM D VP ++ +E  E  + D  S   +      PC H+ H SCL+NWM     CP+
Sbjct: 699 CTICMSD-VP-IYIEEIPETHKVDQHSYMVT------PCDHVFHTSCLENWMSYKLQCPV 750

Query: 414 CRLPV 418
           CR P+
Sbjct: 751 CRSPL 755

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM D VP ++ +E  E  + D  S   +      PC H+ H SCL+NWM     CP+
Sbjct: 699 CAICMSD-VP-IYIEEIPETHKVDQHSYMVT------PCNHVFHTSCLENWMNYKLQCPV 750

Query: 414 CRLPV 418
           CR P+
Sbjct: 751 CRSPL 755

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM D VP ++ +E  E  + D  S   +      PC H+ H  CL+NWM     CP+
Sbjct: 700 CAICMSD-VP-IYIEEVPETHKVDQHSYMVT------PCNHVFHTPCLENWMSYKLQCPV 751

Query: 414 CRLPV 418
           CR P+
Sbjct: 752 CRSPL 756

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 55/118 (46%), Gaps = 12/118 (10%)

Query: 301 KLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDD 360
           +L IM  +D++     L Q SI    IY     L      L+ ++  + +   C +CM +
Sbjct: 653 QLSIMYSQDILGARWFLPQHSIPEGYIYFKPVSLAH----LAKHEGASKHTADCAICMSE 708

Query: 361 LVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPV 418
            VP ++ +EA E    D  S   +      PC H+ H  CL+NWM     CP+CR P+
Sbjct: 709 -VP-VYIEEAEETHNIDQHSYMVT------PCDHIFHTDCLENWMGYKLQCPVCRTPL 758

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM ++   ++ +E  E  + D  S   +      PC H+ H SCL+NWM     CP+
Sbjct: 702 CSICMSEI--PVYVEELPETHKVDQHSYMVT------PCNHIFHTSCLENWMSYKLQCPV 753

Query: 414 CRLPV 418
           CR P+
Sbjct: 754 CRAPL 758

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 353 ICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCP 412
           +C +CM D VP ++ +E  E  + D  S   +      PC H+ H  CL+NWM     CP
Sbjct: 697 VCPICMVD-VP-VYVEETEETHKIDAQSYMIT------PCSHIFHTECLENWMSYKLQCP 748

Query: 413 ICRLPV 418
           +CR P+
Sbjct: 749 VCRAPL 754

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 8/65 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM ++   +   E       D   I+        PC H+ H +CL+NWM     CP+
Sbjct: 691 CTICMSEVPVYIQDIEETHNIDKDTYMIT--------PCNHIFHTTCLENWMSYKLQCPV 742

Query: 414 CRLPV 418
           CR P+
Sbjct: 743 CRAPL 747

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 362 VPSLHGKEAVEMTQADI---DSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPV 418
            P+    E  +  +AD    +SI+    P KLPCGH+    C++ W     TCPICR  +
Sbjct: 198 TPAPSTSEPPKENEADTNNQESIAYKHSPLKLPCGHIFGRECIRQWTNEHNTCPICRARI 257

Query: 419 FDENG 423
              +G
Sbjct: 258 VGADG 262

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 20/81 (24%)

Query: 344 NDVENDNDNICIVCMDDL------VPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLH 397
           +   +D+   C +CM ++      VP+ H        + D+DS   +      PC H+ H
Sbjct: 685 HGASSDHTVDCAICMSEVPVYVDDVPTTH--------KVDLDSFMIT------PCNHVFH 730

Query: 398 LSCLKNWMERSQTCPICRLPV 418
             CL+NWM     CP+CR P+
Sbjct: 731 TQCLENWMGYKLQCPVCRAPL 751

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM + VP ++ K+  E    D  S   +      PC H+ H +CL+NWM     CP+
Sbjct: 698 CAICMSE-VP-VYVKDIPETHAVDQQSYMVT------PCNHIFHTACLENWMGYKLQCPV 749

Query: 414 CRLPV 418
           CR P+
Sbjct: 750 CRAPL 754

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 32/75 (42%), Gaps = 2/75 (2%)

Query: 347 ENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWME 406
           EN++D      + D   S H     E  Q D  +   S     LPCGH+    CL  W  
Sbjct: 176 ENESDQRVDNELPDPESSAHHTGEQEGGQEDTPTYGHSA--TVLPCGHVFGRECLYKWTT 233

Query: 407 RSQTCPICRLPVFDE 421
              +CPICR P+  E
Sbjct: 234 EHNSCPICRAPILSE 248

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 18/70 (25%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKK-----LPCGHMLHLSCLKNWMERS 408
           C +CM+D VP              +D I K+ +  K      PC H+ H  CL++WM   
Sbjct: 688 CAICMND-VPVY------------VDDIPKTHKVDKESYMITPCSHIFHTQCLESWMSYK 734

Query: 409 QTCPICRLPV 418
             CP+CR P+
Sbjct: 735 LQCPVCRAPL 744

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM + VP +  +E  E  + D  +   +      PC H+ H  CL+NWM     CP+
Sbjct: 706 CAICMSE-VP-IRVEEVPETHKVDEQTYMVT------PCAHIFHTQCLENWMSYKLQCPV 757

Query: 414 CRLPV 418
           CR P+
Sbjct: 758 CRSPL 762

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 12/67 (17%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKL--PCGHMLHLSCLKNWMERSQTC 411
           C +CM +          V +   DI    K+   + +  PC H+ H  CL+NWM     C
Sbjct: 699 CAICMSE----------VAIYVEDIPETHKTNPNEYMVTPCAHVFHTECLENWMSYKLQC 748

Query: 412 PICRLPV 418
           P+CR P+
Sbjct: 749 PVCRAPL 755

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM ++  +++  +  E  + D D    +      PC H+ H  CL++WM     CP+
Sbjct: 691 CAICMSEV--AVYVDDIPETHKVDKDDYMIT------PCSHIFHTQCLESWMSYKLQCPV 742

Query: 414 CRLPV 418
           CR P+
Sbjct: 743 CRAPL 747

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 8/65 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM  +   L+  +  E  + D  S   +      PC H+ H  CL+NWM     CP+
Sbjct: 703 CSICMSGI--PLYVDDKPETHKVDQYSYMVT------PCNHIFHTECLENWMSYKLQCPV 754

Query: 414 CRLPV 418
           CR P+
Sbjct: 755 CRTPL 759

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 8/77 (10%)

Query: 357 CMDDLVPSLHGKEAVEMTQADIDSISKSK-RPKKLP-------CGHMLHLSCLKNWMERS 408
           C D  + SL   E  ++  A+  SI     R  K P       C H   L C+  W+ +S
Sbjct: 13  CPDTYIDSLPRVEKGKLKDAEACSICCCNYRDDKYPLVVELPHCNHRFDLECVAVWLSKS 72

Query: 409 QTCPICRLPVFDENGNV 425
           +TCP+CR  V     NV
Sbjct: 73  RTCPLCRDDVLSHKPNV 89

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 49/117 (41%), Gaps = 37/117 (31%)

Query: 336 DKLPTLSVNDVE-NDNDNICIVCMDDLVP--------SLHGKEAVEMTQAD---IDSISK 383
           +KLP L+++D++ N +D  C +C +  V         SL G ++ E   A    ID+ + 
Sbjct: 142 EKLPVLTLDDLKKNGSDLQCSICFEPYVADATTTKKRSLSGTDSEEPGNAKKRKIDATTA 201

Query: 384 SK-------------------------RPKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           S                           P KLPCGH+    CL  W +   TCP+CR
Sbjct: 202 STPTSNEPEPTTTVEDNDEEAHPTYNHSPTKLPCGHIFGRECLYRWCKLENTCPLCR 258

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 8/62 (12%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +CM  +   ++ +E     + DI S   +      PC H+ H  CL+NWM     CP+
Sbjct: 703 CAICMSPV--PVYIEEVEGTHKVDIHSYMVT------PCNHIFHTECLENWMGYKLQCPV 754

Query: 414 CR 415
           CR
Sbjct: 755 CR 756

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 19/79 (24%)

Query: 338 LPTLSVNDVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLP-CGHML 396
           LP L ++D+++  ++ C +C                T AD     K     KLP CGH  
Sbjct: 18  LPRLKLSDLKDPINDSCSICC--------------CTYAD----DKYPLISKLPHCGHNF 59

Query: 397 HLSCLKNWMERSQTCPICR 415
              CL  W+ +++TCP+CR
Sbjct: 60  DYECLSIWLSKNKTCPMCR 78

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 41.6 bits (96), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICRLPVF 419
           +LP CGH   L C+  W+ RS TCP+CR  V 
Sbjct: 107 ELPNCGHTFDLQCVSVWLSRSTTCPMCRSDVL 138

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%)

Query: 384 SKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDENGN 424
           S  P KLPCGH+    CL  W +   TCP+CR  + + N N
Sbjct: 296 SHSPLKLPCGHIFGRECLFKWSKVENTCPLCRHVIIENNQN 336

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P K+PCGH+   SCL  W     +CP+CR
Sbjct: 290 PVKIPCGHIFGRSCLYEWTRLENSCPLCR 318

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 370 AVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICR 415
            V+  Q++ DS +    P +LPC H+    CL  W     TCP+CR
Sbjct: 259 GVDTIQSEEDSPTYLHSPTELPCKHIFGRECLYKWTRVQNTCPLCR 304

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 39.7 bits (91), Expect = 0.004,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICRLPVFDENGNV 425
           +LP CGH   L CL  W  +S +CP+CR  V      V
Sbjct: 92  RLPHCGHDFDLECLSVWFSKSTSCPLCRDDVLSHRAEV 129

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 40.0 bits (92), Expect = 0.004,   Method: Composition-based stats.
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICR 415
           +LP C H   L CL  W+ RS TCP+CR
Sbjct: 124 ELPHCNHRFDLECLSVWLSRSTTCPLCR 151

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 39.7 bits (91), Expect = 0.005,   Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICR 415
           KLP C H   L C+  W+ +S+TCP+CR
Sbjct: 100 KLPHCSHRFDLECVAVWLSKSRTCPLCR 127

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 39.7 bits (91), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICR 415
           +LP C H   L CL  W+ RS TCP+CR
Sbjct: 96  ELPHCHHKFDLECLSVWLSRSTTCPLCR 123

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 332 KQLDDKLPTLSVNDVENDNDNICIVCMDDLVPSLHGKEAVEM------TQADIDSISKSK 385
           K LDD   T S N++         V +D  +  +   +  +M      ++  I  +++ K
Sbjct: 227 KPLDDGTVTTSNNEISG-------VPLDSSIRHVDLSDPAQMPFINESSRKCILCLTEMK 279

Query: 386 RPKKLPCGHMLHLSCLKNWMERSQTCPICR 415
            P   PCGH+   +C+ NW +    CP+CR
Sbjct: 280 DPSCAPCGHIFCWNCIINWCKERSECPLCR 309

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 39.7 bits (91), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 8/73 (10%)

Query: 357 CMDDLVPSLHGKEAVEMTQADIDSISKSKRPK-------KLP-CGHMLHLSCLKNWMERS 408
           C  + + SL    A  + + D  SI  SK  +       +LP C H   L CL  W+ ++
Sbjct: 64  CSQEFIDSLPRITARNLVKGDECSICCSKYNEDDYPLVVELPHCSHRFDLECLTPWLLKN 123

Query: 409 QTCPICRLPVFDE 421
            TCP+CR  V ++
Sbjct: 124 STCPLCRDDVMEK 136

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDENG 423
           P KLPCGH+    C+  W +   +CP+CR  + +  G
Sbjct: 251 PIKLPCGHIFGRECIYKWSKLENSCPLCRHKISESAG 287

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 28/100 (28%)

Query: 331 NKQLDDKLPTLSVNDVENDNDNICIVC----MDDLVPSLHGKEAVEMTQADIDSISKSKR 386
           +K+  D LP +  N +++ N   C +C    ++D  P +                     
Sbjct: 82  SKEFIDSLPRIKANSIKDKNAE-CAICFCKFLEDKYPLV--------------------- 119

Query: 387 PKKLP-CGHMLHLSCLKNWMERSQTCPICRLPVFDENGNV 425
             +LP CGH   L C+  W+ +S TCP+CR  V     ++
Sbjct: 120 -AELPHCGHRFDLECISVWLSKSDTCPLCRDSVLSHKTDI 158

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 39.7 bits (91), Expect = 0.007,   Method: Composition-based stats.
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICR 415
           +LP C H   L CL  W+ RS TCP+CR
Sbjct: 126 ELPHCHHKFDLECLSVWLSRSTTCPLCR 153

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 27/68 (39%), Gaps = 23/68 (33%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           CI+C++D+V                        P   PCGH+    CL +W +    CP+
Sbjct: 290 CILCLNDMV-----------------------DPSCSPCGHIFCWRCLMDWCQERAECPL 326

Query: 414 CRLPVFDE 421
           CR P   +
Sbjct: 327 CRQPCLPQ 334

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDENG 423
           P KLPCGH+    C+  W     +CP+CR  + +  G
Sbjct: 262 PIKLPCGHIFGRECIYKWSRLENSCPLCRHKISENAG 298

>TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [978
           bp, 325 aa] {ON} Anc_5.628 YDR265W
          Length = 325

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 45/108 (41%), Gaps = 25/108 (23%)

Query: 308 KDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDLVPSLHG 367
           K +++D   +  + ++   +  NN+++D K P +     E      CI+CM  ++     
Sbjct: 231 KTLIYDDNPISLNKVTTKNVKYNNEKIDLKNPKILPYIPEESRK--CILCMSFMI----- 283

Query: 368 KEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICR 415
                              P   PCGH+   +CL NW +  + CP+CR
Sbjct: 284 ------------------NPSCAPCGHIYCWNCLINWCKEKEECPLCR 313

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P KLPCGH+    C+  W     +CP+CR
Sbjct: 335 PTKLPCGHIFGRDCIFKWSHLENSCPLCR 363

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDENG 423
           P +LPC H+    C++ W     TCPICR  +   +G
Sbjct: 222 PVQLPCSHVFGRECIRQWTNLHNTCPICRANIVGADG 258

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDENG 423
           P +LPCGH+    CL  W     +CP+CR  + +  G
Sbjct: 270 PIRLPCGHVFGRECLYKWSRLENSCPLCRHKISESAG 306

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P KLPCGH+    C+  W     +CP+CR
Sbjct: 252 PIKLPCGHIFGRECIYKWSRLENSCPLCR 280

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P  LPCGHM   +C+  W      CP+CR
Sbjct: 276 PSCLPCGHMFCWACVMQWCNERNECPLCR 304

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P  LPCGH+    C+ +W + +  CP+CR
Sbjct: 287 PSCLPCGHVFCWDCITDWTKENPECPLCR 315

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P   PCGH+   +C+ NW +  + CP+CR
Sbjct: 328 PSCPPCGHLFCWACIMNWCKEREECPLCR 356

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 46/119 (38%), Gaps = 26/119 (21%)

Query: 344 NDVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKK---------LPCGH 394
           N++ ND D  C +C++ L    +       TQ  +   +K   P K         +PC H
Sbjct: 132 NELAND-DETCCICLELLKTQEYD---TITTQDGMRVKTKGGPPTKSIKDTDIVMIPCQH 187

Query: 395 MLHLSCLKNWM-------ERSQTCPICRLPVFDEN------GNVKPFLHTTTNNNMQPN 440
             H  CLK W         R   CP+CR+ +          G +   L  T N++  PN
Sbjct: 188 YFHAGCLKEWFSPQRRGKRRPLVCPLCRMDIVKCKAFCMRLGLLMSELKVTLNSHTSPN 246

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICRLPVF 419
           +PC H  H  CL  W  ++  CP+CRL  F
Sbjct: 264 IPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 37.0 bits (84), Expect = 0.022,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      +   MT  D D ++         C H  HL C+  W
Sbjct: 50  DIAVDN---CAICRNHIMEPCIECQPKAMTDTDTDCVAAWG-----TCNHAFHLHCINKW 101

Query: 405 MERSQTCPICRLP 417
           ++  + CP+   P
Sbjct: 102 IKTREACPLDNQP 114

>Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON}
           (83624..84610) [987 nt, 329 aa]
          Length = 328

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P   PCGH+    C+ NW +    CP+CR
Sbjct: 288 PSAAPCGHIFCWDCIINWCKERPECPLCR 316

>NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 26/107 (24%)

Query: 334 LDDKLPTLSVNDVENDNDNI-----CIVCMD--DLVPSLHGKEAVE-MTQADIDSISKSK 385
           +D K+P     ++   +D I     CI+C++   +VPS +  E  +  T+   D I    
Sbjct: 124 MDKKIPIDRFVEMSTKDDRIPINECCIICLERVKVVPSTNDLEKQQNGTEQTTDMIPS-- 181

Query: 386 RPKKLPCGHMLHLSCLKNWME------RSQT----------CPICRL 416
           +  KLPC H  H  C+K+W        +S T          CP+CRL
Sbjct: 182 KVVKLPCEHYFHKCCIKDWFSTIRKGMKSSTHSFAIGPTYFCPLCRL 228

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P   PCGH+   SCL +W +    CP+CR
Sbjct: 296 PSCAPCGHLFCWSCLMSWCKERPECPLCR 324

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDENG 423
           P +L CGH+    C+  W + + +CPICR  +    G
Sbjct: 226 PTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P   PCGH+    CL NW +    CP+CR
Sbjct: 289 PSCAPCGHLFCWDCLLNWSKERPECPLCR 317

>KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}
           Anc_5.628 YDR265W
          Length = 327

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 381 ISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           +SK   P   PCGH+    C+ NW      CP+CR
Sbjct: 281 LSKIVDPSCAPCGHLYCWDCILNWCNEKPECPLCR 315

>Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp,
           320 aa] {ON} similar to Ashbya gossypii AER390W
           1-intron
          Length = 320

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P  LPCGH+   +C+ +W      CP+CR
Sbjct: 280 PSCLPCGHLFCWNCIMHWCTERSECPLCR 308

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
           {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 29/69 (42%), Gaps = 20/69 (28%)

Query: 349 DNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERS 408
           + DNIC +C DDL               D D +    + K  PC H  H  C++ W   S
Sbjct: 7   EGDNICPICFDDL--------------NDTDIL----QGKLKPCNHKYHYDCIRRWHGYS 48

Query: 409 QT--CPICR 415
               CP+CR
Sbjct: 49  DNSDCPLCR 57

>KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 305

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P   PCGH+    C+  W    Q CP+CR
Sbjct: 265 PSATPCGHLFCWDCIMEWTLERQECPLCR 293

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 392  CGHMLHLSCLKNWMERSQTCPICRLPV 418
            CGH+   SC+ +W++  +TCP+C+ P 
Sbjct: 1179 CGHLFCTSCIFSWLKNRKTCPLCKHPT 1205

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 385 KRPKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           + P +LPC H+    CL  W     TCP+CR
Sbjct: 257 ESPVELPCHHIFGRECLYKWTRHENTCPLCR 287

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICR 415
           +LP CGH     C+  W+ +++TCPICR
Sbjct: 123 QLPHCGHHFDFECISIWLSKNETCPICR 150

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 36.2 bits (82), Expect = 0.040,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      +   MT  D + ++         CGH  HL C+  W
Sbjct: 42  DIAVDN---CAICRNHIMEPCIECQPKAMTDTDNECVAAWG-----ACGHAFHLHCINKW 93

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 94  IKTRDACPLDNQP 106

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P KLPC H+    CL  W +   +CP+CR
Sbjct: 241 PVKLPCDHIFGRECLYKWSKLENSCPLCR 269

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 37.0 bits (84), Expect = 0.047,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICR 415
           +LP CGH     C+  W+ ++ TCP+CR
Sbjct: 121 ELPHCGHKFDFECVSMWLTKNTTCPMCR 148

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 18/37 (48%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDENG 423
           P +L CGH     C+  W +   +CPICR  +    G
Sbjct: 242 PTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREG 278

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 3/29 (10%)

Query: 390 LPCGHMLHLSCLKNWME---RSQTCPICR 415
           +PCGH  HL+C++ W      +++CP+CR
Sbjct: 33  MPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W
           (PEX10) - C3HC4 zinc-binding integral peroxisomal
           membrane protein [contig 157] PARTIAL
          Length = 152

 Score = 36.6 bits (83), Expect = 0.048,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 17/36 (47%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDEN 422
           P   PCGH+    CL +W      CP+CR     +N
Sbjct: 112 PSCAPCGHVFCWKCLLSWCNERPECPLCRQTCHAQN 147

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 37.0 bits (84), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICRLPVF 419
           +LP C H   L CL  W+ RS TCP+CR  V 
Sbjct: 131 ELPHCHHKFDLECLSVWLSRSTTCPLCRDDVM 162

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 36.6 bits (83), Expect = 0.063,   Method: Composition-based stats.
 Identities = 34/138 (24%), Positives = 57/138 (41%), Gaps = 38/138 (27%)

Query: 329 KNNKQLDDKLPTLSVNDVENDNDN-ICIVCMDDLVPSLHGKEAVE-MTQAD--------I 378
           +   Q  +   T   N+ E D DN + ++ +  ++P+   +E +E M Q+D        I
Sbjct: 27  ETRSQFQELFQTFGNNNSEEDVDNSMLLLLLSQMIPASLQQEWMEQMEQSDKKGCSESFI 86

Query: 379 DSI-----SKSKRPKKLP-------------------CGHMLHLSCLKNWMERSQTCPIC 414
           DS+     SK K     P                   C H   L C+  W+ +S +CP+C
Sbjct: 87  DSLPRIPASKIKEDDSCPICCCTYKEDDHPLVAELPHCNHKFDLECISVWLSKSTSCPLC 146

Query: 415 RLPVFDENGNVKPFLHTT 432
           R    D+  + KP + T+
Sbjct: 147 R----DDVMSHKPGIDTS 160

>Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P   PCGH+   +CL +W +    CP+CR
Sbjct: 296 PSCTPCGHLFCWNCLMSWCKERPECPLCR 324

>Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P   PCGH+    CL +W +    CP+CR
Sbjct: 296 PSCTPCGHLFCWDCLMSWCKERPECPLCR 324

>Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P   PCGH+    CL +W +    CP+CR
Sbjct: 296 PSCAPCGHLFCWDCLMSWCKERPECPLCR 324

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P +LPC H+    CL  W +   +CP+CR
Sbjct: 298 PVQLPCAHIFGRECLDKWSQIENSCPLCR 326

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICRLPVF 419
           +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 258 IPCQHTFHCQCLDKW--KNSQCPVCRYSSF 285

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 35.8 bits (81), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICR 415
           KLP C H   L C+  W+ +S TCP+CR
Sbjct: 107 KLPNCNHKFDLQCITLWLSKSSTCPMCR 134

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%)

Query: 387 PKKLPCGHMLHLSCLKNWME---RSQTCPICRLPV 418
            K +PC H  HLSC++ W       +TCP CR+ +
Sbjct: 21  AKLIPCQHEFHLSCIRKWYHSRISDRTCPNCRVEI 55

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 17/26 (65%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICR 415
            + CGH     C+ +W++  +TCPIC+
Sbjct: 1190 MKCGHFFCRDCIHSWLKNQRTCPICK 1215

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 2/30 (6%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICRLPVF 419
           +PC H  H  CL  W  ++  CPICR    
Sbjct: 300 IPCQHTFHCQCLNKW--KNSKCPICRFSTL 327

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 378 IDSISKSKRPKKLPCGHMLHLSCLKNWMERSQ--TCPICRLPVFDENGNVKPFLHT 431
           +D+I KS   K  PC H  H+ C++ W   S    CP CR+     + N+ P + +
Sbjct: 23  LDAIDKS-IAKLEPCNHKYHIDCIRTWHNYSNDLNCPTCRIETNQLSVNIYPEIQS 77

>TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON}
           Anc_5.628 YDR265W
          Length = 278

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 17/35 (48%)

Query: 381 ISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           +SK   P   PCGH+    C+ +W      CP CR
Sbjct: 232 LSKITDPSVGPCGHIFCWDCIVDWCRERPECPFCR 266

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 34.7 bits (78), Expect = 0.15,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 31/73 (42%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      + + MT  D + ++         C H  HL C+  W
Sbjct: 46  DIAVDN---CAICRNHIMEPCIECQPLAMTDTDNECVAAWG-----TCNHAFHLHCINKW 97

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 98  IKTRDACPLDNQP 110

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%)

Query: 390 LP-CGHMLHLSCLKNWMERSQTCPICR 415
           LP C H  H  C+K W++++  CP+CR
Sbjct: 228 LPNCSHHFHFECIKLWLQKNSLCPLCR 254

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 258 IPCSHTFHCQCLDKW--KNSKCPVCR 281

>TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa]
           {ON} Anc_5.628 YDR265W
          Length = 326

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P   PCGH+    C+ +W +    CP+CR
Sbjct: 286 PSCAPCGHIFCWDCILSWCKERPECPLCR 314

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICRLPVF 419
           +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 188 IPCQHTFHCQCLNRW--KNSKCPVCRYSSF 215

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 33.9 bits (76), Expect = 0.22,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 31/73 (42%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      + + MT+ D + +          C H  HL C+  W
Sbjct: 39  DIAVDN---CAICRNHIMEPCIECQPMAMTETDNECVVAWA-----ACNHAFHLHCINKW 90

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 91  IKTRDACPLDNQP 103

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 2/29 (6%)

Query: 390  LPCGHMLHLSCLKNWMERS--QTCPICRL 416
            L CGH     C+ NW+E+S  + CPIC++
Sbjct: 1150 LKCGHYYCQDCIWNWLEKSKKKNCPICKI 1178

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 371 VEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQ--TCPICR 415
           +E+    ++S++++ + + LPC H  H+SC++ W   S    CP CR
Sbjct: 2   IEICGICLESMNETDQGELLPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>SAKL0G13134g Chr7 (1127910..1133723) [5814 bp, 1937 aa] {ON} similar
            to uniprot|P19812 Saccharomyces cerevisiae YGR184C UBR1
            Ubiquitin-protein ligase (E3) that interacts with
            Rad6p/Ubc2p to ubiquitinate substrates of the N-end rule
            pathway binds to the Rpn2p Rpt1p and Rpt6p proteins of
            the 19S particle of the 26S proteasome
          Length = 1937

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 15/73 (20%)

Query: 359  DDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQ------TCP 412
            DD  P++H  + +E  +   D  +K  R   + C H +H  C K ++++ +       CP
Sbjct: 1243 DDEHPTVHDDKTLESYR---DDGTKGSRKVFVSCNHHIHYECFKRYVQKKRFSSHLFICP 1299

Query: 413  ICR------LPVF 419
            +C+      LPV+
Sbjct: 1300 LCQTFSNCVLPVY 1312

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICR 415
           K+P C H   L CL  W++ + TCP+CR
Sbjct: 88  KVPRCNHKFDLECLSIWLQNNHTCPMCR 115

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICR 415
           +LP CGH+  L C+  W+    TCP+CR
Sbjct: 109 QLPHCGHIFDLQCISMWLSNQVTCPMCR 136

>NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5.628
           YDR265W
          Length = 330

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P   PCGH+    C+ +W +    CP+CR
Sbjct: 290 PSCSPCGHIFCWECILDWCKERPECPLCR 318

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 252 IPCQHTFHCQCLDKW--KNSKCPVCR 275

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 33.9 bits (76), Expect = 0.29,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 31/73 (42%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      + + MT  D + ++         C H  HL C+  W
Sbjct: 44  DIAVDN---CAICRNHIMEPCIECQPMAMTDTDNECVAAWG-----VCNHAFHLHCINKW 95

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 96  IKTRDACPLDNQP 108

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H SCL  W      CP+CR
Sbjct: 285 IPCQHTFHCSCLDKW--NDSRCPVCR 308

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICRLPVFDENGNV 425
           +LP C H   L C+  W+ +S TCP+CR  V +   N+
Sbjct: 66  ELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNI 103

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 33.5 bits (75), Expect = 0.32,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 31/73 (42%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      +   MT+ D + ++         C H  HL C+  W
Sbjct: 35  DIAVDN---CAICRNHIMEPCIECQPNAMTETDNECVAAWG-----TCNHAFHLHCINKW 86

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 87  IKTRDACPLDNQP 99

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 33.5 bits (75), Expect = 0.33,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 26/64 (40%), Gaps = 5/64 (7%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +C + ++      +   MT  D + ++         C H  HL C+  W++    CP+
Sbjct: 45  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWG-----TCNHAFHLHCINKWLQTRNACPL 99

Query: 414 CRLP 417
              P
Sbjct: 100 DNQP 103

>ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} similar to
            uniprot|Q06554 Saccharomyces cerevisiae YLR247C
            Hypothetical ORF
          Length = 1520

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 18/26 (69%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICR 415
            + CGH     C+ +W++ +Q+CP+C+
Sbjct: 1214 IKCGHFFCRKCIHSWLKNNQSCPLCK 1239

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 29/66 (43%), Gaps = 21/66 (31%)

Query: 353 ICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQ--T 410
           +C +C++D+     GK +    +               PCGH  H  C++ W   ++   
Sbjct: 5   VCAICLEDIC----GKSSTSYLK---------------PCGHEYHSDCIRKWHGHAEDLK 45

Query: 411 CPICRL 416
           CP+CR+
Sbjct: 46  CPMCRI 51

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {ON}
           Anc_8.808 YOL054W
          Length = 392

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 5/50 (10%)

Query: 387 PKKLPCGHMLHLSCLKNWM----ERSQTCPICRLPVFDENGNVKPFLHTT 432
           P    CGH     CLK+W+    ++   CP CR  + D   N+ PF+  T
Sbjct: 40  PMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITD-TPNLNPFIQQT 88

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 251 IPCQHTFHCQCLDKW--KNSKCPVCR 274

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score = 34.3 bits (77), Expect = 0.36,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 41/95 (43%), Gaps = 21/95 (22%)

Query: 324 LWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISK 383
           +W I KN  +LD+ +         ++++++C +C      S H          +  +I  
Sbjct: 15  VWDIPKNEDRLDESMA--------DEDEDVCGICR----ASYHAPCPNCRYPGESCAIVL 62

Query: 384 SKRPKKLPCGHMLHLSCLKNWMERSQT---CPICR 415
            +      CGH  H+ C+  W++   +   CP+CR
Sbjct: 63  GR------CGHNFHVHCISRWVDTPTSKGLCPMCR 91

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICRLPVFDE 421
           +LP C H   L C+  W++++ +CPICR  V ++
Sbjct: 132 ELPNCKHYFDLECITLWLQKNSSCPICRNDVLEK 165

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 255 IPCQHTFHCQCLDKW--KNSRCPVCR 278

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 33.9 bits (76), Expect = 0.40,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 26/64 (40%), Gaps = 5/64 (7%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +C + ++      +   MT  D + ++         C H  HL C+  W++    CP+
Sbjct: 72  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWG-----TCNHAFHLHCINKWLQTRNACPL 126

Query: 414 CRLP 417
              P
Sbjct: 127 DNQP 130

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 392  CGHMLHLSCLKNWMERSQTCPICRLPV 418
            CGH    SC+  W++   TCP+C+  V
Sbjct: 1179 CGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 33.1 bits (74), Expect = 0.43,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 25/60 (41%), Gaps = 5/60 (8%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPI 413
           C +C + ++      +   MT  D + ++         C H  HL C+  W++    CP+
Sbjct: 44  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWG-----ACNHAFHLHCINKWLQTRNACPL 98

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 251 IPCQHTFHCQCLDKW--KNSRCPVCR 274

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 15/24 (62%)

Query: 392  CGHMLHLSCLKNWMERSQTCPICR 415
            CGH    SC+  W++   TCP+C+
Sbjct: 1179 CGHFFCYSCIHTWLKEHNTCPLCK 1202

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 33.1 bits (74), Expect = 0.44,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      +   MT  D + ++         C H  HL C+  W
Sbjct: 30  DIAVDN---CAICRNHIMEPCIECQPKAMTDTDNECVAAWG-----TCNHAFHLHCINKW 81

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 82  IKTRDACPLDNQP 94

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 8/26 (30%), Positives = 17/26 (65%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICR 415
            + CGH     C+++W++   +CP+C+
Sbjct: 1239 IKCGHFFCKKCIQSWLKNKNSCPLCK 1264

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H  CL  W  +   CP+CR
Sbjct: 264 IPCQHTFHCQCLNKW--KDSRCPVCR 287

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 16/27 (59%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICRL 416
            + CGH    SC+ +W+     CP+C++
Sbjct: 1177 IKCGHFFCKSCIHSWLRNKNACPLCKM 1203

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 33.1 bits (74), Expect = 0.54,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      +   MT  D + ++         C H  HL C+  W
Sbjct: 51  DIAVDN---CAICRNHIMEPCIECQPKAMTDTDNECVAAWG-----VCNHAFHLHCINKW 102

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 103 IQTRDACPLDNQP 115

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H  CL  W  +   CP+CR
Sbjct: 254 IPCQHTFHCQCLDKW--KDSRCPVCR 277

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICR 415
            + CGH    SC+ +W++   +CP+C+
Sbjct: 1167 IKCGHFFCRSCIHSWLKNHNSCPMCK 1192

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 33.1 bits (74), Expect = 0.62,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      +   MT  D + ++         C H  HL C+  W
Sbjct: 49  DIAVDN---CAICRNHIMEPCIECQPKAMTDTDNECVAAWG-----VCNHAFHLHCINKW 100

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 101 IKTRDACPLDNQP 113

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 2/27 (7%)

Query: 392 CGHMLHLSCLKNWMERS--QTCPICRL 416
           CGH  HL+C++ W + S    CPICR+
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 17/27 (62%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICRL 416
            L CGH     C+ +W++  + CP+C++
Sbjct: 1204 LKCGHFFCKRCITSWLKNKKNCPMCKM 1230

>SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conserved
           hypothetical protein
          Length = 662

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 391 PCGHMLHLSCLKNWMERSQTCPICRLPVFD 420
           PCGH +H  C   + + S  CP C++ V +
Sbjct: 399 PCGHAIHQHCFDEYTKHSYKCPHCQVTVLN 428

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 32.7 bits (73), Expect = 0.69,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      +   MT  D + ++         C H  HL C+  W
Sbjct: 37  DIAVDN---CAICRNHIMEPCIECQPKAMTDTDNECVAAWG-----TCNHAFHLHCINKW 88

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 89  IKTRDACPLDNQP 101

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score = 33.1 bits (74), Expect = 0.73,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 392 CGHMLHLSCLKNWMERSQT---CPICR 415
           C H  H+ C++ W+E +     CP+CR
Sbjct: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 34.7 bits (78), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 391 PCGHMLHLSCLKNWMERSQTCPICRLPVFD 420
           PCGH +H  C   + + S  CP C++ V +
Sbjct: 405 PCGHAIHQHCFDEYTKHSYKCPSCQVSVLN 434

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 32.3 bits (72), Expect = 0.85,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      +   MT  D + ++         C H  HL C+  W
Sbjct: 46  DIAVDN---CAICRNHIMEPCIECQPKAMTDPDNECVAAWG-----VCNHAFHLHCINKW 97

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 98  IKTRDACPLDNQP 110

>Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON}
           (52842..54119) [1278 nt, 426 aa]
          Length = 425

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 9/50 (18%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQT----CPICRLPVFDENGNVKPFLHTT 432
           P  + CGH    SCL +W   ++T    CP CR  V        P L+TT
Sbjct: 46  PMMVACGHNYCYSCLSSWFTSNETQELSCPQCRANV-----TTAPALNTT 90

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 32.3 bits (72), Expect = 0.94,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      +   MT  D + ++         C H  HL C+  W
Sbjct: 49  DIAVDN---CAICRNHIMEPCIECQPKAMTDTDNECVAAWG-----VCNHAFHLHCINKW 100

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 101 IKTRDACPLDNQP 113

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           LPC H+    CL  W +   +CP+CR
Sbjct: 216 LPCNHVFGRECLFKWSQLENSCPLCR 241

>ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} similar
           to uniprot|Q756L3 Ashbya gossypii AER241W AER241Wp and
           weakly similar to uniprot|P32380 Saccharomyces
           cerevisiae YDR356W SPC110 Inner plaque spindle pole body
           (SPB) component
          Length = 835

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 320 DSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNI--CIVCMDDLVPSLHG 367
           D+I+  +++ ++ Q DD LP L+    +NDNDN        DD+V +L G
Sbjct: 65  DTIASHRMFNDSSQFDDTLPQLNGQSADNDNDNAHDSGKETDDVVKNLMG 114

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 389 KLP-CGHMLHLSCLKNWMERSQTCPICRLPVFDENGNVKPFLHTT 432
           +LP C H   L C+  W+  + TCP+CR  V   N N K  + TT
Sbjct: 104 ELPHCSHKFDLQCISVWLSSNSTCPVCRDKV---NHNAKLDIDTT 145

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 32.3 bits (72), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      +   MT  D + ++         C H  HL C+  W
Sbjct: 49  DIAVDN---CAICRNHIMEPCIECQPKAMTDTDNECVAAWG-----VCNHAFHLHCINKW 100

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 101 IKTRDACPLDNQP 113

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 17/26 (65%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICR 415
            L CGH     C+ +W +++ +CP+C+
Sbjct: 1221 LKCGHFFCKDCVTHWFKKNTSCPMCK 1246

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 32.3 bits (72), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 345 DVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNW 404
           D+  DN   C +C + ++      +   MT  D + ++         C H  HL C+  W
Sbjct: 50  DIAVDN---CAICRNHIMEPCIECQPKAMTDTDNECVAAWG-----VCNHAFHLHCINKW 101

Query: 405 MERSQTCPICRLP 417
           ++    CP+   P
Sbjct: 102 IKTRDACPLDNQP 114

>KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.628
           YDR265W
          Length = 309

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 13/29 (44%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P   PCGH     CL  W      CP+CR
Sbjct: 268 PSCAPCGHTYCWDCLFKWCNERPECPLCR 296

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query: 390  LPCGHMLHLSCLKNWM--ERSQTCP 412
            LPCGH  H  C++ W   E  Q CP
Sbjct: 1308 LPCGHEGHFQCIQEWFLDENEQECP 1332

>KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conserved
           hypothetical protein
          Length = 664

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 391 PCGHMLHLSCLKNWMERSQTCPICRLPVFD 420
           PCGH +H  C   + + S  CP C++ + +
Sbjct: 404 PCGHAIHQHCFDEYTKHSYKCPSCQVSILN 433

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
           YOL054W
          Length = 416

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 3/32 (9%)

Query: 387 PKKLPCGHMLHLSCLKNWM---ERSQTCPICR 415
           P   PCGH     CL NW+    +   CP CR
Sbjct: 40  PMMTPCGHNFCYGCLNNWITGGSKDLNCPQCR 71

>NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.157
           YHR115C
          Length = 518

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/149 (18%), Positives = 60/149 (40%), Gaps = 26/149 (17%)

Query: 273 GKFM-YEKLIDVSTKFFKTIVHIFVLIQTKLQIMVLKDVVWDCLTLYQDSISLWKIYKN- 330
           G F+ +++L   ST     ++H   ++Q  +      + ++ C+ +  +    WK+  N 
Sbjct: 345 GTFLNHQRLAPASTMSKDVLLHDGDILQLGMDFRGGTEEIYRCVRMRVELNRSWKLKANA 404

Query: 331 -NKQLDDKLPTLSVNDVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKK 389
            NK+   ++  L +     + +  C +C+  + P     +A+ ++               
Sbjct: 405 FNKEALQRIKNLQMMTTGTEQEEDCSICLSKIRPC----QAIFIS--------------- 445

Query: 390 LPCGHMLHLSCLKNWMERSQT---CPICR 415
            PC H  H  C++  +  S     CP CR
Sbjct: 446 -PCAHSWHFHCIRRLVMLSYPQFVCPNCR 473

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%), Gaps = 2/25 (8%)

Query: 391 PCGHMLHLSCLKNWMERSQTCPICR 415
           PC H  H  CL  W  ++  CP+CR
Sbjct: 233 PCQHTFHCKCLDQW--KNGNCPVCR 255

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICR 415
            L CGH     C+ +W++    CPIC+
Sbjct: 1280 LKCGHFFCEDCIYDWLQTRTICPICK 1305

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 18/27 (66%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICRL 416
            + CGH    SC+ +W++   +CP+C++
Sbjct: 1236 IKCGHFFCQSCIFSWLKNHASCPLCKM 1262

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score = 32.7 bits (73), Expect = 1.4,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 392 CGHMLHLSCLKNWMERSQT---CPICR 415
           C H  H+ C+K W+    +   CP+CR
Sbjct: 87  CNHNFHVHCIKQWLSTETSKGLCPLCR 113

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 2/25 (8%)

Query: 390  LPCGHMLHLSCLKNWM--ERSQTCP 412
            LPCGH  H  C++ W   E+ + CP
Sbjct: 1303 LPCGHEGHFQCIQEWFLNEKERECP 1327

>TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 391 PCGHMLHLSCLKNWMERSQTCPICRLPVFD 420
           PCGH +H  C   +   S  CP C++ V +
Sbjct: 350 PCGHAIHQHCFDEYTRHSYKCPHCQVTVLN 379

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 31.6 bits (70), Expect = 1.6,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 13/26 (50%)

Query: 392 CGHMLHLSCLKNWMERSQTCPICRLP 417
           C H  HL C+  W++    CP+   P
Sbjct: 77  CNHAFHLHCITQWIKSRNVCPLDNKP 102

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 390 LPCGHMLHLSCLKNWMERSQTCPICR 415
           +PC H  H  CL  W +    CP+CR
Sbjct: 244 IPCQHTFHCVCLNKWGD--NRCPVCR 267

>Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] {ON}
            YLR247C (REAL)
          Length = 1560

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICR 415
            + CGH    SC+  W+     CPIC+
Sbjct: 1256 IKCGHYFCKSCILTWLRSHSKCPICK 1281

>CAGL0L11946g Chr12 complement(1282266..1288688) [6423 bp, 2140 aa]
           {ON} similar to uniprot|P32639 Saccharomyces cerevisiae
           YER172c RNA helicase-related protein
          Length = 2140

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 63/131 (48%), Gaps = 17/131 (12%)

Query: 275 FMYEKLIDVSTKFFKTIVHIFVLIQTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQL 334
            + EK+ D + K  K +V   +  +       L+D  ++ L    DSIS +K+  NNK +
Sbjct: 158 LIKEKITDTNAKDLKLVVEKELFTR-------LRDSDFNKLLKLVDSISDYKLVDNNKNV 210

Query: 335 DDKLPTLSVN---DVENDNDNIC-IVCMDDLVPSLHG--KEAVEMTQADIDSI----SKS 384
           +D    L +N   D+ + ND++   + +DD VP  +    E ++  + D DSI    +KS
Sbjct: 211 EDTTVPLVINDGGDIIDTNDSLKNPLLIDDSVPKDNNDYNEKIKNLENDKDSILIKGNKS 270

Query: 385 KRPKKLPCGHM 395
             P  +P   +
Sbjct: 271 YLPTDIPATQL 281

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 3/52 (5%)

Query: 367  GKEAVEMTQADIDSISKSKRPKKLP-CGHMLHLSCLKNWMERS--QTCPICR 415
            G E   +  + + ++ +    K  P C +  H SCL  W   S   TCP+CR
Sbjct: 1533 GFEECAICYSTLHAVDRKLPTKVCPTCNNKFHGSCLYKWFRSSNNNTCPLCR 1584

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQTCPICR 415
           P +L C H+   SCL  W +   +CP+CR
Sbjct: 332 PVQLSCKHIFCRSCLYEWSKLKNSCPLCR 360

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
           {ON} weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 273

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 20/65 (30%)

Query: 354 CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQ--TC 411
           C +C+DD              + +I+SI   +     PC H  H  CL+ W   +    C
Sbjct: 5   CPICLDD-------------DRTNIESIGTLQ-----PCNHKFHRDCLRRWHLYAHDLVC 46

Query: 412 PICRL 416
           PICR+
Sbjct: 47  PICRV 51

>KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]
           {ON} conserved hypothetical protein
          Length = 650

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 391 PCGHMLHLSCLKNWMERSQTCPICRLPVFD 420
           PCGH +H  C   +++ S  CP C + V +
Sbjct: 390 PCGHAIHQHCFDEYIKHSYKCPNCNVSVIN 419

>AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR247C
          Length = 1539

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 15/23 (65%)

Query: 393  GHMLHLSCLKNWMERSQTCPICR 415
            GH     C+ +W+E  Q+CP+C+
Sbjct: 1235 GHFYCQECISSWLETKQSCPLCK 1257

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 14/26 (53%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICR 415
            + CGH    SC+  W+     CPIC+
Sbjct: 1252 IKCGHYFCKSCILTWLRAHSKCPICK 1277

>NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}
           Anc_6.332 YCR066W
          Length = 481

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 385 KRPKKLPCGHMLHLSCLKNWMERSQTCPICRL 416
           K P   PCGH     C++ +++ +  CP+C L
Sbjct: 36  KTPVLTPCGHTFCSVCIREYLQSNSKCPLCLL 67

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1321

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 2/25 (8%)

Query: 390  LPCGHMLHLSCLKNW--MERSQTCP 412
            L CGH  H +CL+ W   E + TCP
Sbjct: 1287 LSCGHEGHFACLREWFITENADTCP 1311

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 4/33 (12%)

Query: 392  CGHMLHLSCLKNWMERSQTCPI---CRLP-VFD 420
            C H+LHL C K W   S+ CP    C  P +FD
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECPTGCGCNCPNMFD 1118

>KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {ON}
           Anc_6.332 YCR066W
          Length = 445

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 385 KRPKKLPCGHMLHLSCLKNWMERSQTCPIC 414
           K P   PCGH     C++ ++ R   CP+C
Sbjct: 36  KVPVLTPCGHTFCSICIREYINRQSKCPLC 65

>Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247C -
            Hypothetical ORF [contig 244] FULL
          Length = 1518

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 8/27 (29%), Positives = 17/27 (62%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICRL 416
            + CGH     C+ +W++   +CP+C++
Sbjct: 1202 IKCGHFFCQDCICSWLKNHSSCPLCKM 1228

>TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.808
           YOL054W
          Length = 394

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 4/39 (10%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQT----CPICRLPVFDE 421
           P    CGH     CLK+W   ++T    CP CR  V  E
Sbjct: 40  PMMTACGHNYCYGCLKSWFTSNETTELSCPQCRSSVGSE 78

>TPHA0I02480 Chr9 complement(551687..553276) [1590 bp, 529 aa] {ON}
           Anc_2.571 YKL047W
          Length = 529

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 38/62 (61%), Gaps = 5/62 (8%)

Query: 92  NVLFMISIFNEYQFFNAL--VFALILSVLKVFHW---ILKDRLESLLQSINDATDLKNLI 146
           NVL   SI++ Y + N     FA++L+VLK FH     L++ + +L++S N +++  +++
Sbjct: 424 NVLTDFSIYSSYSYVNLKDDKFAIVLNVLKYFHLKTVTLRNNISTLIESANGSSNTDSVV 483

Query: 147 FS 148
            +
Sbjct: 484 LA 485

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 15/26 (57%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICR 415
            + CGH     C+ +W++    CPIC+
Sbjct: 1164 IKCGHFFCKHCIFSWLKNKSVCPICK 1189

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054W PSH1 Nuclear protein putative RNA polymerase II
           elongation factor isolated as Pob3p/Spt16p- binding
           protein
          Length = 331

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 9/50 (18%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQ----TCPICRLPVFDENGNVKPFLHTT 432
           P    CGH     C+ NW+  +     TCP CR  V     +V P L+ +
Sbjct: 4   PVMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSV-----SVPPVLNVS 48

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 322

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 2/29 (6%)

Query: 390 LPCGHMLHLSCLKNWMERSQ--TCPICRL 416
           + C H  HL C++ W   SQ   CP CR+
Sbjct: 21  VTCQHEYHLECIREWHNHSQDFKCPTCRV 49

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
           similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 306

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 4/36 (11%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQ----TCPICRLPV 418
           P    CGH     C+ NW+  +     TCP CR P+
Sbjct: 4   PVMTSCGHNYCYECISNWLVSNNANELTCPQCRSPL 39

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
           similar to uniprot|Q06834 Saccharomyces cerevisiae
           YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 291

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 3/40 (7%)

Query: 379 DSISKSKRPKKLPCGHMLHLSCLKNWMERSQT--CPICRL 416
           +S+SK    + + CGH  H +C++ W   S+   CP CR+
Sbjct: 9   ESLSKGA-CRLVECGHKYHFNCIRRWHYHSKNLQCPTCRI 47

>TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.157
           YHR115C
          Length = 524

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 62/152 (40%), Gaps = 31/152 (20%)

Query: 273 GKFM-YEKLIDVSTKFFKTIVHIFVLIQTKLQIMVLKDVVWDCLTLYQDSISLWKIYKN- 330
           G F+ +++L   ST    T++H   ++Q  +      + ++ C+ +  +    WK   N 
Sbjct: 353 GTFLNHQRLAPASTLSKDTLIHDGDVLQLGMDFRGGTEEIYRCVKIRVELNRSWKRRANA 412

Query: 331 -NKQLDDKLPTLS--VNDVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRP 387
            NK+   ++  L      VE ++   C +C+  + P     +A+ ++             
Sbjct: 413 FNKEAIQRIRNLQKLTTGVEEED---CSICLSKIKPC----QAMFIS------------- 452

Query: 388 KKLPCGHMLHLSCLKNWMERSQT---CPICRL 416
              PC H  H  C++  +  S     CP CRL
Sbjct: 453 ---PCSHCWHFQCIRRLVMTSYPQFVCPNCRL 481

>NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1393

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%)

Query: 390  LPCGHMLHLSCLKNWM--ERSQTCP 412
            L CGH  H  C KNW   E   TCP
Sbjct: 1361 LRCGHEAHFQCFKNWFLDEGMNTCP 1385

>SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {ON}
           similar to gnl|GLV|CAGL0J03586g Candida glabrata
           CAGL0J03586g and weakly similar to YCR066W
           uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 468

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 385 KRPKKLPCGHMLHLSCLKNWMERSQTCPIC 414
           K P   PCGH     C++ ++ R   CP+C
Sbjct: 52  KTPVLTPCGHTFCSLCIREYLNRELKCPLC 81

>ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conserved
           hypothetical protein
          Length = 445

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 391 PCGHMLHLSCLKNWMERSQTCPICRLPVFD 420
           PCGH +H  C +     S  CP C++ V +
Sbjct: 239 PCGHAIHQHCFEEHTRHSYKCPHCQVTVLN 268

>Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 2/27 (7%)

Query: 392 CGHMLHLSCLKNWMERS--QTCPICRL 416
           C H  HL+C++ W + S    CPICR+
Sbjct: 23  CRHQFHLNCIREWHKYSIDLKCPICRI 49

>Skud_15.102 Chr15 (187319..188539) [1221 bp, 406 aa] {ON} YOL054W
           (REAL)
          Length = 406

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 9/50 (18%)

Query: 387 PKKLPCGHMLHLSCLKNW----MERSQTCPICRLPVFDENGNVKPFLHTT 432
           P   PCGH     CL  W     ++   CP CR  +      + P L+TT
Sbjct: 40  PMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDIV-----IIPALNTT 84

>TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.332
           YCR066W
          Length = 644

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 14/24 (58%)

Query: 391 PCGHMLHLSCLKNWMERSQTCPIC 414
           PCGH     C++ ++ +   CP+C
Sbjct: 42  PCGHTFCSLCIRGYLNKEPKCPLC 65

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W -
           Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 4/31 (12%)

Query: 392 CGHMLHLSCLKNWMERSQ----TCPICRLPV 418
           CGH     C+ NW+  +     TCP CR P+
Sbjct: 9   CGHNYCYDCISNWLVSNNANELTCPQCRSPL 39

>Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] {ON}
            YLR247C (REAL)
          Length = 1553

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 14/26 (53%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICR 415
            + CGH    +C+  W+     CPIC+
Sbjct: 1249 IKCGHYFCKNCILTWLRAHSKCPICK 1274

>KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {ON}
           similar to uniprot|Q75EN0 Ashbya gossypii AAR049C RAD18
           Postreplication repair ubiquitin-protein ligase E3 RAD18
           and weakly similar to YCR066W uniprot|P10862
           Saccharomyces cerevisiae YCR066W RAD18 Protein involved
           in postreplication repair binds single-stranded DNA and
           has single-stranded DNA dependent ATPase activity forms
           heterodimer with Rad6p contains RING-finger motif
          Length = 427

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 15/24 (62%)

Query: 391 PCGHMLHLSCLKNWMERSQTCPIC 414
           PCGH     C++ ++++   CP+C
Sbjct: 46  PCGHSFCSICIRKYLQKESKCPLC 69

>KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} similar
           to uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 460

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 385 KRPKKLPCGHMLHLSCLKNWMERSQTCPIC 414
           K P   PCGH     C++ ++ R   CP+C
Sbjct: 45  KTPVLTPCGHTFCSLCIREYLNRELKCPLC 74

>Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] {ON}
            YLR247C (REAL)
          Length = 1557

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 14/26 (53%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICR 415
            + CGH    +C+  W+     CPIC+
Sbjct: 1253 IKCGHYFCKNCILTWLRAHNKCPICK 1278

>Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}
           similar to KLTH0D06886g KLTH0D06886p Lachancea
           thermotolerans
          Length = 617

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 391 PCGHMLHLSCLKNWMERSQTCPICRLPVFD 420
           PCGH +H  C  +    S  CP C++ V +
Sbjct: 388 PCGHAIHQHCFNDHTRHSYKCPQCQVTVVN 417

>TDEL0B00890 Chr2 (170522..172144) [1623 bp, 540 aa] {ON} Anc_8.808
           YOL054W
          Length = 540

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 7/52 (13%)

Query: 387 PKKLPCGHMLHLSCLKNWMERSQ----TCPICRLPVFDE---NGNVKPFLHT 431
           P    CGH     CL  W E +     +CP CR  V +    N  +K +LHT
Sbjct: 40  PMMTQCGHNYCYDCLLAWFESNPEEELSCPQCRASVINTPALNSALKQWLHT 91

>Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa] {ON}
           YPR093C (REAL)
          Length = 288

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 2/27 (7%)

Query: 392 CGHMLHLSCLKNWMERS--QTCPICRL 416
           C H  HL+C++ W + S    CPICR+
Sbjct: 23  CKHKFHLNCIREWHKYSIDLKCPICRI 49

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 8/26 (30%), Positives = 17/26 (65%)

Query: 390  LPCGHMLHLSCLKNWMERSQTCPICR 415
            + CGH    +C+ +W++ +  CP+C+
Sbjct: 1284 ISCGHFFCNNCIFSWLKLNSNCPLCK 1309

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 27/59 (45%), Gaps = 4/59 (6%)

Query: 358 MDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMER-SQTCPICR 415
           ++ L P    +    + Q D + ++       L C H+ H  C+  W+ R S  CP+C+
Sbjct: 107 VESLGPGADSRTTCAICQEDFNKLNNVC---LLGCNHVFHTYCIDQWICRNSACCPLCK 162

>KLLA0F17479g Chr6 complement(1601287..1604631) [3345 bp, 1114 aa]
           {ON} similar to uniprot|P32849 Saccharomyces cerevisiae
           YLR032W RAD5 Single-stranded DNA-dependent ATPase
           involved in postreplication repair
          Length = 1114

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 31/99 (31%)

Query: 336 DKLPTLSVN--DVENDNDNI----CIVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKK 389
           DKL  LS N  D+ + ++ +    C +C  + +  L    AV +T+              
Sbjct: 834 DKLDALSANFRDIHSASEQLPSFECAICTTECIEPL---SAVSITE-------------- 876

Query: 390 LPCGHMLHLSCLKNWMERSQT------CPICRLPVFDEN 422
             C H     CL  ++E  Q       CP CR+P+ + N
Sbjct: 877 --CLHTFCEPCLAEYIEFQQNKKLSINCPYCRMPISEAN 913

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,145,851
Number of extensions: 2175183
Number of successful extensions: 9126
Number of sequences better than 10.0: 233
Number of HSP's gapped: 9294
Number of HSP's successfully gapped: 248
Length of query: 553
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 438
Effective length of database: 40,294,809
Effective search space: 17649126342
Effective search space used: 17649126342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)