Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A051306.28ON39639620750.0
NDAI0C026506.28ON38940010101e-135
Suva_15.1726.28ON3983979921e-132
Ecym_30326.28ON3773979811e-131
NCAS0D021406.28ON3763999711e-129
ZYRO0C07546g6.28ON3773969661e-128
CAGL0E02497g6.28ON3764009651e-128
SAKL0E01518g6.28ON3793979581e-127
Kpol_1037.236.28ON3784019561e-127
YOL003C (PFA4)6.28ON3784019501e-126
Smik_15.1676.28ON3783979501e-126
Skud_15.1596.28ON3793979391e-124
TDEL0G044106.28ON3813999381e-124
TPHA0J003906.28ON3804019281e-123
ACL003C6.28ON3754018741e-115
KLTH0C10978g6.28ON3773978721e-114
KNAG0F029306.28ON3864028721e-114
KLLA0C06204g6.28ON3774008591e-112
Kwal_56.224596.28ON3834008211e-106
TBLA0B004806.28ON3774145261e-62
NDAI0G013403.12ON3351332232e-19
SAKL0H13860g8.389ON352942143e-18
Kpol_1014.293.12ON3261132062e-17
TPHA0P015603.12ON331702044e-17
NCAS0E013003.12ON3271162011e-16
CAGL0D02508g3.12ON332591992e-16
Skud_12.3218.389ON356772002e-16
KLLA0E02069g3.12ON325681992e-16
KNAG0K025703.12ON328681983e-16
KAFR0A085903.12ON331501983e-16
Smik_12.3068.389ON359771983e-16
TDEL0A003103.12ON329531974e-16
TBLA0H001503.12ON3451581965e-16
SAKL0C13596g3.12ON333921966e-16
NCAS0C029208.389ON374711976e-16
Kwal_55.221263.12ON360921958e-16
TPHA0C023608.389ON404811951e-15
ZYRO0C03410g3.12ON3271491931e-15
SAKL0H16434g8.286ON5551801961e-15
ZYRO0C04092g8.389ON366621932e-15
YLR246W (ERF2)8.389ON359771913e-15
Skud_14.153.12ON3361281885e-15
KLTH0F08668g8.389ON358951887e-15
Suva_10.3428.389ON356871878e-15
TBLA0H009208.389ON360731879e-15
TDEL0F051308.389ON359611879e-15
KLTH0F19580g3.12ON342631851e-14
ADL197C3.12ON3901281852e-14
Ecym_20143.12ON339511842e-14
KAFR0H019808.389ON361831842e-14
Smik_14.63.12ON3341481842e-14
Suva_14.153.12ON3301291833e-14
Ecym_41788.389ON3681301834e-14
NCAS0B035908.286ON329911815e-14
KAFR0B053708.286ON3291251806e-14
YNL326C (PFA3)3.12ON3361471807e-14
CAGL0G08217g8.389ON326621799e-14
AGL125C8.389ON367601791e-13
NDAI0G022508.389ON389861791e-13
Kwal_23.33028.389ON353831753e-13
KNAG0A027108.389ON354601753e-13
KLLA0D18370g8.389ON355731735e-13
CAGL0B01991g8.286ON330721736e-13
TDEL0F041308.286ON3281291726e-13
Suva_2.2898.286ON335911727e-13
NDAI0J010008.286ON339631692e-12
Skud_4.3878.286ON336621682e-12
YDR126W (SWF1)8.286ON336911673e-12
Smik_4.3728.286ON3351101656e-12
TPHA0C010708.286ON3331261648e-12
ZYRO0D06600g8.286ON330481621e-11
TBLA0D040408.286ON3291411621e-11
KLLA0F19690g8.286ON324711602e-11
KLTH0G13112g8.286ON3491201593e-11
Kpol_1033.168.286ON321911575e-11
Ecym_42828.286ON340491497e-10
AGR065W8.286ON326441407e-09
Kwal_56.236978.286ON338691372e-08
KNAG0H031108.286ON331651336e-08
KLTH0G04972g5.579ON367721329e-08
Kwal_47.183665.579ON356701274e-07
KAFR0I011105.579ON370551231e-06
TDEL0A044405.579ON365701194e-06
NCAS0F013905.579ON374731185e-06
Ecym_41145.579ON3721011176e-06
KNAG0C028305.579ON354771177e-06
Kpol_1004.575.579ON362581177e-06
NCAS0C052805.626ON7571201179e-06
TBLA0J008305.626ON7391161161e-05
KAFR0H005705.626ON757931161e-05
NDAI0H018905.579ON406591114e-05
CAGL0M08712g5.626ON7631021115e-05
TBLA0E028305.579ON386691071e-04
CAGL0K06347g5.579ON352551071e-04
Skud_4.7345.579ON3802161071e-04
ZYRO0D13860g5.579ON3651381061e-04
NDAI0H008505.626ON7861021072e-04
Kpol_526.325.626ON777991062e-04
Suva_2.4325.626ON763831062e-04
SAKL0G06160g5.579ON364981042e-04
Smik_4.5155.626ON764511034e-04
ZYRO0C11132g5.626ON7591041034e-04
KLLA0D06149g5.579ON349701025e-04
Skud_4.5275.626ON764971026e-04
YDR459C (PFA5)5.579ON374481017e-04
Ecym_13305.626ON7391091018e-04
TPHA0C003705.626ON759961018e-04
Smik_4.7375.579ON378165990.001
ABR203W5.579ON35978970.002
TDEL0A049205.626ON75058970.002
KLTH0E02420g5.626ON73455970.003
YDR264C (AKR1)5.626ON76451970.003
KNAG0B031405.626ON682145960.003
YOR034C (AKR2)5.626ON749125960.003
Suva_8.875.626ON73086960.003
AER388C5.626ON72439950.004
KNAG0C062305.626ON752108940.006
Smik_15.2135.626ON744125930.006
Suva_2.6345.579ON38849930.006
SAKL0G07326g5.626ON73784890.023
Skud_15.1995.626ON74188830.12
KLLA0E16721g5.626ON75283780.46
ACL040C7.281ON34266678.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A05130
         (396 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   803   0.0  
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     393   e-135
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   386   e-132
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   382   e-131
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   378   e-129
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   376   e-128
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   376   e-128
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   373   e-127
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   372   e-127
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   370   e-126
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   370   e-126
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   366   e-124
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   365   e-124
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   362   e-123
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   341   e-115
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   340   e-114
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   340   e-114
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   335   e-112
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   320   e-106
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   207   1e-62
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      91   2e-19
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    87   3e-18
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    84   2e-17
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    83   4e-17
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    82   1e-16
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    81   2e-16
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    82   2e-16
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    81   2e-16
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    81   3e-16
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    81   3e-16
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    81   3e-16
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    80   4e-16
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    80   5e-16
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    80   6e-16
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     80   6e-16
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    80   8e-16
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    80   1e-15
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    79   1e-15
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    80   1e-15
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    79   2e-15
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    78   3e-15
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    77   5e-15
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    77   7e-15
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    77   8e-15
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    77   9e-15
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    77   9e-15
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    76   1e-14
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    76   2e-14
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    75   2e-14
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    75   2e-14
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    75   2e-14
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    75   3e-14
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    75   4e-14
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      74   5e-14
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    74   6e-14
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    74   7e-14
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    74   9e-14
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    74   1e-13
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     74   1e-13
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    72   3e-13
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    72   3e-13
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    71   5e-13
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    71   6e-13
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    71   6e-13
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    71   7e-13
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    70   2e-12
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    69   2e-12
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    69   3e-12
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    68   6e-12
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    68   8e-12
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    67   1e-11
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    67   1e-11
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    66   2e-11
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    66   3e-11
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    65   5e-11
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    62   7e-10
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    59   7e-09
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    57   2e-08
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    56   6e-08
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    55   9e-08
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    54   4e-07
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    52   1e-06
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    50   4e-06
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    50   5e-06
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    50   6e-06
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    50   7e-06
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    50   7e-06
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    50   9e-06
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    49   1e-05
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    49   1e-05
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    47   4e-05
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    47   5e-05
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    46   1e-04
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    46   1e-04
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    46   1e-04
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    45   1e-04
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    46   2e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    45   2e-04
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    45   2e-04
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    45   2e-04
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    44   4e-04
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    44   4e-04
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    44   5e-04
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    44   6e-04
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    44   7e-04
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    44   8e-04
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    44   8e-04
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    43   0.001
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    42   0.002
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    42   0.002
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    42   0.003
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    42   0.003
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    42   0.003
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    42   0.003
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    42   0.003
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    41   0.004
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    41   0.006
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    40   0.006
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    40   0.006
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    39   0.023
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    37   0.12 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    35   0.46 
ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON} S...    30   8.1  

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/396 (97%), Positives = 386/396 (97%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120
           DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN
Sbjct: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

Query: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXX 180
           YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAF   
Sbjct: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILL 180

Query: 181 XXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240
                  RCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP
Sbjct: 181 TITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240

Query: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300
           EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH
Sbjct: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300

Query: 301 FELNEIASEKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTVS 360
           FELNEIASEKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTVS
Sbjct: 301 FELNEIASEKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTVS 360

Query: 361 PSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
           PSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE
Sbjct: 361 PSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  393 bits (1010), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 204/400 (51%), Positives = 266/400 (66%), Gaps = 17/400 (4%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           MAI+LK+PWLG+AIP+F+ISFIGY++HYFIL + LS K Q+WFQFSLSMIW+SY LAI  
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  DPGSPSIADKNEDIKTIR---TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVG 117
           +PG P    K  D    R   T+CKKC+ YKP R+HHCKTCN+C+LMMDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 118 FKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAF 177
           +KN+PHF+RFL W+I+TT FLL  L +R   +W   +  S +  R EI+ LTIL PMDAF
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 178 XXXXXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSI 237
                     RC  NQI  GM+QIE WE+ERLE+ FY++K      L ++I  ++ ++  
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKK-----LLPMIIATLWEVYPN 235

Query: 238 ESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGD 297
           E  +      + LL +  K R  F +I+NFPYDIDI TN   V+G  F+W+  FG P+ +
Sbjct: 236 ERTKVADNYADDLLSRRKKVR--FENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRN 293

Query: 298 GMHFELNEIA-SEKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRN 356
           G+ FE NEI+  E  S++ DLLLSLPWPPD    K    I      VE+ +  GE V+RN
Sbjct: 294 GLKFEKNEISLYEPGSSVEDLLLSLPWPPD----KGRNFISNKDTSVESLVYDGEQVVRN 349

Query: 357 RTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
           R  S   ++ T N++ +SR+ W N+WGE+L  FGVDIE E
Sbjct: 350 RA-SNDTNISTINKD-ISREEWNNDWGESLVDFGVDIEAE 387

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  386 bits (992), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 199/397 (50%), Positives = 251/397 (63%), Gaps = 20/397 (5%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           MA++LKWPWLGIAIPTFLISFIGY AHYFIL + LS   Q+ F+ SLSMIW+SYYLAI  
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120
           +PG PS      +  T   YCKKC  YKP R+HHCK CN+C+LMMDHHCPWTMNCVGFKN
Sbjct: 81  NPGKPS-PTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKN 139

Query: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXX 180
           YPHFLRF+FWVI TT FL     +R+ FIW   +    L ++ E+V LTILTP++ F   
Sbjct: 140 YPHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLL 199

Query: 181 XXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240
                  RC  NQI +G SQIE W+M+RLES F S++      +  LI N + I+     
Sbjct: 200 TIVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQR-----LIKKLIENTWRIYPEARS 254

Query: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300
              + +   LL QH  R   F  ++NFPY+ID+ TNAT  LGP   WL P GAP GDG  
Sbjct: 255 PQLERDAEKLLTQHKIR---FEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNS 311

Query: 301 FELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTV 359
           F+ N+I+  E  S+L D++LSLPWPPD    K   + +     +ET  EGGE V+R+R  
Sbjct: 312 FQKNDISKYEVNSSLEDIMLSLPWPPD--GGKIKTASNHSNLAIETCNEGGEQVVRSRIA 369

Query: 360 SPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
                    +    +R+ W N+WGE+L  FGVD++ E
Sbjct: 370 Q--------HGRSATREKWYNDWGESLDDFGVDVDME 398

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  382 bits (981), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 189/397 (47%), Positives = 257/397 (64%), Gaps = 22/397 (5%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           M ++LKWPWLGIAIP FLI+FIGYSA  F+L   LS K Q+WFQFSL+MIWLSYY AI  
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120
           +PGSP +          + YCKKC  +KP R HHCKTC +C+L+MDHHCP+TMNCVG+ N
Sbjct: 61  NPGSP-VPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNN 119

Query: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXX 180
           +PHF+RFLFW+I TT +L  Q F+R  F+W   +S++ LV ++EI+ LTILTP +AF   
Sbjct: 120 FPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLL 179

Query: 181 XXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240
                  RC  NQ+ +GM+QIE WEM+R+ES FY+R+      +  L++N+  ++   S 
Sbjct: 180 TISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRR-----LVPQLLSNLEELYP-NSL 233

Query: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300
           + ++ E++ +L   + R+++F  ++NFPYD D   N    +GP  +WLNPFG P G+GM 
Sbjct: 234 DGHKGEIDRIL---NNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMV 290

Query: 301 FELNEI-ASEKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTV 359
           FE NE+ A E  STL D LLSLPWPPD    +   +       VE+    GE ++R R+ 
Sbjct: 291 FEKNELSAYEHGSTLTDKLLSLPWPPD---GERAPNSSNSRLKVESSTRNGEHIIRKRSP 347

Query: 360 SPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
            P  +        LSR  W N+WGENL  FGVD++ +
Sbjct: 348 EPRLN--------LSRTEWYNDWGENLAHFGVDVDAD 376

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  378 bits (971), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 198/399 (49%), Positives = 258/399 (64%), Gaps = 26/399 (6%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           M ++LK+PW+G+ IP  L SFIGYSAH F+L + +SWKLQLWFQ SL+M+W+SY LAI  
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120
           +PG P+ + K    K    +CKKC  +KP RAHHCKTCN+C+LMMDHHCPWTMNCVGFKN
Sbjct: 61  NPGRPAKSFKPLK-KEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKN 119

Query: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXX 180
           +PHFLRFLFWV+VTT FLL QL +R  ++W      S L ++ EI  L IL PMD F   
Sbjct: 120 FPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLI 179

Query: 181 XXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIE-S 239
                  RC  NQI  G +QIE WE+ERLE+ +Y +K      L  L+ N++ I+  E +
Sbjct: 180 TVALLFIRCLSNQIIGGKTQIESWELERLENLYYRKK-----LLPQLLVNLWEIYPNEKT 234

Query: 240 PEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGM 299
           PE+   +V     Q   R++ F +I+ FPYD+DI +NA  VLG    WL  FG P+ DGM
Sbjct: 235 PEN---KVLAKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGM 291

Query: 300 HFELNEIA-SEKASTLADLLLSLPWPPDTCTSKYGKS-IDEGTKYVETHIEGGECVLRNR 357
           HF+ NE+A  E+ + + DLLLSLPWPPD      G++ I +    VE+  E GE V+R R
Sbjct: 292 HFKKNELALYEEGAAIEDLLLSLPWPPDG-----GRNFIQQKGTNVESITENGEQVIRQR 346

Query: 358 TVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
                      N+N   RK+W N+WGENL+ FGVD++ E
Sbjct: 347 NFE--------NDNSY-RKTWNNDWGENLEDFGVDVDVE 376

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  376 bits (966), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 195/396 (49%), Positives = 250/396 (63%), Gaps = 19/396 (4%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           M +QLKWP+LGIAIP FLISFIGY+AHYFIL + LS + Q+WF+FSL+MIW SYYLAI  
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120
            PG P + +      + ++YCKKC  YKP RAHHCKTCN+C+L MDHHCPWT NCVG+ N
Sbjct: 61  LPGQP-LPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYN 119

Query: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXX 180
           +PHF+RFLFWVI TT +LL +L  R  FI +N  S + L  + E++ LTIL PMD F   
Sbjct: 120 FPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILL 179

Query: 181 XXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240
                  RC  NQIF G +QIE WE ERLE  +YS++      L  L+ N + ++     
Sbjct: 180 TISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKR-----LLPHLLANFWELYPELRT 234

Query: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300
            + ++E +   R   +RR+    ++NFPYDID  +N    LG    WL PFG P+GDGM 
Sbjct: 235 RELEDEAS---RLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMF 291

Query: 301 FELNEIASEKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTVS 360
           F  N+I+  + + L D+LL+LPWPPD    K   SID G   VET +  GE V+R R V 
Sbjct: 292 FPKNDISEFEETNLTDMLLALPWPPDGGKDKV-ISID-GPNAVETTVRDGEQVIRKRLVD 349

Query: 361 PSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
           P         +  SR  W N WGENL+ FGVD++ E
Sbjct: 350 P--------RDPSSRTQWQNTWGENLEDFGVDVDAE 377

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  376 bits (965), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 201/400 (50%), Positives = 255/400 (63%), Gaps = 28/400 (7%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           M ++LKWPWLGIAIP+FLI+ IGY AHYFILL+ LS + QLW+QF  +MIWLSYYLAI  
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  DPGSPSI---ADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVG 117
            PG P       KNE     + YCKKC  YKP R+HHCKTCN+C+LMMDHHCPWTMNCVG
Sbjct: 61  PPGKPPTNFKPSKNE----WKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 116

Query: 118 FKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAF 177
           + N+PHF+RFLFWVIV T  L   L  RI  IW +  S S L  + E++ LTILTP++AF
Sbjct: 117 YNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAF 176

Query: 178 XXXXXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSI 237
                     RC  NQIF+G SQIE WEM+RLE+   +R  K    L ILI NV+ IF  
Sbjct: 177 ILLTISILMIRCLFNQIFNGRSQIESWEMDRLET--LARMSK---LLPILIENVWYIFPN 231

Query: 238 ESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGD 297
              E  + +   LL   +K+RL+   ++NFPYD+    NA  +LG    WL PF  P+ D
Sbjct: 232 LRNEHVESQAEALL---NKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDD 288

Query: 298 GMHFELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRN 356
           G+HF+ NE +  E  ++L D++L LPWPPD  ++K+  S  E T  V+   E GE V+R 
Sbjct: 289 GLHFQKNEESMIEDPNSLNDIILCLPWPPD--STKHLNSTSEHTSNVQIISEEGEQVIRI 346

Query: 357 RTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
           RT           E +LSR  W N+WGE+L+ FGVD++ E
Sbjct: 347 RT----------PEKKLSRSEWLNDWGESLEDFGVDVDVE 376

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  373 bits (958), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 193/397 (48%), Positives = 248/397 (62%), Gaps = 19/397 (4%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           MA++LKWPWLGIAIP FLISFIGY AHYFIL + L  K QLWF+FSL MIW+SYYLAI  
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120
           +PG P+   +    +    +C KC+ YKP RAHHCK CN+C+L MDHHCPWTMNCVG +N
Sbjct: 61  NPGKPTPGFRPSKFEW-ENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRN 119

Query: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXX 180
           + HF+RFLFWVI TT+FLL  L +RI F+W   +  +  V R E++ LTILTPMDAF   
Sbjct: 120 FAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLL 179

Query: 181 XXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240
                  RC  NQI  GM+QIE WEM+R+E+ F+S +   R     ++ N+  I    S 
Sbjct: 180 TISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPR-----MLENLKEI-RPGSL 233

Query: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300
            +  +++  LL Q+   RL+   I+NFPYD++   NA   LG  +SW+ P+G  +G+GM 
Sbjct: 234 SNQDDDIRKLLSQN---RLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMI 290

Query: 301 FELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTV 359
           FE NE++  E    + D LLSLPWPPD    K           VE+    GE V+R R V
Sbjct: 291 FEKNELSVYEPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWV 350

Query: 360 SPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
            P   +P        RK W N+WGENL  FGVD++ E
Sbjct: 351 DPRTTMP--------RKKWYNDWGENLADFGVDLDEE 379

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  372 bits (956), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 199/401 (49%), Positives = 258/401 (64%), Gaps = 28/401 (6%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           M ++LK+PW+GIAIP FLISFI Y+AHYFILL+ LS   Q+WF+ S++MIW+SYYLAI  
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  DPGSPS---IADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVG 117
           +PG P    I   N+     + YCKKC+AYKP R HHCKTC +C+LMMDHHCPWTMNCVG
Sbjct: 61  NPGKPGSNYIPPSNQ----WKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVG 116

Query: 118 FKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAF 177
           +KN+PHFLRFLFWVIVTT +LL  L  RI F+W +    S L  + EI+ LTI TPMD F
Sbjct: 117 YKNFPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGF 176

Query: 178 XXXXXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSI 237
                     RCT+NQ+ SG +QIE WE ERLES FY R+ K +     LI+N++     
Sbjct: 177 VLLTISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQ-----LISNLWEFHPE 231

Query: 238 ESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGD 297
               D + +   ++     +R+ F  +++FPYD+ ++ N T VLG   +WL  +G P GD
Sbjct: 232 LKTPDNEAKAEKIV----SKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGD 287

Query: 298 GMHFELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDE-GTKYVETHIEGGECVLR 355
           GM F+ NE +  E+ S L D +LSLPWPPD    K+G +I+   T  +ET  + GE V+R
Sbjct: 288 GMLFKKNEYSLFEEDSILEDQILSLPWPPD--GGKHGFNIENSSTNSIETSTKDGEHVIR 345

Query: 356 NRTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
            R  SP   L        SR  W N+WGENL+ FGVDI+ E
Sbjct: 346 KR--SPVSKLLE------SRTQWYNDWGENLEDFGVDIDVE 378

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  370 bits (950), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 251/401 (62%), Gaps = 28/401 (6%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           M ++L+WPWLGIAIPTFLISFIGY AHYFIL + LS   Q+ F+F LSMIWLSYYLAI  
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120
           +PG P + +        R +CKKC +YKP R+HHCKTCN+C+LMMDHHCPWTMNCVGF N
Sbjct: 61  NPGRP-LPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFAN 119

Query: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXX 180
           YPHFLRFLFW+IVTT+ L     +RI FIW   +      ++ E++ LTI +P+++F   
Sbjct: 120 YPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLL 179

Query: 181 XXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIF----S 236
                  RC  NQI +G SQIE W+M+RLES F S +   +     LI+N + I+    S
Sbjct: 180 TITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQK-----LIDNTWRIYPESRS 234

Query: 237 IESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEG 296
            ++ +D +E +        K+R  F  ++NFPYD D+ TNA   LGP   WL P+G P G
Sbjct: 235 FQNKKDAEEHLT-------KKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTG 287

Query: 297 DGMHFELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLR 355
           DG +F  N I+  E  S+L D +LSLPWPPD    K     + G+  +E   E GE ++R
Sbjct: 288 DGNNFPKNGISKYEANSSLEDHILSLPWPPD--GGKTNTVFNHGSSTIEMRNESGEQLIR 345

Query: 356 NRTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
            R       LP  N    SR+ W N+WGE+L  FGVD++ E
Sbjct: 346 TR-------LP-QNGRHASREKWYNDWGESLDDFGVDVDME 378

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  370 bits (950), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 191/397 (48%), Positives = 249/397 (62%), Gaps = 20/397 (5%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           MA++L+WPWLGIAIPT LISFIGY AHYFIL + L    Q+ F+FSLSMIW SYYLAI  
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120
           +PG P + +          +CKKC  YKP R+HHCKTCN+C+LMMDHHCPWTMNCVGF N
Sbjct: 61  NPGRP-LPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGN 119

Query: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXX 180
           YPHFLRFLFW+I+TT+ L     +RI FIW        L ++ E+  LTIL+P++ F   
Sbjct: 120 YPHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLL 179

Query: 181 XXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240
                  RC  NQI +G SQIE W+M+RLES F SR+      +  LI N + I+     
Sbjct: 180 TITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRR-----LIQKLIYNTWRIYPESKT 234

Query: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300
             ++ +  GLL+Q   +R +F  ++NFPY+ D+ TNA   LGP   WL P+G P G+G +
Sbjct: 235 LQHERDAEGLLKQ---QRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNN 291

Query: 301 FELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTV 359
           F  N+I++ E  S L D++LSLPWPPD   +      +  T  +ET  EGGE V+R+R  
Sbjct: 292 FPKNDISNYEVDSPLEDIILSLPWPPDGGETT--TVSNPKTSTIETCNEGGEQVVRSRVA 349

Query: 360 SPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
                    N    SR+ W N+WGE+L  FGVD++ E
Sbjct: 350 Q--------NGRSASREKWFNDWGESLDDFGVDVDME 378

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  366 bits (939), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 191/397 (48%), Positives = 248/397 (62%), Gaps = 19/397 (4%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           MA++LKWPWLGIAIPTFLISFIGY AHYFIL + LS   QL F+ SLSMIW+SYYLAI  
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120
           + G P + +          +CKKC +YKP R+HHCK CN+C+LMMDHHCPWTMNCVGF+N
Sbjct: 61  NAGRP-LPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRN 119

Query: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXX 180
           YPHFLRFLFWVIVTT+ L     +RI FIW        L ++ E++ LTIL+P+D F   
Sbjct: 120 YPHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLL 179

Query: 181 XXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240
                  RC  NQI +G SQIE W+M+RLES   S K      +  LI+N + I+     
Sbjct: 180 TIAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGK-----LIPKLIDNTWRIYPEARS 234

Query: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300
             ++ + + LL Q  + R  F  +++FPY+ +  TNA   LGP   WL P+G P GDG  
Sbjct: 235 SQHERDADKLLTQRGRAR--FDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNS 292

Query: 301 FELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTV 359
           F  N+I+  E  S L D++LSLPWPPD   +K   + +  T  +ET+ EGGE ++R+R  
Sbjct: 293 FPKNDISQYEVNSPLEDIILSLPWPPDGNKTKAVSNHNNST--IETYNEGGEQIVRSRNA 350

Query: 360 SPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
               D          R+ W N+WGE+L  FGVD++ E
Sbjct: 351 QHGSD--------AIREKWYNDWGESLDDFGVDVDME 379

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  365 bits (938), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 192/399 (48%), Positives = 249/399 (62%), Gaps = 24/399 (6%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           M ++LKWPWLGIAIP  L+SFIGY  H+FIL + LS   QLWFQ +L++IWLSYY AI  
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  DPGSPSIADKNEDIKTI--RTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGF 118
           +PG P     N ++     + YCKKC  YKP RAHHCKTCN+C+LMMDHHCPWTMNCVG 
Sbjct: 61  NPGRPR---PNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGH 117

Query: 119 KNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFX 178
            N+PHFLRFL WVIV TAFLL QL  RI  +W +      +  R E+V LTILTP+DAF 
Sbjct: 118 NNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFV 177

Query: 179 XXXXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIE 238
                    RC  NQIF+GMSQIE WE+ERL++ F S++      + +LI   + IF   
Sbjct: 178 LLTITILLCRCLANQIFNGMSQIETWELERLQALFDSKR-----LVPLLIEAAWDIFP-G 231

Query: 239 SPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDG 298
           + E   E     L  + + RL    ++NFPYD+D  +NA  +LG    WL PFG P+GDG
Sbjct: 232 TREQINESTAAELSMNKELRL--EDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDG 289

Query: 299 MHFELNEIASEKA-STLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNR 357
           M F  NEI+   + ++  DLLLSLPWPPD   ++ G      +  +E+  + GE ++R R
Sbjct: 290 MSFVKNEISEYSSRASYEDLLLSLPWPPDGGRTRAGPG--SLSSSIESITKQGEQLIRRR 347

Query: 358 TVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
                   P    + + R+ W N+WGENL+ FGVD++ E
Sbjct: 348 --------PNDTSDLIGRRQWQNDWGENLEDFGVDVDTE 378

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  362 bits (928), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 187/401 (46%), Positives = 252/401 (62%), Gaps = 27/401 (6%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           M ++ KWPW+GIAIP  LISFIGY +HY+IL  HLS   Q +F+FSL+MIW+SYY+AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  DPGSPSIADKNEDIKTI----RTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCV 116
           +PG P      ++ K +    R +CKKC+ YKP R+HHCKTCN+C+LMMDHHCPWTMNC+
Sbjct: 61  NPGKPG-----KNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCI 115

Query: 117 GFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDA 176
           GF N+PHF+RFL W++ TT FLL    +RI ++W N    S L +R E++ L + TP++ 
Sbjct: 116 GFNNFPHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNL 175

Query: 177 FXXXXXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFS 236
           F          RC  NQI +G +QIE WEM+RLE+ FY +K      L  LI N++ ++ 
Sbjct: 176 FILLTITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKK-----LLPQLILNLWELYP 230

Query: 237 IESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEG 296
                 + EE   L+   +K+ + + SI+NFPYD+ I  N T ++G    WL PFG P G
Sbjct: 231 ELKSAKHDEEAERLI---EKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSG 287

Query: 297 DGMHFELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLR 355
           +GM+FE NEIA  +  S+L    L+LPWPPD       K+++  +  VE     GE V+R
Sbjct: 288 NGMNFEKNEIALFDPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSN-VEFITTDGEQVVR 346

Query: 356 NRTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
           NRT         A    LSR+ W NEWGENL+ FGVD+E E
Sbjct: 347 NRT--------HAKNPILSREEWFNEWGENLEDFGVDVEME 379

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  341 bits (874), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 180/401 (44%), Positives = 247/401 (61%), Gaps = 31/401 (7%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           MA+ +KWPWLG+AIP FLISF GY AH+F+L + LS+K  LWFQ SLSMIW+SY+ AI  
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  DPGSPSIADKNEDIKTIR----TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCV 116
           +PG P+     +  + +R     YC KC+ YKP R HHCK CN+C+L+MDHHCPWTMNC+
Sbjct: 61  NPGRPT-----KGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCL 115

Query: 117 GFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDA 176
           G +          W+I TT  LL    +RI F W N Y+++ LV +QE++ LTILTP+DA
Sbjct: 116 GLQYLAPQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDA 175

Query: 177 FXXXXXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFS 236
           F          RC  NQI +G +QIE WEM+R+E+ FY ++      L  L+ N+  I+ 
Sbjct: 176 FILLTISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQR-----LLPQLLTNLKEIYP 230

Query: 237 IESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEG 296
             S E  ++EV   L        +F  +INFPYDI+   N    +G   +WLNPFG P+ 
Sbjct: 231 -GSLEGQEKEVEEFL---SSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKA 286

Query: 297 DGMHFELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLR 355
           DGM F+ NEI+  ++A+++ D LL+LPWPPD   +++G +      +VE   +GGE V+R
Sbjct: 287 DGMVFQKNEISDYDEATSIQDKLLALPWPPD--DTRHGIAF-PSVSHVEKDTQGGEQVVR 343

Query: 356 NRTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
            R V     +P  NE       W N+WGE+L+ FGVD+E E
Sbjct: 344 RRHV--PIAVPPRNE-------WYNDWGESLEHFGVDVEVE 375

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  340 bits (872), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 173/397 (43%), Positives = 239/397 (60%), Gaps = 22/397 (5%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           M ++LKWPWLGIA+P+FLI++IGYS+HYFIL +  S   QLWF+FSL++IW+SY  AI  
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120
           +PG P   +    I   + YCKKCD YKP R HHCKTC +C+L MDHHCPWTMNCVG  N
Sbjct: 61  NPGRPP-PNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNN 119

Query: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXX 180
           +PHF+RFL WV++TT++L   L +R    W +  ++   V   E+  L +  P++AF   
Sbjct: 120 FPHFVRFLTWVVLTTSYLGLLLTQRAFDHWAS-RNTRKFVHTSELCFLFVNAPLNAFILL 178

Query: 181 XXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240
                  RC  NQ  +GM+QIE WE +R+E+ F++ +      +  LI+N+  +F    P
Sbjct: 179 TVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNER-----LVPQLIDNLKELF----P 229

Query: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300
           ED  +E     +    ++L    IINFPYD+DIL N    +GP +SW  P G P  +G  
Sbjct: 230 EDTFDE-GAAQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTR 288

Query: 301 FELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTV 359
           F  N+++  +  +++ D LLSLPWPPD    K  +S D  +  +ET   GGE  LRNR+ 
Sbjct: 289 FVTNDLSDYDIKASIEDKLLSLPWPPDGGRQKSQRSADIAST-LETFSSGGEATLRNRSF 347

Query: 360 SPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
                +P        R  W N+WGENL  FGVD++ E
Sbjct: 348 DSRISVP--------RTEWHNDWGENLSDFGVDVDAE 376

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  340 bits (872), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 178/402 (44%), Positives = 239/402 (59%), Gaps = 22/402 (5%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           M +QLK PW GIAIP  LI FIGY AH+FIL + LS K Q+ FQF L+MIW+SYY+AI  
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  DPGSPSIADKNEDIK-TIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFK 119
           +PG P      +     +  YC KC+ +KP R+HHCKTC +C+LMMDHHCPWTMNC+GF 
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 120 NYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWT--NWYSSSALVQ--RQEIVMLTILTPMD 175
           N+P F+RFL WVI+TT+ L   L  RI  IW   N      +V    +E+V L +LTPMD
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 176 AFXXXXXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIF 235
            F          RC  NQ+  GM+QIE WEMERL++ FYS+K      L I+I  V+  F
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKK-----LLPIMIERVWEKF 235

Query: 236 SIESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPE 295
             E   +++ E   LL  +++  L F S++NFPYD+D+LTN    LG     L PF   +
Sbjct: 236 PHEQTPEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQ 295

Query: 296 GDGMHFELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVL 354
           G+G+ F+ N+I++ E   +++DLLL L WPPD          ++G   ++  +E GE ++
Sbjct: 296 GNGVTFQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMI 355

Query: 355 RNRTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
           R R           N    SR +W N+WGE L+ FGVD   E
Sbjct: 356 RKR-----------NSPIESRTTWENQWGETLEGFGVDPMNE 386

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  335 bits (859), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 178/400 (44%), Positives = 241/400 (60%), Gaps = 27/400 (6%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           MAI+LK  WLG+AIP FL++ IGY +HYFIL + LSW  Q+++Q   +MIW+SYYLAI  
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120
           +PG P   D     +    YCKKC  YKP RAHHCKTCN+C+L MDHHCPWT+NCVG  N
Sbjct: 61  NPGIPP-KDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSN 119

Query: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXX 180
           +PHF+RFLFWVI +TA+LL  L  RI  +W+  +++       EI+ + I+TPMDAF   
Sbjct: 120 FPHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLL 179

Query: 181 XXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240
                  RC  NQ   GM+QIE WEM+R++S  Y  +         L+  V        P
Sbjct: 180 TVSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNR---------LLAQVIDRLVERRP 230

Query: 241 E---DYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGD 297
           E     Q E+N LL    KR +      NFPYD++  TN    +GP++ WL P+  P   
Sbjct: 231 EILPAKQHEINKLL---SKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTI 287

Query: 298 GMHFELNEI-ASEKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRN 356
           G  F  NE+   +  S++ D+L+SLPWPPD  T  + +++  G+  +ET + GGE V+R+
Sbjct: 288 GTSFAKNELFFYDPNSSIEDMLMSLPWPPDGLT-HHSRALGSGSS-IETIVSGGEQVIRD 345

Query: 357 RTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
           ++V    DL     ++L R SW N+WGE+L  FGVD E E
Sbjct: 346 KSV----DL----RDRLGRNSWYNDWGEDLSDFGVDTELE 377

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  320 bits (821), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 170/400 (42%), Positives = 239/400 (59%), Gaps = 28/400 (7%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           M ++LKWPWLGIAIP+ LI+FIGY +HYFIL + LS   Q+WFQ  LSMIW+SY LAI  
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120
           +PG P    +       +  C+KC  YKP R HHCKTC++C+L+MDHHCPWTMNCVG  N
Sbjct: 61  NPGKPPTGFQPLP-HQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNN 119

Query: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXX 180
           +PHF+RFL WVI+TT++L   L++RI   W     +   VQ+ E+V + I TP++AF   
Sbjct: 120 FPHFVRFLVWVIITTSYLGFMLWKRIFMHW-QLRHTRIYVQKIELVFIFINTPLNAFVWL 178

Query: 181 XXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFS--IE 238
                  RC+ NQ   GM+QIE+WE ER+E+ F + +      +  L+ N+  I+   I 
Sbjct: 179 TIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGR-----LIPQLLENLAEIYGDDIL 233

Query: 239 SPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDG 298
           +  + ++ +N        R L    I+NFPYD++I+ N    +G   + + P+ +P G+G
Sbjct: 234 NSPNAKKLINA-------RDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNG 286

Query: 299 MHFELNEIAS-EKASTLADLLLSLPWPPDTCTSK-YGKSIDEGTKYVETHIEGGECVLRN 356
           + F  N+++S +   T+ D LLSLPWPPD    +  G S  + +  +E H   GE VLR 
Sbjct: 287 LKFTKNDLSSYDTCHTIEDKLLSLPWPPDGGRQQPTGDS--QVSSRIEMHSSRGEPVLRK 344

Query: 357 RTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396
           R   P  +        + R  W N+WGENL  FGVD+E E
Sbjct: 345 RLRDPRIN--------MQRTEWYNDWGENLSDFGVDVESE 376

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  207 bits (526), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 143/414 (34%), Positives = 214/414 (51%), Gaps = 58/414 (14%)

Query: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60
           M I+   PW G+AIP+ +I  +   +++ IL D L+    +W+  +  MI  SYYLAI  
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  DPG-SPS------IAD--KNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPW 111
            P  +PS      I+D   NE+     T CKKC   K PRAHHCKTCN C++MMDHHCPW
Sbjct: 61  PPTPAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMMDHHCPW 120

Query: 112 TMNCVGFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQ--RQEIVMLT 169
           TMNCVG+ NYPHF+RFL WVI++T  LL+QL ++   ++    S   L Q  + +I++LT
Sbjct: 121 TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKIIILT 180

Query: 170 ILTPMDAFXXXXXXXXXXRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILIN 229
           +L P   F          +   NQI++GM+QIE W+ E +E+ ++  K       + L+ 
Sbjct: 181 LLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVALQLQLLE 240

Query: 230 NVFTIFSIESPEDYQEEVNGL---LRQHDKRRLAFHSIINFPYDIDILTNATCVLGPF-- 284
           N+   ++ +   D   ++  L   L+   +   +FHSIINFPYD+ +  N T  +G    
Sbjct: 241 NLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP 300

Query: 285 FSWLNPFGAPEGDGMHFELNEIA----SEKASTLADLLLSLPWPPDTCTSKYGKSIDEGT 340
            SW NP+  P     + ++NE A    +E    + D+LL LPWP +   +          
Sbjct: 301 LSWFNPWYTPLTASYN-KINEFAIWDDNETHDNIKDMLLCLPWPLNYSNN---------- 349

Query: 341 KYVETHIEGGECVLRNRTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIE 394
               +  + GE V++                       +N++GE LQ FGVD +
Sbjct: 350 ----STFQDGELVVK-----------------------SNDYGETLQDFGVDYD 376

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 67/133 (50%), Gaps = 5/133 (3%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C+ C  +KP R HHC TCNKCIL MDHHCPW   C+GFKN   F++FL +  +  AF+  
Sbjct: 109 CQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTI-YAFVAL 167

Query: 141 QLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXXXXXXXXXRCTMNQIFSGMSQ 200
            L   I + + NWY +   +  + I    ++  + AF            ++ Q+    + 
Sbjct: 168 GL---ISYQFVNWYKNQNYMN-EYIDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNRTT 223

Query: 201 IEKWEMERLESSF 213
           IE + + R    F
Sbjct: 224 IEMYGIRRYNRDF 236

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 54/94 (57%), Gaps = 6/94 (6%)

Query: 54  YYLAIKADPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTM 113
           YY  I    G+P IA  N ++K    YC  C  ++PPRA HC TC  CI+  DHHC W  
Sbjct: 151 YYNMITLPTGNPLIA--NIEVK----YCTTCRIWRPPRASHCSTCEACIITHDHHCKWVN 204

Query: 114 NCVGFKNYPHFLRFLFWVIVTTAFLLAQLFRRIG 147
           NC+G +NY +F  FL   ++ TAF++A    R+ 
Sbjct: 205 NCIGQRNYHYFFTFLVSCVIATAFIIANCAIRVS 238

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 57/113 (50%), Gaps = 25/113 (22%)

Query: 53  SYYLAIKADPGSP---------SIADKNEDIK------TIRTY----------CKKCDAY 87
           +YY  I   PGSP         +I D  + I+        R++          C+ C+ +
Sbjct: 53  TYYKVIIVGPGSPLDFGQLTVRNIKDAEDGIELPPDFLAQRSFTLKHDGRFRVCRTCNVW 112

Query: 88  KPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           KP R HHC  C+KCIL MDHHCPW   CVGFKN  +F++FL +  V    ++ 
Sbjct: 113 KPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTVYAILVMT 165

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 83.2 bits (204), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 1/70 (1%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C+ C+ +KP R+HHC TCN+C+L MDHHCPW   C+GFKN   F++FL +   T A+++A
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYN-TTYAYVIA 168

Query: 141 QLFRRIGFIW 150
            L  +  + W
Sbjct: 169 ILTSKQMYNW 178

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 59/116 (50%), Gaps = 28/116 (24%)

Query: 53  SYYLAIKADPGSPS-----------------------IADKNEDIKTIRTY--CKKCDAY 87
           +Y+  +   PG+PS                       IA ++  +K    Y  C+ C  +
Sbjct: 48  AYFRVVSTGPGTPSNFPDLRVYNLEDAKRGIELPPEYIAKRSFTLKKDGRYRLCQTCQVW 107

Query: 88  KPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLAQLF 143
           KP R HHC TC+KCIL MDHHCPW   C+GF+N  +F++FL   I  TA+ +  LF
Sbjct: 108 KPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFL---IYCTAYSIVVLF 160

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 40/59 (67%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLL 139
           CK C ++KP R HHC TCN C+L MDHHCPW   CVG++N   F++FL +  V +  +L
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTVYSILVL 164

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (63%), Gaps = 2/77 (2%)

Query: 65  PSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHF 124
           P+ +   EDI TI+ YC+ C  ++PPR  HC TCN C+++ DHHC W  NCVG +NY  F
Sbjct: 161 PTHSSVLEDI-TIK-YCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFF 218

Query: 125 LRFLFWVIVTTAFLLAQ 141
           L FL   I ++ FLL  
Sbjct: 219 LIFLLSAIFSSVFLLTN 235

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 46/68 (67%), Gaps = 4/68 (5%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLL 139
           +C+ C+ +KP R HHC  CNKC L MDHHCPW  +CVGF+N   F++FL +  V + ++L
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVL 163

Query: 140 ----AQLF 143
               AQL+
Sbjct: 164 LMTSAQLY 171

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 4/68 (5%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C+ C  +KP R HHC +C++CIL MDHHCPW   CVGF+N   F++FL +      F+L+
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYTTAYAIFVLS 162

Query: 141 ----QLFR 144
               QL+R
Sbjct: 163 MTSVQLYR 170

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFW 130
           C+ C  +KP R HHC +CN+CIL MDHHCPW   C+GFKN  +F++FLF+
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFY 155

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 52/77 (67%), Gaps = 2/77 (2%)

Query: 65  PSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHF 124
           P+ +  ++DI TI+ YC+ C  ++PPR+ HC TCN C+++ DHHC W  NC+G +NY  F
Sbjct: 161 PTHSSVSKDI-TIK-YCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFF 218

Query: 125 LRFLFWVIVTTAFLLAQ 141
           L FL   ++++  LLA 
Sbjct: 219 LVFLLSAVISSIILLAN 235

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 38/53 (71%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIV 133
           C+ C  +KP R HHC  CN+CIL MDHHCPW  +CVGF+N  +F++FL +  +
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATL 160

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 75/158 (47%), Gaps = 36/158 (22%)

Query: 13  AIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIW----LSYYLAIKA---DPGSP 65
             P    +F+ Y   +F  +  + W   + + F ++M+W    + YY  ++A    PGSP
Sbjct: 10  VFPKLFTTFL-YLWSFFTAIYQIKW---INYTFMITMLWSLYLIGYYAYVQAFMVGPGSP 65

Query: 66  S-----------------------IADKNEDIK--TIRTYCKKCDAYKPPRAHHCKTCNK 100
           S                       ++ K+  +K       C+ C  +KP R HHC +C++
Sbjct: 66  SDFPELRVNSIEAAEAGTEFPPEYLSQKSITLKHDGRARVCRTCLVWKPDRCHHCSSCDR 125

Query: 101 CILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFL 138
           CIL MDHHCPW   C+GFKN+ +F+ FL +  +   F+
Sbjct: 126 CILKMDHHCPWFAECIGFKNHKYFINFLIYNSLYATFV 163

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 53/92 (57%), Gaps = 6/92 (6%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C+ C  +KP R+HHC +CNKC L MDHHCPW  +C+GFKN   F++FL +      F   
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYTTWYAVF--- 161

Query: 141 QLFRRIGFIWTNWYSSSALVQRQEIVMLTILT 172
            +F   G     W  +   +  +E++ L+++T
Sbjct: 162 -VFMTTGLQLWKWLDNK--MYEKELIDLSLMT 190

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 43/71 (60%)

Query: 71  NEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFW 130
           + D   +  YCK C  ++PPR+ HC  C  C+LM DHHC W  NCVG +NY +FL FL  
Sbjct: 174 HTDCNIVLKYCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTS 233

Query: 131 VIVTTAFLLAQ 141
             +T+ FL+  
Sbjct: 234 STLTSIFLIVN 244

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 53/92 (57%), Gaps = 6/92 (6%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLL 139
           +C+ C  +KP R HHC  CNKC L MDHHCPW  +CVG++N  +F+ FL +   TTA+ +
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLY---TTAYSI 188

Query: 140 AQLFRRIGFIWTNWYSSSALVQRQEIVMLTIL 171
              F   G     W+ S      QE++ L +L
Sbjct: 189 LVFF-LTGADLLMWFRSQGY--NQELINLPLL 217

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 51/81 (62%), Gaps = 2/81 (2%)

Query: 67  IADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLR 126
           I D+++ ++   TYC+ C  ++PPR+ HC  C+ C++ +DHHC W  NCVG +NY +FL 
Sbjct: 184 IKDESQYVEI--TYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLI 241

Query: 127 FLFWVIVTTAFLLAQLFRRIG 147
           FL   I+T  FLL      IG
Sbjct: 242 FLTSTIMTVIFLLINTGIHIG 262

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 74/149 (49%), Gaps = 36/149 (24%)

Query: 40  QLWFQFSLSM-IWL------SYYLAIKADPGSPSIAD--KNEDIKTIRT----------- 79
           Q+W++F +S+ ++L      +YY  I   PGSP   D  K  D++ + +           
Sbjct: 34  QIWYKFLVSVDVFLVAIGLYTYYKVIITGPGSPLDYDTIKVYDMQAVESGAELPPEFLSR 93

Query: 80  ------------YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRF 127
                        C+ C  +KP R HHC  C+KCIL MDHHCPW   C+GF N   F+++
Sbjct: 94  RSITTKRDGRFRVCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQY 153

Query: 128 LFWVIVTTAFLLAQLFRRIGFIWTNWYSS 156
           L +   TT  ++  LF  I  +  +W+++
Sbjct: 154 LLY--ATTYSIVIFLFSSIQLL--HWFNT 178

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/180 (33%), Positives = 88/180 (48%), Gaps = 18/180 (10%)

Query: 5   LKWPWLGIAIPTFLISFIGYSAHYFI--LLDHLSWKLQLWFQFSLSMIWL-----SYYLA 57
           L++ W    +P F  S   Y    F   L   LS  L    +F +  + L     + YL 
Sbjct: 44  LRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSPYLLFLERFLIVPLLLLGPIITGYLC 103

Query: 58  IKADPGS-PSIADK----NEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWT 112
           +  +P S  S+AD     +E I    T C+ C   KP R+ HC  CNKCILM+DHHC W 
Sbjct: 104 MTIEPDSTKSLADCRVPFDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWV 163

Query: 113 MNCVGFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILT 172
            NC+G  NY +F  FL    ++   LL+  F R+  I     S +  ++ + +++LTILT
Sbjct: 164 NNCIGKGNYKYFYGFL----LSNVTLLSYSFLRLTSI--QLMSQTENIKTKPMLVLTILT 217

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLL 139
           YC  C  ++PPRA HC TC  CIL  DHHC W  NC+G +NY +F+ FL   I+++ FL+
Sbjct: 180 YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFLI 239

Query: 140 AQ 141
           A 
Sbjct: 240 AN 241

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (64%), Gaps = 2/77 (2%)

Query: 65  PSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHF 124
           P+ +  ++DI TI+ YC  C  ++PPR+ HC TCN C+++ DHHC W  NC+G +NY  F
Sbjct: 161 PTHSSISKDI-TIK-YCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFF 218

Query: 125 LRFLFWVIVTTAFLLAQ 141
           L FL   I+++  LL  
Sbjct: 219 LIFLLGAILSSVILLTN 235

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (47%), Gaps = 5/128 (3%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C+ C  +KP R HHC +C+ CIL MDHHCPW   C GFKN   F++FL +       +L 
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYTTFYAFLVLI 165

Query: 141 QLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXXXXXXXXXRCTMNQIFSGMSQ 200
                +G     W++S +   R+ I +  + T + A             ++ Q+ +  + 
Sbjct: 166 DTCYELG----TWFNSGSF-SRELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNNQTT 220

Query: 201 IEKWEMER 208
           IE   M R
Sbjct: 221 IELHSMRR 228

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 47/95 (49%), Gaps = 6/95 (6%)

Query: 53  SYYLAIKADPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWT 112
           SYY  I      P    K  D+K    YC  C  ++PPRA HC TC  C+L  DHHC W 
Sbjct: 156 SYYNIITLPSAHPE--GKTVDVK----YCATCRIWRPPRASHCSTCEACVLTHDHHCTWV 209

Query: 113 MNCVGFKNYPHFLRFLFWVIVTTAFLLAQLFRRIG 147
            NC+G +NY +FL FL    + T   +     R+ 
Sbjct: 210 NNCIGQRNYRYFLTFLASCCLATTLCIVGCGIRVA 244

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 51/87 (58%), Gaps = 5/87 (5%)

Query: 55  YLAIKADPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMN 114
           Y  +   P  PS+   + DI TI+ YC  C  ++PPR+ HC TCN C+++ DHHC W  N
Sbjct: 154 YYNLITLPTHPSV---HNDI-TIK-YCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNN 208

Query: 115 CVGFKNYPHFLRFLFWVIVTTAFLLAQ 141
           C+G +NY  FL FL   I ++  LL  
Sbjct: 209 CIGKRNYRFFLIFLLSAIFSSILLLVN 235

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 46/73 (63%), Gaps = 2/73 (2%)

Query: 67  IADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLR 126
           +A+KN  I+    YC  C  ++PPRA HC  C  CI + DHHC W  NCVG +NY +F+ 
Sbjct: 178 VANKNHSIEL--KYCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFII 235

Query: 127 FLFWVIVTTAFLL 139
           FL   I+++ F++
Sbjct: 236 FLVGAILSSIFII 248

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 39/61 (63%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLL 139
           YC  C  ++PPRA HC TC  C++  DHHC W  NCVG +NY +F+ FL   ++   FL+
Sbjct: 180 YCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTVLAELFLI 239

Query: 140 A 140
           A
Sbjct: 240 A 240

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 40/63 (63%), Gaps = 2/63 (3%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFW--VIVTTAF 137
           +C+ C  +KP R HHC  C KC L MDHHCPW  +CVG+ N  +F++FL +  V     F
Sbjct: 105 FCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILIF 164

Query: 138 LLA 140
           LL+
Sbjct: 165 LLS 167

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 57/128 (44%), Gaps = 32/128 (25%)

Query: 49  MIWLSYYLAIKADPGSP------SIADKNE---------DIKTIRT----------YCKK 83
           +I  +Y+  I   PGSP       I D N+         D    +T          YC K
Sbjct: 114 LILYAYFSTIAVGPGSPLDFEELRIRDLNDVETGMEFPPDFLAAKTVTLDSTGRHRYCVK 173

Query: 84  CDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFL-------FWVIVTTA 136
           C  +KP R HHC  C+KC L  DHHC W   C+G+ N+  FL FL       FW+ + T 
Sbjct: 174 CKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYAFWICIITT 233

Query: 137 FLLAQLFR 144
           + L   FR
Sbjct: 234 WDLVVWFR 241

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 35/51 (68%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFW 130
           YC  C  +KP R+HHC +CNKC L  DHHCPW  +C+GF N   F++FL +
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMY 159

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 45/83 (54%), Gaps = 9/83 (10%)

Query: 59  KADPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGF 118
           + +P   SI  K         YC+ C  ++PPRA HC  C  C++  DHHC W  NCVG 
Sbjct: 165 RGNPNGDSILMK---------YCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQ 215

Query: 119 KNYPHFLRFLFWVIVTTAFLLAQ 141
           +NY +F+ FL    + + FLLA 
Sbjct: 216 RNYRYFVTFLISGTLASIFLLAN 238

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 64/148 (43%), Gaps = 29/148 (19%)

Query: 37  WKLQLWFQFSLSMIWLSYYLAIKADPGSP-----------------------SIADKNED 73
           W L L    +L++   +YY  I   PGSP                        I+ +   
Sbjct: 37  WFLTLTIVATLTVALYTYYKVISRGPGSPLDFPDLIVHDLKAAENGLELPPEYISKRCMT 96

Query: 74  IKTIRTY--CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWV 131
           +K    +  C+ C  +KP R HHC +C+ C+L MDHHCPW   C GFKN   F++FL + 
Sbjct: 97  LKHDGRFRVCQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMYT 156

Query: 132 IVTTAFLLAQLFRRIGFIWTNWYSSSAL 159
                 +L      +G     W++S + 
Sbjct: 157 TCYAFLVLIYTCYELG----TWFNSGSF 180

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 61/129 (47%), Gaps = 7/129 (5%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C+ C  +KP R HHC +C+ CIL MDHHCPW   C GFKN   F++FL +       +L 
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTFYAFLVLI 165

Query: 141 QLFRRIGFIWTNWYSSSALVQRQEIVMLTIL-TPMDAFXXXXXXXXXXRCTMNQIFSGMS 199
                +G     W+ S +    QE++   +L   + A             ++ Q+ +  +
Sbjct: 166 YSCYELG----TWFHSGSF--NQELIDFHLLGVALLAIAIFISVLAFTAFSIYQVCNNQT 219

Query: 200 QIEKWEMER 208
            IE + M R
Sbjct: 220 TIELYGMRR 228

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 63/130 (48%), Gaps = 23/130 (17%)

Query: 41  LWFQFSLSMIWLSYYLAIKADPGS-------PSIADKNE------DIKTIRT-------- 79
           + F +S ++ +LS+      DPG+       P + +  E       I T+ +        
Sbjct: 126 ILFYYSWTLCFLSFIKTATTDPGTLPRNIHLPQLRNDYELPSEYYSIITLPSSSTNSPIQ 185

Query: 80  --YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAF 137
             YC  C  ++P RA HC TCN CI+  DHHC W  NCVG +NY +FL F++  ++T   
Sbjct: 186 LKYCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLTIIL 245

Query: 138 LLAQLFRRIG 147
           L+     R+ 
Sbjct: 246 LVINCSVRLS 255

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 8/91 (8%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C+ C +YKP R+ HC  C++C+L+ DHHC W  NCVG  NY +F  FL    +T  F L 
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFL----ITNTFSLT 192

Query: 141 QLFRRIGFIWTNWYSSSALVQRQEIVMLTIL 171
             F R   + T +Y+++  + +  +  LTIL
Sbjct: 193 YAFIR---LLTIFYTTNVYLPKNTLT-LTIL 219

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 58/125 (46%), Gaps = 12/125 (9%)

Query: 79  TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFL 138
           T+C  C   KP R+ HC  CN+C+L+ DHHC W  NC+G  NY +F  FL    V+   L
Sbjct: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTLL 190

Query: 139 LAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXXXXXXXXXRCTMNQIFSGM 198
           L   F RI  I    YS          ++LT L    AF          +  +  ++ GM
Sbjct: 191 LGYAFLRI--ILLTAYSDIGFPN----IVLTFLILSGAFFAILLVFTYLQFAL--VYDGM 242

Query: 199 SQIEK 203
           +  EK
Sbjct: 243 TTNEK 247

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (44%), Gaps = 29/147 (19%)

Query: 37  WKLQLWFQFSLSMIWLSYYLAIKADPGSP-----------SIADKNEDIK---------T 76
           W L L    +L++   +YY  I   PGSP             A+   ++          T
Sbjct: 37  WFLALTIVPTLAVALYTYYKVIARGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCLT 96

Query: 77  IR-----TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWV 131
           ++       C+ C  +KP R HHC +C+ CIL MDHHCPW   C GF+N   F++FL + 
Sbjct: 97  LKHDGRFRVCQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYT 156

Query: 132 IVTTAFLLAQLFRRIGFIWTNWYSSSA 158
            +    +L      +G     W++S +
Sbjct: 157 TLYAFLVLIYTCYELG----TWFNSGS 179

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 37/62 (59%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLL 139
           YC  C  ++PPRA HC  C  C+L  DHHC W  NCVG +NY +FL FL    +  A L+
Sbjct: 159 YCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALLI 218

Query: 140 AQ 141
           A 
Sbjct: 219 AN 220

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLL 139
           YC  C  ++PPRA HC  C+ CIL  DHHC W  NC+G +N+ +FL FLF  ++++ +LL
Sbjct: 186 YCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIWLL 245

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 46/86 (53%), Gaps = 7/86 (8%)

Query: 54  YYLAIKADPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTM 113
           YY  +    G+P   +   +IK    YC  C  ++PPR+ HC  C  CI+  DHHC W  
Sbjct: 197 YYNEVTLPTGNP---ESTINIK----YCTTCRIWRPPRSSHCSICEACIITHDHHCIWVN 249

Query: 114 NCVGFKNYPHFLRFLFWVIVTTAFLL 139
           NC+G +NY  FL FL     T+ FL+
Sbjct: 250 NCIGQRNYRFFLTFLLSGTFTSIFLI 275

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 66  SIADKNEDIKTIRT-YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHF 124
           S+   N +  T+   YC  C  ++PPRA HC  C  CIL  DHHC W  NC+G +NY +F
Sbjct: 157 SLPSANSNGLTVDVKYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYF 216

Query: 125 LRFLFWVIVTTAFLLAQLFRRIG 147
           L FL    +T    +     RI 
Sbjct: 217 LTFLVSSWLTAVICIVSCAIRIA 239

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 34/60 (56%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLL 139
           YC  C  ++PPRA HC+ C  C+   DHHC W  NCVG +NY +FL FL     T   L 
Sbjct: 185 YCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATCATCTVLF 244

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%)

Query: 67  IADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLR 126
           +  KN +      YC+ C  ++PPR+ HC  C+ C+L  DHHC W  NC+G +NY  FL 
Sbjct: 160 LPTKNPNASVSMKYCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLE 219

Query: 127 FLFWVIVTTAFLL 139
           FL    ++   L+
Sbjct: 220 FLMASTISCILLI 232

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 39/72 (54%), Gaps = 4/72 (5%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C+ C   KP R+ HC  CN CI + DHHC W  NCVG  NY +F  FL     +   LL+
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL----CSNLLLLS 191

Query: 141 QLFRRIGFIWTN 152
             F R+ FI  N
Sbjct: 192 YSFIRLIFIQFN 203

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 60/129 (46%), Gaps = 17/129 (13%)

Query: 51  WLSYYLAIKADPGSPSIADKNEDIKTIRTY----CKKCDAYKPPRAHHCKTCNKCILMMD 106
           WLS  +  K   G    + +  D   I  Y    C+ C   KP R+ HC  C +C+L+ D
Sbjct: 104 WLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVAD 163

Query: 107 HHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYS----SSALVQR 162
           HHC W  NC+G  NY  F  FL   +++ ++         GF+   W S     S +V  
Sbjct: 164 HHCVWVNNCIGKGNYQFFYAFLVVNVISLSY---------GFLRVLWISVMKDPSMVVYP 214

Query: 163 QEIVMLTIL 171
           + I++ TIL
Sbjct: 215 RSILIFTIL 223

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 51/91 (56%), Gaps = 8/91 (8%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C  C   K  R+ HC  CN+C+L+ DHHC W  NC+G  NY  F  FLF    +  F ++
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLF----SNIFSMS 191

Query: 141 QLFRRIGFIWTNWYSSSALVQRQEIVMLTIL 171
             F R+ FI  N   S+A++ R  ++ LTIL
Sbjct: 192 YAFLRLYFISFN---STAVLPR-AVLTLTIL 218

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (58%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C+ C   KP R+ HC+ CN CIL+ DHHC W  NC+G  NY +F  FL    +T  +   
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFI 198

Query: 141 QLF 143
           +LF
Sbjct: 199 RLF 201

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 36/62 (58%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C  C   KP R+ HC  CN+CIL+ DHHC W  NC+G  NY  F  FL   IV+ ++   
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSYAFL 195

Query: 141 QL 142
           +L
Sbjct: 196 RL 197

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 50/91 (54%), Gaps = 8/91 (8%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C  C   KP R+ HC  CN+C+L+ DHHC W  NC+G  NY  F  FL    ++  F + 
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL----ISNIFSMC 191

Query: 141 QLFRRIGFIWTNWYSSSALVQRQEIVMLTIL 171
             F R+ +I  N  S+S L   + ++ LTIL
Sbjct: 192 YAFLRLWYISLN--STSTL--PRAVLTLTIL 218

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 54/110 (49%), Gaps = 8/110 (7%)

Query: 62  PGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNY 121
           PGS      +  +      C  C   KP R+ HC  CN+CIL+ DHHC W  NC+G  NY
Sbjct: 117 PGSTEKYPYDYLLYYPVVKCSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNY 176

Query: 122 PHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTIL 171
             F  FL    ++  F L   F R+  I  N  S +AL   + ++ LTIL
Sbjct: 177 LQFYLFL----ISNIFSLLYAFLRLWCISLN--SKTAL--PRAVLTLTIL 218

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 59/126 (46%), Gaps = 13/126 (10%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C  C+  KP R+ HC  C  CIL+ DHHC W  NC+G  NY +F  FL    ++ ++   
Sbjct: 139 CSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAFL 198

Query: 141 QLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXXXXXXXXXRCTMNQIFSGMS- 199
           +L            S   + + + I+ L ILT   +F          +  M Q+ +GM+ 
Sbjct: 199 RLLHIT-------LSKPDVPKSKNILALCILT--GSFSVICGVFFYLQ--MKQVNNGMTT 247

Query: 200 -QIEKW 204
            + +KW
Sbjct: 248 NETDKW 253

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (64%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFL 128
           C+ C   KP R+ HC  CN+C+L +DHHC W  NCVG  NY +F  FL
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFL 182

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 69/141 (48%), Gaps = 19/141 (13%)

Query: 6   KWPWLGIAIPTFLISFIGYSAHYF------ILLDHLSWKLQLWFQFSLSMIWLSYY--LA 57
           K+ W    +P F I+   Y    F      ++ D L++  + +F   +S+I   ++  + 
Sbjct: 47  KYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHDKLTY-FERFFFIPISIISTPFFGIIT 105

Query: 58  IKADPGSPSIADKNEDIKTIR---------TYCKKCDAYKPPRAHHCKTCNKCILMMDHH 108
           +  +P + ++   N+ IK            T CK C   KP R+ HC  C++CIL+ DHH
Sbjct: 106 MLINPDT-ALMYSNDSIKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHH 164

Query: 109 CPWTMNCVGFKNYPHFLRFLF 129
           C W  NC+G  N+ +F  FLF
Sbjct: 165 CVWVNNCIGRGNFLYFYLFLF 185

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLF--WVIVTTAFL 138
           C+ C   K PR+ HC  C +CI + DHHC W  NCVG+ NY +F  FL    +++T A L
Sbjct: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCLLLTYASL 188

Query: 139 -LAQLFRRIGF 148
            L  LFR   F
Sbjct: 189 RLLTLFRITAF 199

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 59/120 (49%), Gaps = 11/120 (9%)

Query: 52  LSYYLAIKADPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPW 111
           L+ ++  K+   SP +   +E I      C+ C   K  R  HC  C++C+ + DHHC W
Sbjct: 104 LTIWIKPKSTYASPMLDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVW 163

Query: 112 TMNCVGFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTIL 171
             NC+G  NY +F  FL    V+  FL    F R+ F+          V  +++++L+IL
Sbjct: 164 ANNCIGRGNYQYFYLFL----VSNVFLTNYGFLRLLFL-------QRFVHSRQLLILSIL 212

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 47/91 (51%), Gaps = 8/91 (8%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           CK C   KP R+ HC  C+KCIL+ DHHC W  NC+G  NY  F  F    I   +  + 
Sbjct: 135 CKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLF----IGGNSLTMI 190

Query: 141 QLFRRIGFIWTNWYSSSALVQRQEIVMLTIL 171
             F R+ FI   +  +S+    + I+ + IL
Sbjct: 191 YCFTRLLFISIKYKVTSS----RAILTMNIL 217

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 29/49 (59%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLF 129
           C+ C   K  R+ HC  C +CIL+ DHHC W  NC+G  NY +F  FL 
Sbjct: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 26/44 (59%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHF 124
           C+ C   KP R+ HC  C +C+ + DHHC W  NCVG  NY  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 4/69 (5%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C+ C   K  R+ HC  C +C  + DHHC W  NC+G  NY +F  FL     +  FL  
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFL----ASNVFLTV 186

Query: 141 QLFRRIGFI 149
             F R+ ++
Sbjct: 187 YGFTRLLYL 195

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%)

Query: 79  TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFL 138
           T C+ C   K  R+ HC  C +CI + DHHC W   C+G  N+ +F  FL    +   + 
Sbjct: 137 TTCRSCHTVKWARSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTYA 196

Query: 139 LAQLF 143
            A+LF
Sbjct: 197 FARLF 201

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 37/72 (51%), Gaps = 7/72 (9%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFW-------VI 132
           +C  C + K  R HH  T   CI   DH+C W    VG KNY  F++F F+       VI
Sbjct: 131 WCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFAIFVI 190

Query: 133 VTTAFLLAQLFR 144
           V+TA  L ++ R
Sbjct: 191 VSTASFLPKIIR 202

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLL 139
           +C  C + K  R HH  T   CI   DH+C W    VG KNY  F++F F+  + T +++
Sbjct: 124 WCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFYFWLFTIYMI 183

Query: 140 AQL---FRRI 146
           A +    RRI
Sbjct: 184 ASIASFLRRI 193

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVT 134
           +C  C+  K  R+HH    N CI   DH+C W    +G  NY  F+ FLF+  V+
Sbjct: 118 WCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFVIFLFYCTVS 172

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFL- 138
           +C  CD+ K  RAHH      C+   DH C W    +G  NY  F++F+ ++ + + F+ 
Sbjct: 126 WCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAILSLFVF 185

Query: 139 --LAQLFRRI 146
             +    RRI
Sbjct: 186 VPICAFIRRI 195

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFW---VIVTTA 136
           +C  C + K  R+HH K   +CIL  DH+C W    +   NY  FL+++ W   +++   
Sbjct: 117 WCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFLQYVGWFNLLLLWYW 176

Query: 137 FLLAQLFRRIGFI 149
             +A   R IG +
Sbjct: 177 LTIAVFIRTIGML 189

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 7/101 (6%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWV---IVTTA 136
           +C  C + K  R+HH +    C+   DH+C W    +G KNY  F++++ +    +VT +
Sbjct: 126 WCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTAS 185

Query: 137 FLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAF 177
             +A   +RI     ++     L     I++L IL    AF
Sbjct: 186 LTIALFMKRI----VDYNKEHDLTLNLNIIVLFILVLAFAF 222

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 8/77 (10%)

Query: 79  TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWV------- 131
           T+C  C + K  R HH      C+   DH+C W    +G  NY  F++FL ++       
Sbjct: 124 TWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLVYMDCLLLIM 183

Query: 132 -IVTTAFLLAQLFRRIG 147
            I  + F+    FRR G
Sbjct: 184 WISMSPFIRVYTFRRDG 200

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 28/58 (48%)

Query: 73  DIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFW 130
           DI     +C  C + K  R HH K    CI   DHHC W    +G  NY  F +F+F+
Sbjct: 116 DINGYPIWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFY 173

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 16/120 (13%)

Query: 37  WKLQLWFQFSLSMIWLS-YYLAIK---ADPGSPSIADKNEDIK------------TIRTY 80
           +K +L   F + +I +  YYL IK   +DPG   I   +E+++             I+ +
Sbjct: 397 FKSRLLTNFFMFLILMQIYYLFIKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDIKNF 456

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C +    KP R+H        +   DH CPW  N +G KN+ +F+ F+    V   F ++
Sbjct: 457 CLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEVGIWFFIS 516

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 21/116 (18%)

Query: 37  WKLQLW---FQFSLSMIWLSYYLAIKADPGSPSIADKNEDIKT---------------IR 78
           W+  +W   F  S+  +   +Y  I+++PG     ++N D+++               IR
Sbjct: 409 WEEPIWNSIFGVSIIGVIYEFYKLIRSNPGRK---NRNHDMESVRKTIQTLMELGKFDIR 465

Query: 79  TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVT 134
            +C +    KP R+         +   DH+CPW  N +G +N+  F+ F+F+  VT
Sbjct: 466 HFCLETWVRKPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVT 521

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 43/93 (46%), Gaps = 12/93 (12%)

Query: 51  WLSYYLAIKADPGSPSIADKNEDIKTI------------RTYCKKCDAYKPPRAHHCKTC 98
           + ++   IK+DPG     D +E+I+ +            R +C +    KP R+      
Sbjct: 421 YYTFLHLIKSDPGLIPSNDDHEEIRNVIQELLSIGKFDTRNFCIETWIRKPLRSKFSTFY 480

Query: 99  NKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWV 131
           N  +   DH+CPW  N +G KN+  F+ F+  V
Sbjct: 481 NSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISV 513

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFL 138
           +C  C + K  R HH +    CI   DH+C W    +G  NY  F++++F+  +  A++
Sbjct: 116 WCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVFYYNLLLAWI 174

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 12/102 (11%)

Query: 40  QLWFQFSLSMIWLSYYLAIKADPGSPSIADKNEDIK------------TIRTYCKKCDAY 87
            L F   L  +  S +L   +DPG     + +E I+              R++C +    
Sbjct: 403 NLTFCAILCFVCYSLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVR 462

Query: 88  KPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLF 129
           KP R+ +    +  IL  DH+CPW  N VG KN+  F+ F+ 
Sbjct: 463 KPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFIL 504

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 31/69 (44%)

Query: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140
           C +C + K  R HH      C+   DH+C W    +G  NY  FL+F+ +  +  + +  
Sbjct: 123 CSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLSIIWV 182

Query: 141 QLFRRIGFI 149
            +   I  I
Sbjct: 183 SIVSYIHMI 191

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%)

Query: 79  TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIV 133
            +C  C + K  R  H      C+   DH+C W    +GFKNY  F++F+F+  V
Sbjct: 114 VWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFYFAV 168

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 76/216 (35%), Gaps = 32/216 (14%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLL 139
           +C  C + K  R HH      C+   DH+C W    +G  NY  F++F+ +  +    + 
Sbjct: 131 WCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFVAYFSILLLIMW 190

Query: 140 AQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXXXXXXXXXRCTMNQIFSGMS 199
           A +      I    +S    +     VMLT+   +  +             M+Q  + + 
Sbjct: 191 ASICVYTKEITQRHHSQGPRINVN--VMLTLAFAILGWLLTTSTLGSAIFYMSQNKTSLE 248

Query: 200 QIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESPEDYQEEVNGLLRQHDKRRL 259
            I    M+     F +RK                IFS      Y  E N L    +  R 
Sbjct: 249 AI----MDSKRKKFGTRK----------------IFS------YYSESNKLRFVVEFDRS 282

Query: 260 AFHSIINFPYDIDILTNATCVLGP-FFSWLNPFGAP 294
            FH+   F     IL N    +GP    WL P G P
Sbjct: 283 EFHA---FWSKKTILANVKDFMGPNMLMWLIPLGKP 315

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 57/138 (41%), Gaps = 7/138 (5%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLL 139
           +C  C + K  RAHH +    C+   DH C +  + +G  NY  F+++  ++ +  A + 
Sbjct: 126 WCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTIWLAIIW 185

Query: 140 AQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFXXXXXXXXXXRCTMNQIFSGMS 199
             +   I  I  ++    + +    I +L ILT +              C    I    +
Sbjct: 186 TSIVAYIRSITRDYRGHGSHLNGNLIAIL-ILTTLFWITVTSLLLTQLNC----IVKNKT 240

Query: 200 QIEKWEMERLESSFYSRK 217
            IE   MER   +F +RK
Sbjct: 241 SIE--VMERRRKAFSTRK 256

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 15/102 (14%)

Query: 60  ADPGSPSIADKNEDIKTI------------RTYCKKCDAYKPPRAHHCKTCNKCILMMDH 107
           +DPG       +++I+ I            + +C +    KP R+ +    N  +   DH
Sbjct: 441 SDPGCIPPETNHDNIRNIIKELLDVGKFDSKNFCLESWTRKPLRSKYSHLNNALVARFDH 500

Query: 108 HCPWTMNCVGFKNYPHFLRFLFWV---IVTTAFLLAQLFRRI 146
            CPW  N VG KN+ +F+ F+  V   I+T A L  + F  +
Sbjct: 501 FCPWIYNDVGLKNHKNFIGFILLVEAGIITFASLCFEYFDEL 542

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 45/99 (45%), Gaps = 14/99 (14%)

Query: 49  MIWLSYYLA--IKADPGSPSIADKNEDIKTIRT------------YCKKCDAYKPPRAHH 94
           +I LSY     +++DPG+      ++ I+   T            +C +    KP R+ +
Sbjct: 433 IISLSYLFVNLVRSDPGTKPAEFNHDSIRETITNLMLIGKFDTNNFCIESSVRKPLRSRY 492

Query: 95  CKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIV 133
               +  +   DH CPW  N +G KN+  F+ F+  +++
Sbjct: 493 SYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVI 531

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 37/83 (44%), Gaps = 12/83 (14%)

Query: 58  IKADPGS-PSIADKNEDIKTI-----------RTYCKKCDAYKPPRAHHCKTCNKCILMM 105
           + +DPG  P   D     +TI           + +C +  A KP R+      N  +   
Sbjct: 436 VTSDPGCVPEETDHENVRQTISDLLEIGKFDTKNFCIETWARKPLRSRFSSLNNAVVARF 495

Query: 106 DHHCPWTMNCVGFKNYPHFLRFL 128
           DH+CPW  N VG KN+  F+ F+
Sbjct: 496 DHYCPWIFNDVGLKNHKGFMFFI 518

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%)

Query: 73  DIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVI 132
           D +    +C  C + K  R HH  T   C+   DH+C W    VG KNY  F++F  +  
Sbjct: 119 DPQGYPIWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSMYFF 178

Query: 133 VTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTI 170
                +L  + + +  I  +   +S  V    +V+L +
Sbjct: 179 FYFVIVLIPVCKYLKDIIHHNRHTSPPVNPNILVLLIL 216

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 78  RTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFL 128
           +++C +    KP R+ +    N  +   DH+CPW  N VG KN+  F+ F+
Sbjct: 469 KSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query: 43  FQFSLSMIWLSYYLAI--KADPGSPSIADKN-----EDIKTI--------RTYCKKCDAY 87
           F   + ++ +SY L +  K+DPG     +KN     E IK +        + +C +    
Sbjct: 412 FLLMIIILAVSYLLVVLVKSDPGRIP-TEKNTQVIRETIKDLLATGKFDSKNFCIETWVK 470

Query: 88  KPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWV 131
           KP R+      N  +   DH+CPW  N +G +N+  FL  +  V
Sbjct: 471 KPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLV 514

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 32/70 (45%)

Query: 73  DIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVI 132
           D +    +C  C + K  R HH      C+   DH+C W    +G  NY  F++F F++ 
Sbjct: 120 DERGYPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLD 179

Query: 133 VTTAFLLAQL 142
           +    L+  +
Sbjct: 180 LVVLILMISI 189

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 15/97 (15%)

Query: 47  LSMIWLSYYL---AIKADPGS-PSIADKNEDIKTI-----------RTYCKKCDAYKPPR 91
           L ++   +YL    + +DPG  P   D     +TI           + +C +    KP R
Sbjct: 423 LMILLFEFYLFGRLVNSDPGCLPEETDHENVRQTISDLLEIGKFDTKNFCIETWTRKPLR 482

Query: 92  AHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFL 128
           +      N  +   DH+CPW  N VG KN+  F+ F+
Sbjct: 483 SKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRF 127
           +C +C + K  R HH      CI   DH+C W    +G  NY  F++F
Sbjct: 130 WCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQF 177

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 12/109 (11%)

Query: 56  LAIKADPGS-PSIADKNEDIKTI-----------RTYCKKCDAYKPPRAHHCKTCNKCIL 103
           + +++DPGS P+ +D  E   T+           + +C       P R+ +    N  I 
Sbjct: 419 ILMQSDPGSIPASSDPKEIRATMSELLRIGKFDAKHFCIHSWVRIPLRSKYKTARNVLIA 478

Query: 104 MMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTN 152
             DH+CPW  N +GF N+  FL F+ ++ +     +    R     W N
Sbjct: 479 RYDHYCPWVYNQIGFCNHKIFLFFIMFLQIGVFIFVRLSIRYFELEWQN 527

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 12/96 (12%)

Query: 46  SLSMIWLSYYLAIKADPGS-------PSIADKNEDIKTIRTY-----CKKCDAYKPPRAH 93
           ++S+I + +   I +DPG+         + +  E++  +  Y     C +    KP R+ 
Sbjct: 417 TISIICILFGKLITSDPGNIYEEKDHGLVREMVEELMKLGKYDTSNFCIETLTRKPLRSR 476

Query: 94  HCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLF 129
           +    N  +   DH+CPW  N VG KN+  FL F+ 
Sbjct: 477 YSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFIL 512

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 62/165 (37%), Gaps = 31/165 (18%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRF---------LFW 130
           +C  C + K  R+HH      CI   DH+C W    +G  NY  F++F         + W
Sbjct: 130 WCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFVQFTGYFSSLLLIMW 189

Query: 131 VIVTTAF-------------LLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAF 177
           V +                 L A +F  + F    W  +++++      M    T ++A 
Sbjct: 190 VSICVFIRNITQHHHNHNSPLNANVFLTLAFAIFGWLFTTSMLASNIFYMCQNKTYLEAI 249

Query: 178 XXXXXXXXXXRCTMNQIFSGMSQIEKW----EMERLE-SSFYSRK 217
                     R    +IF   S+  K     E ER E  SF+S+K
Sbjct: 250 MDSKRKNFGTR----KIFCYYSEANKLRFVVEFERTEFHSFWSKK 290

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 3/78 (3%)

Query: 73  DIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVI 132
           D +    +C  C + K  R HH      C+  +DH+C W    +G +NY  F +FL   +
Sbjct: 114 DTQGYPVWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFL 173

Query: 133 VTTAFL---LAQLFRRIG 147
           +    +   +  L RRI 
Sbjct: 174 MHALIIFVSVVSLQRRIA 191

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%)

Query: 78  RTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTT 135
           R +C +    KP R+         I   DH+CPW  N VG KN+  FL F+  + V  
Sbjct: 459 RHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEVAV 516

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 78  RTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVI 132
           R +C      KP R+   +     I+  DH CPW  N VG  N+  F+ FL  ++
Sbjct: 451 RHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLV 505

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 78  RTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFL 128
           + +C +    KP R+      N  +   DH+CPW  N VG KN+  F+ F+
Sbjct: 469 KNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 64/145 (44%), Gaps = 19/145 (13%)

Query: 12  IAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSL----SMIWLSYYLAIKADPGS-PS 66
           + +  FL++   +   + + L  + +  + +  F      +++ L Y   I +DPG  P 
Sbjct: 320 MMVGVFLVNMGTFIVLWLVHLQEVFFNNEYYLNFVFPVLSTLLLLCYGRLIFSDPGCIPE 379

Query: 67  IAD----KNEDIKTIR-------TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNC 115
             D    +N+  K I+       T+C K    KP R    K   + +   DH+C W  N 
Sbjct: 380 ETDTDLIRNDIEKLIKLGSFNCHTFCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYND 439

Query: 116 VGFKNYPHFLRFLFWVIVTTAFLLA 140
           VG KN+     ++F++I+   FL+ 
Sbjct: 440 VGLKNHK---LYIFFLILLETFLMT 461

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 54/125 (43%), Gaps = 17/125 (13%)

Query: 58  IKADPG----SPSIADKNEDIKTI--------RTYCKKCDAYKPPRAHHCKTCNKCILMM 105
           +++DPG      S+    E IK +          +C +    KP R+ +       +   
Sbjct: 413 VRSDPGCLKTDDSLTSIQETIKQLIDLGKFDRENFCVETLERKPLRSKYSFFSGALVARY 472

Query: 106 DHHCPWTMNCVGFKNYPHFLRFLFWV---IVTTAFLLAQLFRRIGFIW--TNWYSSSALV 160
           DH+CPW  N VG KN+  F+ F   V   +    +L    F++  +I+     Y+  AL+
Sbjct: 473 DHYCPWIYNDVGLKNHKLFVFFAVTVQYHMFLFMWLCLAYFKKTNYIYEQVEEYARCALL 532

Query: 161 QRQEI 165
           + + +
Sbjct: 533 KNETL 537

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 36/86 (41%), Gaps = 12/86 (13%)

Query: 58  IKADPGSPSIADKNEDIKTI------------RTYCKKCDAYKPPRAHHCKTCNKCILMM 105
           +++DPG   + D    ++                +C +    KP R+ +       +   
Sbjct: 396 VRSDPGCLKMDDSTTPVRETINQLIQIGKYDRNNFCVETLERKPLRSKYSLFSGALVARF 455

Query: 106 DHHCPWTMNCVGFKNYPHFLRFLFWV 131
           +H+CPW  N +G KN+  F+ F F V
Sbjct: 456 NHYCPWVYNDIGLKNHKLFMFFAFSV 481

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 89  PPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRF 127
           P RA + +  +  IL  DH+CPW  N +GF+N+  F+ F
Sbjct: 456 PLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 44/108 (40%), Gaps = 18/108 (16%)

Query: 39  LQLWFQFSLSMIWLSYYLAIKADPGSPSIADKNEDIKTIRT---------------YCKK 83
           L + F   L  + L ++  + +DPG   + +   D   IR                +C +
Sbjct: 406 LSILFVAVLGCVHLLFFQLVYSDPG---VLEPETDFNEIRNKISELLKIGKFDTKNFCIE 462

Query: 84  CDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWV 131
               KP R       ++ +L  DH+CPW  N VG  N+  F+ ++  V
Sbjct: 463 TWQRKPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 51/125 (40%), Gaps = 17/125 (13%)

Query: 58  IKADPG----SPSIADKNEDIKTI--------RTYCKKCDAYKPPRAHHCKTCNKCILMM 105
           +++DPG      S+    E IK +          +C +    KP R+         +   
Sbjct: 410 VRSDPGCLKTDDSLISIQETIKQLIQLGKFDRENFCVETLERKPLRSKFSPFSGALVARY 469

Query: 106 DHHCPWTMNCVGFKNYPHFLRFLFWV---IVTTAFLLAQLFRRIGFIW--TNWYSSSALV 160
           DH CPW  N +G KN+  FL F   V   +    +L    F+R   I+   + Y+  AL 
Sbjct: 470 DHFCPWVYNDIGLKNHKLFLFFALTVQYHMFLFMWLCLAYFKRTNHIYEQVDGYARCALF 529

Query: 161 QRQEI 165
           + + +
Sbjct: 530 KNETL 534

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%)

Query: 80  YCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFL 128
           +C  C + K  R HH      C+   DH+C W    +G  NY  F++F+
Sbjct: 136 WCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFV 184

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 36/84 (42%), Gaps = 12/84 (14%)

Query: 58  IKADPG-SPSIADKNEDIKTIRT-----------YCKKCDAYKPPRAHHCKTCNKCILMM 105
           +++DPG  P   D ++  +TI+            +C      KP R+         +   
Sbjct: 417 VRSDPGLIPEETDHSKVKETIKELLNVGKFDAKHFCISTWVRKPIRSKFSNFSRALVTRF 476

Query: 106 DHHCPWTMNCVGFKNYPHFLRFLF 129
           DH CPW  N +G +N+  FL F+ 
Sbjct: 477 DHFCPWIYNDIGLRNHKTFLFFIL 500

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 14/88 (15%)

Query: 58  IKADPGSPSIADKNEDIK-TIR-----------TYCKKCDAYKPPRAHHCKTCNKCILMM 105
           +++DPG     D +  I+ TI+            +C +    K  R+ +       +   
Sbjct: 407 VRSDPGCLKTDDSSTSIQETIKKLIQLGKFDKENFCVETLERKSLRSKYSVFSGALVARF 466

Query: 106 DHHCPWTMNCVGFKNYPHFLRFLFWVIV 133
           DH+CPW  N +G KN  H L   F + V
Sbjct: 467 DHYCPWIYNDIGLKN--HKLSLFFAMTV 492

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 12/83 (14%)

Query: 58  IKADPGS-PSIADKNEDIKTIRTYCK--KCDAYK---------PPRAHHCKTCNKCILMM 105
           +K+DPG  P   D ++  +TI+      K DA           P R+ + +     I   
Sbjct: 433 MKSDPGYIPGTVDHDKVRETIKELLSLGKFDAKHFCVHTWIRIPLRSKYDRDSACLISAF 492

Query: 106 DHHCPWTMNCVGFKNYPHFLRFL 128
           DH CPW  N +G  N+  F  F+
Sbjct: 493 DHFCPWVYNQIGLLNHKLFYMFV 515

>ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL175C
           (AIR2) and YIL079C (AIR1)
          Length = 342

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 26/66 (39%), Gaps = 12/66 (18%)

Query: 67  IADKNEDIKTIRTYCKKCDAYKPPRAHHCKTC-----NKCILMMDH---HCPWTMNCVGF 118
           + D  + I      CK C      R H  K C     + C LM DH   HCP TM C   
Sbjct: 55  VEDDADAIHEAEAKCKNCSQ----RGHIKKNCPHVICSYCGLMDDHYSQHCPRTMRCSHC 110

Query: 119 KNYPHF 124
            +  H+
Sbjct: 111 NDSGHY 116

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,305,372
Number of extensions: 1758677
Number of successful extensions: 5850
Number of sequences better than 10.0: 129
Number of HSP's gapped: 5835
Number of HSP's successfully gapped: 129
Length of query: 396
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 284
Effective length of database: 40,638,807
Effective search space: 11541421188
Effective search space used: 11541421188
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)