Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A051206.29ON1479147966600.0
KNAG0F029206.29ON1492125035990.0
NCAS0D021306.29ON1434125235750.0
ACL004W6.29ON1377124134710.0
CAGL0E02475g6.29ON1493127133800.0
ZYRO0C07524g6.29ON1670109833510.0
TDEL0G044006.29ON1490109532680.0
Kpol_1037.226.29ON1496111132000.0
TPHA0J004006.29ON1512112731120.0
SAKL0E01540g6.29ON1415107230640.0
Ecym_30336.29ON1474111630020.0
KLLA0C06182g6.29ON1519112829650.0
YOL004W (SIN3)6.29ON153698329650.0
Skud_15.1586.29ON155596629510.0
Smik_15.1666.29ON156695729450.0
Suva_15.1716.29ON156194429220.0
NDAI0C026606.29ON165788428370.0
TBLA0E031606.29ON173983628120.0
KLTH0C10956g6.29ON143395827000.0
Kwal_56.224626.29ON154193426660.0
CAGL0J11594g6.29ON9373686164e-65
Kpol_2000.451.101ON40673781.7
Kpol_1064.538.403ON48965772.4
Skud_4.541singletonON32893736.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A05120
         (1479 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  2570   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1390   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1381   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1341   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1306   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1295   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1263   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1237   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1203   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1184   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1160   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1146   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1146   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1141   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1139   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1130   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1097   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1087   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1044   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1031   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   241   4e-65
Kpol_2000.45 s2000 (87497..88717) [1221 bp, 406 aa] {ON} (87497....    35   1.7  
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    34   2.4  
Skud_4.541 Chr4 complement(960364..961350) [987 bp, 328 aa] {ON}...    33   6.3  

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 2570 bits (6660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1281/1479 (86%), Positives = 1281/1479 (86%)

Query: 1    MNQGNSSTNIPQGXXXXXXXXXXXXXXXXXXXXXGSQHQLASIQAPTTIVNANTIPPSHV 60
            MNQGNSSTNIPQG                     GSQHQLASIQAPTTIVNANTIPPSHV
Sbjct: 1    MNQGNSSTNIPQGTATNNPASAASTSSVTPPVAPGSQHQLASIQAPTTIVNANTIPPSHV 60

Query: 61   NTGENKNAVVLPSLSTLNNSTEQKEQQEQQHFNPLNILNTNGSNRKNSTMDSIMNPEPPT 120
            NTGENKNAVVLPSLSTLNNSTEQKEQQEQQHFNPLNILNTNGSNRKNSTMDSIMNPEPPT
Sbjct: 61   NTGENKNAVVLPSLSTLNNSTEQKEQQEQQHFNPLNILNTNGSNRKNSTMDSIMNPEPPT 120

Query: 121  SMVSKAXXXXXXXXXXXXXXXXXXXGNVKVKNERAPFFGTGVSVASFDXXXXXXXXXXXX 180
            SMVSKA                   GNVKVKNERAPFFGTGVSVASFD            
Sbjct: 121  SMVSKASTTNTQTTPSSSSVPPINNGNVKVKNERAPFFGTGVSVASFDNPLPPLNQQQSQ 180

Query: 181  XXFPAMHMRDXXXXXXXXXXXXXXEDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFL 240
              FPAMHMRD              EDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFL
Sbjct: 181  PSFPAMHMRDQQQQQQMAAAPAAAEDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFL 240

Query: 241  DIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPI 300
            DIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPI
Sbjct: 241  DIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPI 300

Query: 301  GSSTLHEMTRSVQRAXXXXXXXXXXXXXXXXXXXXIPIGSISNNANLNAAVQSVDDQAKQ 360
            GSSTLHEMTRSVQRA                    IPIGSISNNANLNAAVQSVDDQAKQ
Sbjct: 301  GSSTLHEMTRSVQRANSNLQQQQALSQNNMMQQAQIPIGSISNNANLNAAVQSVDDQAKQ 360

Query: 361  ANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQ 420
            ANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQ
Sbjct: 361  ANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQ 420

Query: 421  NAXXXXXXXXXXXXXSSKEQQYTGQLPQQIPNQEQLEEFSGSYARPPNAPLDMVAQQSLP 480
            NA             SSKEQQYTGQLPQQIPNQEQLEEFSGSYARPPNAPLDMVAQQSLP
Sbjct: 421  NAPDLLDDFKKFLPDSSKEQQYTGQLPQQIPNQEQLEEFSGSYARPPNAPLDMVAQQSLP 480

Query: 481  PIGSFSPPANTGISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDEIPVS 540
            PIGSFSPPANTGISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDEIPVS
Sbjct: 481  PIGSFSPPANTGISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDEIPVS 540

Query: 541  DVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHIXXXXXXXXXXXXXXXXXXXXXXXXXX 600
            DVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHI                          
Sbjct: 541  DVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHILQQQEIQQQQLMLQQQQEQELLEQQQ 600

Query: 601  XXYVEAPVRPEIDLDXXXXXXXXXXXXXXXXNFTLIEETSFFDKAKKFINNKQIYTEFLK 660
              YVEAPVRPEIDLD                NFTLIEETSFFDKAKKFINNKQIYTEFLK
Sbjct: 601  QQYVEAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINNKQIYTEFLK 660

Query: 661  VLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDL 720
            VLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDL
Sbjct: 661  VLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDL 720

Query: 721  CEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETL 780
            CEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETL
Sbjct: 721  CEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETL 780

Query: 781  FKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVI 840
            FKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVI
Sbjct: 781  FKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVI 840

Query: 841  RKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKS 900
            RKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKS
Sbjct: 841  RKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKS 900

Query: 901  LDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFD 960
            LDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFD
Sbjct: 901  LDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFD 960

Query: 961  ILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTD 1020
            ILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTD
Sbjct: 961  ILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTD 1020

Query: 1021 SALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQXXXXXXXXXXXXXXXR 1080
            SALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQ               R
Sbjct: 1021 SALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQEENNIDTIIDEESDER 1080

Query: 1081 LAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLL 1140
            LAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLL
Sbjct: 1081 LAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLL 1140

Query: 1141 ELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDI 1200
            ELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDI
Sbjct: 1141 ELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDI 1200

Query: 1201 EHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATS 1260
            EHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATS
Sbjct: 1201 EHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATS 1260

Query: 1261 AKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVT 1320
            AKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVT
Sbjct: 1261 AKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVT 1320

Query: 1321 SYSLPHPTEGIDHESLQIPFLQKIXXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYKIKIH 1380
            SYSLPHPTEGIDHESLQIPFLQKI               KSNGKYSPEGVSNSMYKIKIH
Sbjct: 1321 SYSLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSNGKYSPEGVSNSMYKIKIH 1380

Query: 1381 PGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESXXXXXXXXXXXTFLESNNGWXXXXXX 1440
            PGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHES           TFLESNNGW      
Sbjct: 1381 PGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNTFLESNNGWKKHLKK 1440

Query: 1441 XXXXXXNESEPESAETRTIPAVPASTTDKPPSMEQSTGI 1479
                  NESEPESAETRTIPAVPASTTDKPPSMEQSTGI
Sbjct: 1441 QLSLKKNESEPESAETRTIPAVPASTTDKPPSMEQSTGI 1479

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1390 bits (3599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 727/1250 (58%), Positives = 867/1250 (69%), Gaps = 69/1250 (5%)

Query: 207  DASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRG 266
            D+ YRPLNVKDALSYLEQVK QFNSRP IYNQFLDIMKDFKSQ IDTPGVIERVSTLF+G
Sbjct: 215  DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274

Query: 267  YPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIG---SSTLHEMTRSVQRAXXXXXXXX 323
            +P+LIQGFNTFLP GYRI+C SNPN+PIKVTTP+G   +    ++T   Q A        
Sbjct: 275  FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENVRGSDITADQQPAIGQLPTTQ 334

Query: 324  XXXXXXXXXXXXIPIGSISNNANLNAAVQSVDDQAKQANKKPADVEFSQAINYVNKIKNR 383
                          +   S  A      QS +  A+   KK  DVEFSQAI+YVNKIKNR
Sbjct: 335  SPIQASLPPPQSAHLHLPSTVAAATTVQQSANVHAENEPKKANDVEFSQAISYVNKIKNR 394

Query: 384  FADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAXXXXXXXXXXXXXSSKEQQYT 443
            F+DQPDIYKNFLEILQTYQREQKPINEVYAQVT+LF NA             SS   +  
Sbjct: 395  FSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKFLPDSSASNE-- 452

Query: 444  GQLPQQIPNQEQLEEFSGS-YAR-----------PP--NAPLDMVAQQSLPPIGSFSPPA 489
             Q P+Q P   Q+  +SG+  AR           PP  N P     Q +LPPIGSFSPPA
Sbjct: 453  -QQPKQSPYSPQV--YSGADMARGYMYNNTGVYYPPQVNQP-----QSNLPPIGSFSPPA 504

Query: 490  N-----TGISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDEIPVSDVRM 544
            N     TG ++    ++  +  +P+M  HEQ         P++    I+ND I +S++R 
Sbjct: 505  NGVAPTTGTAIPHADEQHVVAGVPAMAPHEQ------QHAPSM----INNDGIQISNMRG 554

Query: 545  AQYPNGAVPDYGQYPTHPQMKPDLATQRHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXYV 604
                 G VP   QY     + P   TQ+                                
Sbjct: 555  G----GTVPALNQYG---MISPHDYTQQQAKQVQQFQEDQQQQQQQSMMMDEQYGSG--- 604

Query: 605  EAPVRPEIDLDXXXXXXXXXXXXXXXXNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNL 664
            +  VRPEIDLD                N +L EETSFF+K KK I N+QIY EFLKVLNL
Sbjct: 605  DMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNL 664

Query: 665  FSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEAC 724
            FSQDLI+VD+LV KVE Y+    ELFEWF+NFVGYQ  PKIIEN++HEKHRLDLDLCEA 
Sbjct: 665  FSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAY 724

Query: 725  GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 784
            GPSYK+LPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 725  GPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 784

Query: 785  EERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVY 844
            EERHEYD+YIESNLRTIQTLE I +KI+NM+EEEK  FKL PGLGHTSLTIYKK+IRKVY
Sbjct: 785  EERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVY 844

Query: 845  DKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHL 904
            DKERGFEIID LHEHPAI  PIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHL
Sbjct: 845  DKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHL 904

Query: 905  GLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSL 964
            GLTFKQADKKLLT KQLISEISSIKVDQNNKR+HWLTPKPK QL++   D +I+FDI+ L
Sbjct: 905  GLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGL 964

Query: 965  SENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSALP 1024
            ++ F++H STYS  DKERL D  + FISLFF +P + I+ ALD ++++  S   TD+   
Sbjct: 965  TDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKS---TDTKF- 1020

Query: 1025 DGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQXXXXXXXXXXXXXXXRLAEE 1084
            +  ++ KKR   D+ELS+SDILHR KYQK+K    G                    ++E 
Sbjct: 1021 EKADDSKKRPRPDVELSLSDILHRAKYQKLK---NGEGLGMSEDDDEEKLAKEAEEMSE- 1076

Query: 1085 ADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKE 1144
                 ++A +PWL+GDI+++ N+ G++TDR  +NLF NTN+Y+F+RHW+TLY RLLELK+
Sbjct: 1077 -----KNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQ 1131

Query: 1145 MNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQW 1204
            M+  VTKEINNRK V+FAEDL L+STQL++MGLDF  K++Y+E L+LSKRLI N++EHQW
Sbjct: 1132 MDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQW 1191

Query: 1205 FEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQ 1264
            FEESLRQAYNN+AFKLYTVDKVV +LVKH HTLMTD K++E+M+LFEKDRL S+T  KDQ
Sbjct: 1192 FEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQ 1251

Query: 1265 ILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSL 1324
            ILYRL  RSHMS+TE MFR++YNKD R++ IQYI LDD+TL++   + E+W YY+TSY+L
Sbjct: 1252 ILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYAL 1311

Query: 1325 PHPTEGIDHESLQIPFLQKIXXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYKIKIHPGNY 1384
            PHPTEGI  + L +PFL++I                 + +Y+P G S S  KI I P  Y
Sbjct: 1312 PHPTEGIMQDKLVVPFLERILEFENDMLDVEA----GSDRYNPVGTSYSKLKINIDPKTY 1367

Query: 1385 ALDIQTGSFDIFSRKSLNKYPVKVNEDHESXXXXXXXXXXXTFLESNNGW 1434
             L IQ GS+DIFSR S+N+YP++ +                 FL+   GW
Sbjct: 1368 KLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQKFLDGRFGW 1417

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1381 bits (3575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 719/1252 (57%), Positives = 875/1252 (69%), Gaps = 75/1252 (5%)

Query: 207  DASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRG 266
            D +YRPLNVKDALSYLEQVK QF+ RPDIYNQFLDIMKDFKSQ+IDTPGVIERVS LFRG
Sbjct: 204  DLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRG 263

Query: 267  YPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRAXXXXXXXXXXX 326
            YP L+QGFNTFLP GYRI+C ++P+ PI+VTTP+G+STL         A           
Sbjct: 264  YPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLS--GGPAMEAPSSSESNLQQQ 321

Query: 327  XXXXXXXXXIPIGSISNNANLNAAVQSVDDQAKQANKKPADVEFSQAINYVNKIKNRFAD 386
                         S    +N     Q  D  AK A     +VEFSQAINYVNKIKNRFAD
Sbjct: 322  QHHQSPTIPSLAASTFQESNFQQTPQPEDQSAKNA-----EVEFSQAINYVNKIKNRFAD 376

Query: 387  QPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAXXXXXXXXXXXXXSSKEQQYTGQL 446
            QPDIYK FLEILQTYQREQKPINEVY+QVT+LFQ+A             SS     T +L
Sbjct: 377  QPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGTTS-TSEL 435

Query: 447  PQQIPNQEQLEEFSGS-----YARPPNA-PLDMVAQQSLPPIGSFSPPANTGISMHD-QS 499
            PQ    Q++    + +     Y  P N  P     QQ+LPPIGSF+PP  T    +   +
Sbjct: 436  PQNAGIQQRAAIPTPNPKHQQYGYPNNYYPNGTGTQQNLPPIGSFAPPNGTASREYAPGN 495

Query: 500  QRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDEIPVSDVRMA----QYPNGAVPDY 555
            Q      LPSM+ ++Q +     P       G +N+ IPVS++R      QYPN  + + 
Sbjct: 496  QFVGPGGLPSMIPNDQALQQQQQPG---LVHGYTNEAIPVSNLRSPLTDQQYPN--LLNM 550

Query: 556  GQYPTHPQMKPDLATQRHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVEAPVRPEIDLD 615
                T  QM  + AT                                  EAP+RPEIDLD
Sbjct: 551  QNQMTPGQMDINNATAPMAQQYTN-------------------------EAPIRPEIDLD 585

Query: 616  XXXXXXXXXXXXXXXXNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDL 675
                            N +L+EET+FF+KAKKFI  KQ+YTEFLK+LNL+SQDL++ D+L
Sbjct: 586  PSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDEL 645

Query: 676  VNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSD 735
              KVEYY+GS++ELF WF+NFVG+Q  P IIENIVHEKH+LDLDLCEACGPSYK+LPK+D
Sbjct: 646  CVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTD 705

Query: 736  TFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIE 795
            TFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYD+ IE
Sbjct: 706  TFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIE 765

Query: 796  SNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDA 855
            SNLRTIQTLE I NKI NM+ EEKKNFKL PGLGHTS TIYKKVIRKVYDK+RGFEIID 
Sbjct: 766  SNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDL 825

Query: 856  LHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKL 915
            LHE PA+  P+VLKRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKL
Sbjct: 826  LHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKL 885

Query: 916  LTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTY 975
            LT KQL+SEISSIKVDQ NKRIHWLTPKPKSQL F   D +I  DIL L+  FINHSSTY
Sbjct: 886  LTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTY 945

Query: 976  STSDKERLNDFLKSFISLFFSVPLNEINNALDKRNN--QKNSEKVTDSA--------LPD 1025
            S  +KER+ DFL+ F+SLFFS+PL+++N AL  R++  Q+  +K  +S+           
Sbjct: 946  SNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKTKESSRNIDSTTSSSS 1005

Query: 1026 GTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGS---DSQXXXXXXXXXXXXXXXRLA 1082
               N KKR + +I++ ++DIL + KYQK++   + S   ++Q                  
Sbjct: 1006 SGSNSKKRPL-NIDIPLADILRKHKYQKIRKQAKESNEENAQEEDDENIVGDSNEELNEQ 1064

Query: 1083 EEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLEL 1142
            +E ++I ++ KRPWLLG+II+  +  G I++RK FN+FANTNIYVF R WT +YERL E+
Sbjct: 1065 DENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEM 1124

Query: 1143 KEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEH 1202
            K++N +VTKE+N+R+  +FA+DL L+STQLK+MGLDFV  +SY+ELL LSKRLI+NDIEH
Sbjct: 1125 KQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEH 1184

Query: 1203 QWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAK 1262
            QWFEESLRQA+NN+AFKLYTVDKV+Q+LVKH HT++ D KT+E+M LFEKDRL S+TSAK
Sbjct: 1185 QWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAK 1244

Query: 1263 DQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSY 1322
            +QILYRLQ R+HM+NTE MFRIE+N++  ++CIQYIAL+DLT+K+  + E+ W+YYVTSY
Sbjct: 1245 EQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSY 1304

Query: 1323 SLPHPTEGIDHESLQIPFLQKIXXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYKIKIHPG 1382
            SLPHPTEG+  + L+IPFL+K                + + K SPEGVS+S  KIKI P 
Sbjct: 1305 SLPHPTEGVPQDELKIPFLEK--------TLELEVDEEGDNKSSPEGVSSSKLKIKIDPK 1356

Query: 1383 NYALDIQTGSFDIFSRKSLNKYPVKVNEDHESXXXXXXXXXXXTFLESNNGW 1434
            +YAL+I+ GSFD+FSRKS+N YP   +E  +             FL+  NGW
Sbjct: 1357 SYALEIEPGSFDLFSRKSMNVYPTYSDETKKRKSIDQMTK----FLDGKNGW 1404

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1341 bits (3471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/1241 (56%), Positives = 845/1241 (68%), Gaps = 89/1241 (7%)

Query: 205  EDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 264
            +D ++YRPLNVKDALSYLEQVK QF+SRPD+YN FLDIMKDFKSQ IDTPGVIERVSTLF
Sbjct: 124  QDGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 183

Query: 265  RGYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRAXXXXXXXXX 324
             GYP+LIQGFNTFLP GY I+CPS+PNDPIKVTTP G  T+ E+  +             
Sbjct: 184  HGYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFG--TIGEIPITGAGGNHAHGANTE 241

Query: 325  XXXXXXXXXXXIPIGSISNNANLNAAVQSVDDQAKQANKKPADVEFSQAINYVNKIKNRF 384
                       +   +  + A + A   +  +Q     KK  DVEFS AI+YVNKIK RF
Sbjct: 242  PRLQSTQNVPTVYRSAEGSPAAI-ATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRF 300

Query: 385  ADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAXXXXXXXXXXXXXSSKEQQYTG 444
            A+QPDIYK+FLEILQTYQREQKPINEVYAQVT+LFQNA             SS  Q    
Sbjct: 301  AEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSAPQL--- 357

Query: 445  QLPQQIPNQEQLEEFSGSY-----ARPPNAPLDMVAQQSLPPIGSFSPPANTGISMHDQS 499
            Q  QQI        F  +      A P   PL  + QQ+LPP+G+FS P +         
Sbjct: 358  QSHQQINGAMVAPGFGHAQSGLQQALPGTQPL--MHQQNLPPLGNFSTPGDH-------- 407

Query: 500  QRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDEIPVSDVRMAQYPNGAVPDYGQYP 559
               H M+LPS+      + ++      + TQG+SN  IPVSD+R A   +    +Y Q  
Sbjct: 408  ---HPMSLPSV--QGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASFRASEYNQV- 461

Query: 560  THPQMKPDLATQRHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVEAPVRPEIDLDXXXX 619
                                                       Y+E  VRPEIDLD    
Sbjct: 462  ---------------------------------------QDVQYMEPTVRPEIDLDPSLV 482

Query: 620  XXXXXXXXXXXXNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKV 679
                           L+EE +FFDKAKKFI NKQIYTEFLK+LNL+SQDL+  + LV  V
Sbjct: 483  PVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDV 542

Query: 680  EYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMP 739
             +Y+  S ELF+WF++FVGYQ  PK IEN++HEKHRLDLDLCEACGPSYKRLPK+DTFMP
Sbjct: 543  SHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMP 602

Query: 740  CSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLR 799
            CSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYD+YIE+NLR
Sbjct: 603  CSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLR 662

Query: 800  TIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEH 859
            TIQTLE I NKI+NM+ EEK  FKL PGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHEH
Sbjct: 663  TIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEH 722

Query: 860  PAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIK 919
            PAI  P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT K
Sbjct: 723  PAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAK 782

Query: 920  QLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSD 979
            QLISEISSIKVDQ+NKRIH LTPK KSQL++D K+ E+  DILSL   F+ +++TYS SD
Sbjct: 783  QLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSD 842

Query: 980  KERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSALPDGTE------NQKKR 1033
             ERL DF K FISLFFS PL+EI   L KR++Q  +    D       +      + +KR
Sbjct: 843  NERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKR 902

Query: 1034 SIHDIELSMSDILHRTKYQKMKLSNRGSDSQXXXXXXXXXXXXXXXRLAEEADLIRQDAK 1093
               D E  + DIL+R K QK+   N+G  +                   EE +++RQ+AK
Sbjct: 903  VRDDTEHLLRDILYRNKQQKV---NKGPQNDQSSEEFEKESD------IEEKEIVRQEAK 953

Query: 1094 RPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEI 1153
            +PWLLG I+D+ +  G ++DR  FN+FANTNIYVF RH TT+YERL+E+K++NGEVTKEI
Sbjct: 954  KPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEI 1013

Query: 1154 NNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAY 1213
            +NRK V+FA+DL L+STQL +MGLDF   D+YEELLRLS+ LI  ++EHQWFEESLRQAY
Sbjct: 1014 SNRKVVQFAKDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAY 1073

Query: 1214 NNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARS 1273
             N+AFKLYT+DKV+QALVKH HT++ D+KT E+M LF+ DR S++TS KDQILYRLQ RS
Sbjct: 1074 KNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRS 1133

Query: 1274 HMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDH 1333
            +MSN E MFRIEYN    +  IQ++A++DLTL E  +  +KW+YY+TSYSL HPTEGI H
Sbjct: 1134 NMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISH 1193

Query: 1334 ESLQIPFLQKIXXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSF 1393
            ++L+ PFL+KI                 + +YSPEGV++S  K+KI P  Y+++++ G  
Sbjct: 1194 DNLRTPFLEKI------IERDEGYIDDGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCH 1247

Query: 1394 DIFSRKSLNKYPVKVNEDHESXXXXXXXXXXXTFLESNNGW 1434
            DIFSRKS+NK+P +V  D +             FL    GW
Sbjct: 1248 DIFSRKSVNKFPTRV--DVKKKKSAELKLVLEGFLNGERGW 1286

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1306 bits (3380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/1271 (54%), Positives = 856/1271 (67%), Gaps = 116/1271 (9%)

Query: 206  DDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFR 265
            D  SYRPLNVKDALSYLEQVK QF++RPDIYN FLDIMKDFKSQTIDTPGVIERVS+LF+
Sbjct: 181  DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240

Query: 266  GYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRAXXXXXXXXXX 325
            GYP+LIQGFNTFLP GYRI+C +NPNDPIKVTTP+GSST   +  + Q++          
Sbjct: 241  GYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTT-VLNTAPQKSPSPSDIQTNN 299

Query: 326  XXXXXXXXXXIPIGSISNNANLNAAVQSVDDQAK-----QANKKPADVEFSQAINYVNKI 380
                          +I+  A L +    +  Q        + KKPADVEFSQAI YVNKI
Sbjct: 300  QQTQ----------AIAQEAQLQSQATPIPTQHDVGQNFGSAKKPADVEFSQAITYVNKI 349

Query: 381  KNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAXXXXXXXXXXXXXSSKEQ 440
            K RFADQPDIYK FLEILQTYQREQKPI+EVYAQVTILFQNA             SS   
Sbjct: 350  KTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLDDFKKFLPDSSASG 409

Query: 441  QYTGQLPQQIPNQEQLEEFSGSYARPPNAPLDMVAQQS---------------------- 478
                Q+ QQ   Q   ++  G+      A   M AQ                        
Sbjct: 410  SEETQVQQQQHYQSLSDKMGGNAEAANYAASGMNAQTGYYEPVKGGVSYNTQQNQHQQQN 469

Query: 479  LPPIGSFSPPANTG-ISMHDQSQRPH----MMALPSMLQ-------------HEQII-DM 519
            LPPIGSFSPP N   +    QS  P     +M+LPSM+              H ++I D 
Sbjct: 470  LPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDS 529

Query: 520  NNH-PKPAVSTQGI-SNDEIPVSDVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHIXXX 577
            ++H  +  V +Q I SND+IPVS++R        V +   +P     +   A Q  +   
Sbjct: 530  HDHNSQQQVLSQNIHSNDDIPVSNLRTT------VVEQNYHPETIYQQQGNAQQHMVDGG 583

Query: 578  XXXXXXXXXXXXXXXXXXXXXXXXXYVEAP----VRPEIDLDXXXXXXXXXXXXXXXXNF 633
                                     YV  P    VRPEIDLD                + 
Sbjct: 584  -------------------------YVGTPSELVVRPEIDLDPSLVPVVPEPTEPIENSL 618

Query: 634  TLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWF 693
             L+EET+FF++ KK I NKQIY EFLK+LNLFS DL++VD+LV+KVEYYIG++KELF+WF
Sbjct: 619  NLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFDWF 678

Query: 694  RNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLND 753
            + FVGYQ  PK IENIVHEKH+LDLDLCEA GPSYK+LPK+DTFMPCSGRDDMCWEVLND
Sbjct: 679  KVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVLND 738

Query: 754  EWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISN 813
            EWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLE I NKI+N
Sbjct: 739  EWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKIAN 798

Query: 814  MSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQ 873
            M++ EK  F+L PGLGHTS+TIYKKVIRKVYDKERGFEIIDALH +PAI+ PI+L+RLKQ
Sbjct: 799  MTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRLKQ 858

Query: 874  KDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQN 933
            KDEEWRRAQREWNK+WR+LEQKVYFKSLDHLGLTFKQADKKLLT KQLISEI+ IKVDQN
Sbjct: 859  KDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVDQN 918

Query: 934  NKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISL 993
            +KRIHWLTPKPK+QL++D  D++ILFDI++L   F  +++ YS  DKER+ D L+ F+S 
Sbjct: 919  SKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFVSQ 978

Query: 994  FFSVPLNEINNALDKR--------NNQKNSEKVTDSALPDG-----TENQKKRSIHDIEL 1040
            FFS+PL E+++AL++R        ++ K S K+   A   G     T + KKR   D +L
Sbjct: 979  FFSIPLKEVSDALERRGFSDDNNNDSDKGSGKMDQIAEEIGETEQDTSSSKKRPF-DNDL 1037

Query: 1041 SMSDILHRTKYQKMKLSNRGSDSQXXXXXXXXXXXXXXXRLAEEADLIRQDAKRPWLLGD 1100
            +MSDILH+TK QK K++     S+                + +   L   + ++ WL+GD
Sbjct: 1038 NMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGT--IEDSGSL--SEHRKQWLVGD 1093

Query: 1101 IIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVK 1160
            ++D  N +  + +R  +NLFANTNIY+F RH  TLYERL E+K++N E+ KEI +R+   
Sbjct: 1094 VVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTT 1153

Query: 1161 FAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKL 1220
            FA+DLGL+STQL  +GLDF   D+Y++LL LSKRLIE DIEHQWFEES+RQAYNNRAFKL
Sbjct: 1154 FAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKL 1213

Query: 1221 YTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEY 1280
            YT+DKVVQ+ VKH HTL++D KT+E+M LFE  R ++ T+ KDQILYR+Q RSHMS+TE 
Sbjct: 1214 YTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTEN 1273

Query: 1281 MFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPF 1340
            MFRIEY ++ R+  IQYIALDDLTLK   + EE W YYVTSYSL +PTEG+ HE+L++PF
Sbjct: 1274 MFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPF 1333

Query: 1341 LQKIXXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKS 1400
            L+K+                +N  YS  G+S S   I I    Y L +Q GS D++SR +
Sbjct: 1334 LEKV----IEFDQEYSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRAT 1389

Query: 1401 LNKYPVKVNED 1411
            + KYP+  +++
Sbjct: 1390 IQKYPIVASDE 1400

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1295 bits (3351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/1098 (60%), Positives = 787/1098 (71%), Gaps = 37/1098 (3%)

Query: 354  VDDQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYA 413
            V  Q     KK ADVEFSQAI+YVNKIKNRF+DQPDIYK+FLEILQTYQREQKPINEVYA
Sbjct: 506  VQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYA 565

Query: 414  QVTILFQNAXXXXXXXXXXXXXSSKEQQYTGQLPQQIPNQEQLEEFSGSYAR-PPNAPLD 472
            QVT+LFQNA             SS       +   Q   Q Q    +  Y     N P  
Sbjct: 566  QVTVLFQNAPDLLDDFKKFLPDSSASAAQQQRQQLQPVMQHQQAAAATGYGYYGENQP-- 623

Query: 473  MVAQQSLPPIGSFSPPANTGISMHDQSQRPHM-MALPSMLQHEQIIDMNNHPKPAVSTQG 531
             VA+Q+LPP+GSFSPP N G +  D  Q P   MALP M  H +       P   V TQG
Sbjct: 624  -VARQNLPPLGSFSPPPN-GTAPRDYYQEPSQGMALPPMT-HLETQAAKVTPSHYVMTQG 680

Query: 532  ISNDEIPVSDVRMAQYPNGAVPDYGQYP--THPQMKPDLATQRHIXXXXXXXXXXXXXXX 589
            +SND IP+S++R    P    P   Q P  T PQ     + Q+                 
Sbjct: 681  MSNDAIPLSNMRS---PTVGAPG-AQTPVETAPQHPQQYSPQQAPQPQLPQQQLPPQQQE 736

Query: 590  ----------XXXXXXXXXXXXXYVEAPVRPEIDLDXXXXXXXXXXXXXXXXNFTLIEET 639
                                   YV+  VRPEIDLD                + +L+EET
Sbjct: 737  QSLPPQTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDPSIVPVVPEPTEPIEDSLSLVEET 796

Query: 640  SFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGY 699
            SFFDKAKKFI NKQ+YTEFLK+LNL+SQDL+ +D LV KVE+Y+G SKELF WF+NFVGY
Sbjct: 797  SFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGY 856

Query: 700  QGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHP 759
            Q  PK IEN++HEKHRLDLD+CEA GPSYK+LPKSDTFMPCSGRD+MCWEVLNDEW+GHP
Sbjct: 857  QDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHP 916

Query: 760  VWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEK 819
            VWASEDSGFIAHRKNQYEETLFK+EEERHEYD+YIESNLRTIQTLE I +KI+NM+EEEK
Sbjct: 917  VWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEK 976

Query: 820  KNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWR 879
             NFKL PGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPA+A P+VLKRLKQKDEEWR
Sbjct: 977  ANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWR 1036

Query: 880  RAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHW 939
            RAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ NKRIHW
Sbjct: 1037 RAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHW 1096

Query: 940  LTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPL 999
            LTPKPKSQL++D  D EI  DILSL+E F+NH+  YS SDKERL DFLKSF+SLFFS+P+
Sbjct: 1097 LTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFFSIPV 1156

Query: 1000 NEINNALDKRNNQKNSEKVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNR 1059
            +E+N+ L +R +  N E+   +   +GT     +   +IEL + DILHR KYQK+KL   
Sbjct: 1157 SEVNDGL-RRRSPSNKEEHEANKKENGTALAHGKRPREIELPLRDILHRNKYQKLKLR-- 1213

Query: 1060 GSDSQXXXXXXXXXXXXXXXRLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNL 1119
             SD +                + EE ++I+Q+AK+PWLLG+I+++ N QGII++RK FNL
Sbjct: 1214 -SDGEEGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLGNIVEEANAQGIISNRKSFNL 1272

Query: 1120 FANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDF 1179
            FANT+IYVF RH TTLYERL+E+K ++ EVT+EIN+RK  +FA+DL L+S QLKNMGLDF
Sbjct: 1273 FANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDF 1332

Query: 1180 VDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMT 1239
               D+YE+LL LSKRLIE DIEHQWFEESLRQAYNNRAFK YTVDKVVQALVKH HT++T
Sbjct: 1333 AGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILT 1392

Query: 1240 DYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIA 1299
            D K +E+M LFEKDR  + TSAKDQILYR+QARSHMSNTE MFRIE+N+  +++CIQYIA
Sbjct: 1393 DIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIA 1452

Query: 1300 LDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKIXXXXXXXXXXXXXXX 1359
            +DDLTL E  + E+KWKYYVTSYSL HPTEGI HE LQ+PFL+KI               
Sbjct: 1453 IDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKI-------IESEQEYD 1505

Query: 1360 KSNG---KYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESXX 1416
            + NG   K+SPEGVS S  +IKI P  Y L+++ GS D+FSRK++NK+P++ N +     
Sbjct: 1506 EDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTK 1565

Query: 1417 XXXXXXXXXTFLESNNGW 1434
                      +L+S  GW
Sbjct: 1566 VDKKNELIRGYLDSEKGW 1583

 Score =  186 bits (472), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/109 (79%), Positives = 94/109 (86%)

Query: 207 DASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRG 266
           D  YRPLNVKDALSYLEQVK QFNSRPD+YN FLDIMKDFKSQ IDTPGVIERVSTLFRG
Sbjct: 274 DQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333

Query: 267 YPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRA 315
           YP+LIQGFNTFLP GYRIDC  NP++PIKVTTP+GSST+  +    Q A
Sbjct: 334 YPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAA 382

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 278 LP 279
           LP
Sbjct: 585 LP 586

 Score = 36.2 bits (82), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 32/49 (65%)

Query: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQN 421
           A++Y+ ++K +F  +PD+Y +FL+I++ ++ +      V  +V+ LF+ 
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 215 VKDALSYLEQVK-----QQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPS 269
           ++D+LS +E+       ++F     +Y +FL I+  +    +D  G++E+V     G   
Sbjct: 786 IEDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKE 845

Query: 270 LIQGFNTFLPTGYRIDCPSN 289
           L   F  F+  GY+ D P N
Sbjct: 846 LFTWFKNFV--GYQ-DRPKN 862

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1263 bits (3268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/1095 (59%), Positives = 776/1095 (70%), Gaps = 60/1095 (5%)

Query: 349  AAVQSVDDQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPI 408
            AA Q     +    KK ADVEFSQAINYVNKIKNRFA+QPDIYK+FLEILQTYQREQKPI
Sbjct: 361  AAGQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPI 420

Query: 409  NEVYAQVTILFQNAXXXXXXXXXXXXXSSKEQQYTGQLPQQIPNQEQLEEFSGSY--ARP 466
            NEVYAQVT+LFQNA             SS       Q P  +  Q      S  Y    P
Sbjct: 421  NEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSANRQQQQPGVLQQQSPAFGLSAYYNETSP 480

Query: 467  PNAPLDMVAQQSLPPIGSFSPPANTGISM-HDQSQRPHMMALPSMLQHEQIIDMNNHPKP 525
            P       ++Q+LPP+GSFSPP N  +   + + Q+P  + LP + Q E  ID  +   P
Sbjct: 481  P------TSRQNLPPLGSFSPPPNGAVPHNYYRDQQPQTLGLPPVAQVENHIDQRS--PP 532

Query: 526  AVSTQGISNDEIPVSDVR---MAQYPN--GAVPDYGQYPTHPQMK-PDLATQRHIXXXXX 579
             ++TQGI+ + +PVS++R    AQ P+    +    Q P+ P    PD            
Sbjct: 533  HIATQGIAGEPMPVSNLRSQITAQSPSELAQLHQQQQIPSQPTANIPD------------ 580

Query: 580  XXXXXXXXXXXXXXXXXXXXXXXYVEAPVRPEIDLDXXXXXXXXXXXXXXXXNFTLIEET 639
                                   Y++  VRPEIDLD                + TL+EET
Sbjct: 581  ---------------------GQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEET 619

Query: 640  SFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGY 699
            SFFD+AKKFI NKQIYTEFLK+LNLFSQDL+ VD+LV +VE+Y+G +KELF WF+NFVG+
Sbjct: 620  SFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGF 679

Query: 700  QGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHP 759
            Q  PK IENIVHEKHRLDLDLCEACGPSYK+LPKSDTFMPCSGRD+MCW VLNDEWVGHP
Sbjct: 680  QDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHP 739

Query: 760  VWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEK 819
            VWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQTLE I +KI+NMSEEEK
Sbjct: 740  VWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEK 799

Query: 820  KNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWR 879
              FKL PGLGHTSLTIYKKVIRKVYDKERGFEIIDALHE+PAIA P+VLKRLKQKDEEWR
Sbjct: 800  ATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWR 859

Query: 880  RAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHW 939
            RAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLT KQLISEI SIK DQ NKR+HW
Sbjct: 860  RAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHW 919

Query: 940  LTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPL 999
            LTPKPK QL++ + D  + FDILSL++ FINH+S+YS  DK RL D  K F+SLFFS+P+
Sbjct: 920  LTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPM 979

Query: 1000 NEINNALDKRNNQKNSEKVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNR 1059
             E+N A+ +R N  + ++ +   +     N  KR   D E+S+S++LHR K Q+ K  +R
Sbjct: 980  YEVNEAVSRRGNLDDDKEDSTQKMESDNLNNSKRPRED-EISLSEVLHRAKNQRFK--SR 1036

Query: 1060 GSDSQXXXXXXXXXXXXXXXRLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNL 1119
             +D                  L EE + IRQ+AK+PWLLG+++++ N QG+I +RK FN+
Sbjct: 1037 AADE-----TSEESAAEPEPELNEEEETIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNM 1091

Query: 1120 FANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDF 1179
            FANTNIYVF RH TTLYERL E+K+MN  VTKEIN+RK V+FA+DL L+S QLK MGLDF
Sbjct: 1092 FANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDF 1151

Query: 1180 VDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMT 1239
               D+YE+L  L KRLIE DIEHQWFEESLRQAYNN+AFKLYTVDKV+Q+LVKH HT++T
Sbjct: 1152 EGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILT 1211

Query: 1240 DYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIA 1299
            D KT+E+M  FEKDR    TSAKDQILYRLQ RS+MS+TE MFRIEYNK  +N+ IQ+IA
Sbjct: 1212 DSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIA 1271

Query: 1300 LDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKIXXXXXXXXXXXXXXX 1359
            +DDLTL E  + EEKW+YYVTSYSL HPTEGI  E LQ+PFL+K+               
Sbjct: 1272 VDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETEEDYGSDVDNF- 1330

Query: 1360 KSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESXXXXX 1419
             S  K+SPEGVS S  KIKI P  Y LDI+ GS+D+FSRKS+N++PV V+ +  +     
Sbjct: 1331 -SIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEK 1389

Query: 1420 XXXXXXTFLESNNGW 1434
                   FLES  GW
Sbjct: 1390 KKNMVIQFLESKKGW 1404

 Score =  183 bits (464), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 81/99 (81%), Positives = 92/99 (92%)

Query: 207 DASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRG 266
           DA YRPLNVKDALSYLEQVK QFNSRPD+YN FLDIMKDFKSQ IDTPGVI+RVSTLF+G
Sbjct: 188 DAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247

Query: 267 YPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTL 305
           YP LIQGFNTFLP GYRI+C +NP++PI+VTTP+GSS++
Sbjct: 248 YPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSV 286

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 38/62 (61%)

Query: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277
           A++Y+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 444

Query: 278 LP 279
           LP
Sbjct: 445 LP 446

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 32/49 (65%)

Query: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQN 421
           A++Y+ ++K +F  +PD+Y +FL+I++ ++ +      V  +V+ LF+ 
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKG 247

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1237 bits (3200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/1111 (56%), Positives = 783/1111 (70%), Gaps = 55/1111 (4%)

Query: 336  IPIGSISNNANLNAAVQSVDDQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFL 395
            IP G++      N      + Q     +KPADVEFSQA++YVNKIKNRFADQPDIYK+FL
Sbjct: 335  IPAGTVPGTTVAN------NIQGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFL 388

Query: 396  EILQTYQREQKPINEVYAQVTILFQNAXXXXXXXXXXXXXSS----KEQQYTGQLPQQIP 451
            EILQTYQREQKPI+EVYAQVT+LFQNA             SS     +Q    Q      
Sbjct: 389  EILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSVTTQQPVQPQQQALPQ 448

Query: 452  NQEQLEEFSGSYARPPNAPLDMVAQQSLPPIGSFSPPANTGISMHDQS----QRPHMMAL 507
             Q+ +   +  Y +    P    A Q+LPP+G+FSPP+N  +    +      + HMMAL
Sbjct: 449  QQQPMYGVNNGYYQAGKIP---SANQNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMAL 505

Query: 508  PSMLQ----HEQIIDMNNHPKPAVSTQGISNDEIPVSDVRMAQYPNGAVPDYGQYPTHPQ 563
            PSMLQ    H Q+     H  P      ++N+ IP+SD+R     N  V +Y        
Sbjct: 506  PSMLQAPTEHAQL-HAQQHIAP------MTNEAIPISDLRSQIIDNNHVHNY-------- 550

Query: 564  MKPDLATQRHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVEAPVRPEIDLDXXXXXXXX 623
                  T   +                              E  VRPEIDLD        
Sbjct: 551  ------TPIELAQLQQQQQQQQQQQQQQQQQQMQLEAAYATEGIVRPEIDLDPSIVPVIP 604

Query: 624  XXXXXXXXNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYI 683
                    + +L+EE +FFDKAKKFI NKQ+Y EFLK+LNL+SQD++S+DDL+ KV+YY+
Sbjct: 605  EPTEPIEESLSLVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYYL 664

Query: 684  GSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGR 743
            GS+KELF+WF+NFVG+Q  PK IEN+VHEKH+LDLDLCEACGPSYK+LPK+DTFMPCSGR
Sbjct: 665  GSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGR 724

Query: 744  DDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQT 803
            D+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQT
Sbjct: 725  DEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQT 784

Query: 804  LEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIA 863
            LE I +KI+NM+EEEK+ FKL  GLGHTS TIY+KVIRKVYDKERGFEIIDALHE+P++A
Sbjct: 785  LETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSVA 844

Query: 864  APIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLIS 923
             P+VLKRLKQKD+EWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQ+DKKLLT KQL++
Sbjct: 845  VPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLLA 904

Query: 924  EISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERL 983
            EISSIKVDQ NKRIHWLTPKPKSQL++++KD  +LFDIL L++ FINH+S+YS  DKERL
Sbjct: 905  EISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKERL 964

Query: 984  NDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSALPDGTENQKKRSIHDIELSMS 1043
             DFL+S+I LFFS+P+ EI +A++   +  N +++ ++      +N  KR   D+E+ +S
Sbjct: 965  RDFLQSYIGLFFSIPIREIKDAVEAAID--NGKQLDENEQNSSKKNSNKRP-RDVEICLS 1021

Query: 1044 DILHRTKYQKMKLSNRGSDSQXXXXXXXXXXXXXXXRLAEEADLIRQDAKRPWLLGDIID 1103
            DIL+R++YQ++K S   S++                   +  ++IRQ+AK+PWLLG +++
Sbjct: 1022 DILNRSRYQRLKHSLDSSEASLGAVSPGQNEQD------DMDEMIRQEAKKPWLLGSLVE 1075

Query: 1104 KTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAE 1163
            + N+QG+I +RK +N+FAN N+YVF+R+  T+Y+RL E+K++N  VTKEIN RK V+FA+
Sbjct: 1076 EANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFAK 1135

Query: 1164 DLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTV 1223
            DL L+S QLKNMGLDF   DSY +LL LSKRLIE D+EHQWFEESLRQAY NRAFKLYT+
Sbjct: 1136 DLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYTI 1195

Query: 1224 DKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFR 1283
            DKV+Q+LVKH H +MTD K+++VM LFEKDR+SS+T++KDQILYRLQ RSHMS TE+MFR
Sbjct: 1196 DKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMFR 1255

Query: 1284 IEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQK 1343
            IEYN    +I IQYIALDDLTL+E  T E+KWKYY+TSYSL HPTEGI  E ++IPFL K
Sbjct: 1256 IEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLDK 1315

Query: 1344 IXXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNK 1403
            +                 N KYSPEGVS S   IKI P  Y L+++ GSFDIFSRKS+NK
Sbjct: 1316 V----IESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNK 1371

Query: 1404 YPVKVNEDHESXXXXXXXXXXXTFLESNNGW 1434
            +PV V  +               FL   +GW
Sbjct: 1372 FPVDVFSESYKVKKQTRRNRCKNFLNGKHGW 1402

 Score =  184 bits (467), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 94/147 (63%), Positives = 104/147 (70%), Gaps = 13/147 (8%)

Query: 156 PFFGTGVSVASFDXXXXXXXXXXXXXXFPAMHMRDXXXXXXXXXXXXXXEDDASYRPLNV 215
           P   T +SVASFD               PA H++                D + YRPLNV
Sbjct: 80  PKTSTTLSVASFDNPLPPA---------PAAHLQQQQQQQQQQQQA----DGSYYRPLNV 126

Query: 216 KDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFN 275
           KDAL+YLEQVK QFNSRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFRGYP+LIQGFN
Sbjct: 127 KDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFN 186

Query: 276 TFLPTGYRIDCPSNPNDPIKVTTPIGS 302
           TFLP GY I+C SNP+DPIKVTTP+GS
Sbjct: 187 TFLPQGYTIECSSNPDDPIKVTTPLGS 213

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 211 RPLNVK--DALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYP 268
           +P +V+   A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P
Sbjct: 357 KPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAP 416

Query: 269 SLIQGFNTFLP 279
            L+  F  FLP
Sbjct: 417 DLLDDFKKFLP 427

 Score = 35.8 bits (81), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 31/48 (64%)

Query: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQ 420
           A+ Y+ ++K +F  +PDIY +FL+I++ ++ +      V  +V+ LF+
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1203 bits (3112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/1127 (55%), Positives = 768/1127 (68%), Gaps = 49/1127 (4%)

Query: 342  SNNANLNAAVQSVDDQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTY 401
            S NA +   + ++     +  +KPADVEFSQA++YVNKIKNRF D+PDIYK FLEILQTY
Sbjct: 326  SANAPIQPNMHNMTQDTMKITEKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTY 385

Query: 402  QREQKPINEVYAQVTILFQNA-------------XXXXXXXXXXXXXSSKEQQYTGQLPQ 448
            Q+EQKPI+EVY+QVTILFQNA                           +   QY      
Sbjct: 386  QKEQKPIHEVYSQVTILFQNAPDLLDDFKKFLPDNNNSAGAETNQNIQANAMQYQQLHQN 445

Query: 449  QIPNQEQLEEFSGSYARPPNAPL----------DMVAQQSLPPIGSFSPPANTGISMHDQ 498
             +   + + E +  Y    N P           ++V  QSLPP+G+F PP+N   +    
Sbjct: 446  NVAIPQHIYENNTYYQN--NVPTAAAAAANAAGNVVTIQSLPPLGNFLPPSNKNNNTTAV 503

Query: 499  SQRPHMMALPSMLQ--------HEQIIDMNNHPKPAV--STQGISNDEIPVSDVRMAQYP 548
            +    +M + S++          + I D      PA   ST  ++N+ + +S++R +   
Sbjct: 504  NNN--LMGISSIMHPKVDHIQSQQYIADQKQAYTPAQQQSTTQLTNEAMQISELRGSPMM 561

Query: 549  NGAVP-DYGQYPTHPQMKPDLATQRHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVEAP 607
            +G    +       P     L  Q+HI                              +  
Sbjct: 562  DGQTARNLANVNYSPAELNQLQAQQHISIQQQQQQQQQQQQQLQMQMQMQMDGGYPQDIS 621

Query: 608  VRPEIDLDXXXXXXXXXXXXXXXXNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQ 667
            VRPEIDLD                + +L+EET+FFDKAKKFINNKQIY EFLK+LNL+SQ
Sbjct: 622  VRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNLYSQ 681

Query: 668  DLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPS 727
            ++++V++LV KV+YY+GS+KELF+WF+ FVGYQ  PK IENIVHEKH+LDLDLCEA GPS
Sbjct: 682  NILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAYGPS 741

Query: 728  YKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 787
            YK+LPK+DTFMPCSGRD+MCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIEEER
Sbjct: 742  YKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 801

Query: 788  HEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKE 847
            HEYD+YIESNLRTIQTLE I +KI+NM+EEE+ NFKL  GLGHTS+TIY+KVIRKVY KE
Sbjct: 802  HEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVYGKE 861

Query: 848  RGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLT 907
            RGFE+IDALHE+PA+A PI+LKRLKQKDEEWRRAQREWNKVWREL+QKVY+KSLDHLGLT
Sbjct: 862  RGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGLT 921

Query: 908  FKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSEN 967
            FKQADKKLLT KQLISEISSIKVDQ NK++HWLTPKPKSQL++ + D +IL+DIL L++ 
Sbjct: 922  FKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKLTDV 981

Query: 968  FINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSALPDGT 1027
            FINH+S YS  DKERL DFL+SFISLFF +PL +I  A+  R+   +++  ++ +  D  
Sbjct: 982  FINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIKIRSPLDDTKTDSEESSGDSD 1041

Query: 1028 ENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQXXXXXXXXXXXXXXXRLAEEADL 1087
            +  KKRSI D ++S  DIL + KYQK+K   +G D                    ++ +L
Sbjct: 1042 KFPKKRSIEDDDISFHDILDKVKYQKVK---QGLDKNETFSNDISSATS-----VDDDEL 1093

Query: 1088 IRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNG 1147
            IRQ+A++PWLLG I+D  N+ GII +R K+N+F NTNIYVF+RH  TLYERL E K+MN 
Sbjct: 1094 IRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNA 1153

Query: 1148 EVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEE 1207
            EVT+EI NR  V FA+DL LVSTQLKNMGLDF   DSY++LL LS RLIE ++EH WFEE
Sbjct: 1154 EVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEE 1213

Query: 1208 SLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILY 1267
            SLRQA+ N+AFKLYT+DKV Q++VKH HT+M+D KT E+M L EKDR  + TS+KDQILY
Sbjct: 1214 SLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILY 1273

Query: 1268 RLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHP 1327
            RLQARSHMS T+ MFRIE+NK   NI IQYI +DDLTL E  T EEKWKYY+TSY+L HP
Sbjct: 1274 RLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHP 1333

Query: 1328 TEGIDHESLQIPFLQKIXXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYKIKIHPGNYALD 1387
            TEG+  E +QIPFL+KI                 N KYSP+GVS S  KIKI P NYAL+
Sbjct: 1334 TEGVPQEEIQIPFLEKILETEEAYAEEEEVI---NDKYSPKGVSQSDLKIKISPENYALE 1390

Query: 1388 IQTGSFDIFSRKSLNKYPVKVNEDHESXXXXXXXXXXXTFLESNNGW 1434
            I+ GSFD FSR S+NKYP+ V  D               FL    GW
Sbjct: 1391 IEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGW 1437

 Score =  186 bits (471), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 92/100 (92%)

Query: 206 DDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFR 265
           D+  YRPLNVKDAL+YLEQVK QF+SRPDIYN FLDIMKDFKSQ+IDTPGVIERVSTLFR
Sbjct: 138 DEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197

Query: 266 GYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTL 305
           GYPSLIQGFNTFLP GY I+C +NPNDPIKVTTPIGS T+
Sbjct: 198 GYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETI 237

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 211 RPLNVK--DALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYP 268
           +P +V+   A+SY+ ++K +F   PDIY  FL+I++ ++ +      V  +V+ LF+  P
Sbjct: 348 KPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAP 407

Query: 269 SLIQGFNTFLP 279
            L+  F  FLP
Sbjct: 408 DLLDDFKKFLP 418

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 44/82 (53%), Gaps = 7/82 (8%)

Query: 346 NLNAAVQSVDDQAKQAN-KKPADVEFSQAIN------YVNKIKNRFADQPDIYKNFLEIL 398
           N+N    +       AN  K +D +F + +N      Y+ ++K +F+ +PDIY +FL+I+
Sbjct: 116 NVNTTYSATAGTTASANDSKESDEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIM 175

Query: 399 QTYQREQKPINEVYAQVTILFQ 420
           + ++ +      V  +V+ LF+
Sbjct: 176 KDFKSQSIDTPGVIERVSTLFR 197

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1184 bits (3064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1072 (57%), Positives = 753/1072 (70%), Gaps = 78/1072 (7%)

Query: 363  KKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNA 422
            KK  DVEFS AI+YVNKIK RFA+QPDIYK+FLEILQTYQREQKPINEVYAQVT+LFQNA
Sbjct: 334  KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 393

Query: 423  XXXXXXXXXXXXXSSKEQQYTGQLPQQIPNQEQLEEFSGSYARPPNAPLDMVAQQSLPPI 482
                         +S  Q  T   P            +G    P  AP     QQ+LPP+
Sbjct: 394  PDLLDDFKKFLPDASAPQSTTTPAP-----------VNGGTFYPQAAP-----QQNLPPL 437

Query: 483  GSFSPPANTGISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDEIPVSDV 542
            GSFSPP++      +    P +   PSM       D++  P+  + TQG+SND+IP+S+V
Sbjct: 438  GSFSPPSSGSAREGEHVGLPAVQP-PSM-------DISGQPQQHIITQGMSNDDIPISEV 489

Query: 543  RMAQYPNGAVPDYGQYPTHPQMKPDLATQRHIXXXXXXXXXXXXXXXXXXXXXXXXXXXX 602
            R     +GA             + DL     +                            
Sbjct: 490  RNTA--DGA------------YRSDLRNSGEVQ--------------------------- 508

Query: 603  YVEAPVRPEIDLDXXXXXXXXXXXXXXXXNFTLIEETSFFDKAKKFINNKQIYTEFLKVL 662
            Y+E   RPEIDLD                  +L+EETSFFDKAKKFI NKQIYTEFLK+L
Sbjct: 509  YMEPVARPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKIL 568

Query: 663  NLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCE 722
            NL+SQDL+  D+LV KVEYY+G +KELF+WF+NFVGY+  PK IENIVHEKHRLDLDLCE
Sbjct: 569  NLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCE 628

Query: 723  ACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 782
            ACGPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK
Sbjct: 629  ACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 688

Query: 783  IEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRK 842
            IEEERHEYD+YIE+NLRTIQTLE I NKI+NM+ EEK  FKL PGLGHTS+TIYKKVIRK
Sbjct: 689  IEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRK 748

Query: 843  VYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 902
            VYDK+RGFEIIDALHE P+IA PIVLKRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLD
Sbjct: 749  VYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLD 808

Query: 903  HLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDIL 962
            HLGLTFKQADKKLLT KQL+SEIS+IKVDQ NKRIH LTPKPKSQL++  KD E+L+DIL
Sbjct: 809  HLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDIL 868

Query: 963  SLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSA 1022
            +L++ FI+ ++TYS  DKE++ DFLKSF+ LFFS P+ E+  A  +R      +   +++
Sbjct: 869  NLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEENS 928

Query: 1023 LPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQXXXXXXXXXXXXXXXRLA 1082
              + ++  +KR+  +  L + D+L R KYQK +     + ++                  
Sbjct: 929  GQENSDLSRKRTREEENL-LKDVLRRNKYQKGR-----NFAEEEPIPEESEFAEKTVEEK 982

Query: 1083 EEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLEL 1142
            EE ++IRQ+AK+PWLLG I+D+ N  G + +RK FN+FANTNIYVF RH  TLY RL E+
Sbjct: 983  EEEEIIRQEAKKPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEV 1042

Query: 1143 KEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEH 1202
            K++N  VT+EI NRK V+FA+DL L+STQL +MGLDF   D+Y ++L LSKRLIE DIEH
Sbjct: 1043 KDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEH 1102

Query: 1203 QWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAK 1262
            QWFEESLRQAY N+AFK+YT+DKVVQ+LVKH HT++TD KT E+M LFEKDR    TSAK
Sbjct: 1103 QWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAK 1162

Query: 1263 DQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSY 1322
            +QILYRLQ RSHM+  E MFRIEYN+   +  IQ++A+DDLTL+E  + E++WKYYVTSY
Sbjct: 1163 EQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSY 1222

Query: 1323 SLPHPTEGIDHESLQIPFLQKIXXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYKIKIHPG 1382
            SL HPTEGI HE LQ PFL+KI                 NG+YSPEGVS+S  K+KI+P 
Sbjct: 1223 SLSHPTEGISHEELQPPFLEKILEKEEEFQC-------ENGEYSPEGVSSSNLKVKINPE 1275

Query: 1383 NYALDIQTGSFDIFSRKSLNKYPVKVNEDHESXXXXXXXXXXXTFLESNNGW 1434
             Y+LD+Q GS+D FSRKS+NK+P+++N D              ++L    GW
Sbjct: 1276 TYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGW 1327

 Score =  175 bits (443), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 81/99 (81%), Positives = 89/99 (89%), Gaps = 2/99 (2%)

Query: 207 DASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRG 266
           D SYRPLNVKDALSYLEQVK QFN+RPD+YN FLDIMKDFKSQ IDTPGVIERVS LF+G
Sbjct: 155 DPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQG 214

Query: 267 YPSLIQGFNTFLPTGYRIDCPSNPND--PIKVTTPIGSS 303
           YP+LIQGFNTFLP GY+I+C SNPND  PIKVTTP G++
Sbjct: 215 YPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTT 253

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 38/62 (61%)

Query: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 278 LP 279
           LP
Sbjct: 404 LP 405

 Score = 36.6 bits (83), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 33/49 (67%)

Query: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQN 421
           A++Y+ ++K +F ++PD+Y +FL+I++ ++ +      V  +V+ LFQ 
Sbjct: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQG 214

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1160 bits (3002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 623/1116 (55%), Positives = 747/1116 (66%), Gaps = 110/1116 (9%)

Query: 356  DQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQV 415
            DQ     KK  DVEFS AI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPINEVYAQV
Sbjct: 340  DQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQV 399

Query: 416  TILFQNAXXXXXXXXXXXXXSSKEQQYTGQLPQQIPNQEQLEEFSGSY------------ 463
            T+LFQNA             +S  Q     L Q  P        S  Y            
Sbjct: 400  TVLFQNAPDLLDDFKKFLPDASAPQAQQQHLAQSHPQLNGALTPSSFYHSQQQQGPQPQQ 459

Query: 464  --------------ARPPNAPLDMVAQQSLPPIGSFSPPANTGISMHDQSQRPHMMALPS 509
                           +       ++ QQ+LPP+GSFS P +            H M LP 
Sbjct: 460  DQSQSQHPVQQQQQQQQQQQQQTVIHQQNLPPLGSFSTPGDH-----------HPMNLPL 508

Query: 510  MLQHEQIIDMN-NHPKPA-VSTQGISNDEIPVSDVRMAQYPNGAVPDYGQYPTHPQMKPD 567
            +    Q  +MN N   PA + TQG+SN +IP+SD+R     +    +Y Q          
Sbjct: 509  V----QAPNMNLNQGHPAHIITQGMSNQKIPISDLRTTADTSYRPAEYSQ---------- 554

Query: 568  LATQRHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVEAPVRPEIDLDXXXXXXXXXXXX 627
                                               Y+E   RPEIDLD            
Sbjct: 555  ------------------------------GQDTQYMETNARPEIDLDPSLVPVIPEPIK 584

Query: 628  XXXXNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSK 687
                   L+EE SFFDKAKK+I NKQIYTEFLK+LNL+SQDL+  + LV KV +Y+    
Sbjct: 585  PLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCP 644

Query: 688  ELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMC 747
            ELF+WF++FVGYQ  PK IENIVHEKHRLDLDLCEACGPSYKRLPK+DTFMPCSGRD+MC
Sbjct: 645  ELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMC 704

Query: 748  WEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAI 807
            WEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYD+YIE+NLRTIQTLE I
Sbjct: 705  WEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETI 764

Query: 808  VNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIV 867
             NKI+NM+ EEK  FKL PGLGHTS+TIYKKVIRKVYDK+RG+EIIDALHE+PAI  PIV
Sbjct: 765  ANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIV 824

Query: 868  LKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISS 927
            LKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQADKKLLT KQLISEISS
Sbjct: 825  LKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISS 884

Query: 928  IKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFL 987
            IKVDQNNKRIH LTPK KSQL+ D  D E+ +DIL+L+  F+ +++TYS  DKERL DF 
Sbjct: 885  IKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFF 944

Query: 988  KSFISLFFSVPLNEINNALDKRN-------NQKNSEKVTDSALPDG-TENQKKRSIHDIE 1039
            K FISLF S P+ +I  AL KR+       +  N+E  ++    DG  +  KKR+  D +
Sbjct: 945  KGFISLFCSYPVPQIEKALAKRDAASSSQSSNSNTETYSEKQQEDGDMKLPKKRNREDSD 1004

Query: 1040 LSMSDILHRTKYQK-MKLSNRGSDSQXXXXXXXXXXXXXXXRLAEEADLIRQDAKRPWLL 1098
              + D+L R K QK  + S RG  S                   EE ++IRQ+AK PWLL
Sbjct: 1005 RLLRDVLFRNKQQKGGRNSPRGDSS----------ISAEKESDMEEEEIIRQEAKNPWLL 1054

Query: 1099 GDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKS 1158
            G I+D+ +  G + +RK FNLFANTNIYVF RH  T+YERL+E+K+MN EVTKEI NRK 
Sbjct: 1055 GSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKV 1114

Query: 1159 VKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAF 1218
            V+FA+DL L+STQL +MGLDF  +D+YE+LL+LS+ LI  D+EHQWFEESLRQAY N+AF
Sbjct: 1115 VQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAF 1174

Query: 1219 KLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNT 1278
            K+YTVDKV+QALVKH H ++TD KT E+M LFEKDR S +TS KDQILYRLQ RS+MSN 
Sbjct: 1175 KIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNI 1234

Query: 1279 EYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQI 1338
            E MFRIEYN+   ++CIQ++A+DDLTL+E  + ++KW+YY+TSYSL HPTEGI H++L+ 
Sbjct: 1235 ENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRS 1294

Query: 1339 PFLQKIXXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSR 1398
            PFL+K                  + KYSPEGV+ S  K+KI P  Y+++++ GS DIFSR
Sbjct: 1295 PFLEK------IIESEEDIIEDKDEKYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSR 1348

Query: 1399 KSLNKYPVKVNEDHESXXXXXXXXXXXTFLESNNGW 1434
            K++NK+PV+V  D               FL SN+GW
Sbjct: 1349 KAVNKFPVRV--DIRKKKSSELKLELERFLNSNSGW 1382

 Score =  182 bits (462), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 82/99 (82%), Positives = 91/99 (91%)

Query: 205 EDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 264
           +D +SYRPLNVKDALSYLEQVK QFNSRPD+YN FLDIMKDFKSQ IDTPGVIERVSTLF
Sbjct: 155 QDGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 214

Query: 265 RGYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSS 303
           +GYP+LIQGFNTFLP GY I+C S+PNDPIKVTTP G++
Sbjct: 215 QGYPTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTT 253

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 38/62 (61%)

Query: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 278 LP 279
           LP
Sbjct: 417 LP 418

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 32/49 (65%)

Query: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQN 421
           A++Y+ ++K +F  +PD+Y +FL+I++ ++ +      V  +V+ LFQ 
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQG 216

 Score = 37.0 bits (84), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 213 LNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQ 272
           LN+ +  S+ ++ K+   ++  IY +FL I+  +    +D   ++E+V     G P L  
Sbjct: 590 LNLVEEASFFDKAKKYIGNK-QIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648

Query: 273 GFNTFLPTGYR 283
            F +F+  GY+
Sbjct: 649 WFKSFV--GYQ 657

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1146 bits (2965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/1128 (54%), Positives = 736/1128 (65%), Gaps = 128/1128 (11%)

Query: 358  AKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTI 417
            A    +K  +VEFS AI+YVNKIK RFADQPDIYK FLEILQTYQREQKPI+EVYAQVTI
Sbjct: 415  ALPGQQKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTI 474

Query: 418  LFQNAXXXXXXXXXXXXXSS---------------------------------------- 437
            LFQN              SS                                        
Sbjct: 475  LFQNNPDLLDDFKKFLPDSSVSQQQQEQQQEPQQQQQDQQQEHQQDQEQQHHEQKQQPLP 534

Query: 438  KEQQYTGQLPQQIPNQEQLEEFSGSYARPPNAPLDMVAQQSLPPIGSFSPPANTGISMHD 497
            ++Q     LP Q P  +Q +   G    P +  L  +   +LPP+G+FS           
Sbjct: 535  QDQNQQAMLPPQ-PYLQQNQSMQGQGFYPQSGVL--MQPTNLPPLGNFSASGQAS----- 586

Query: 498  QSQRPHMMALPSMLQHEQIIDMNNHPKPA-VSTQGISNDEIPVSDVR--------MAQYP 548
             ++  HM  LPSM QH        H  P  V TQG+SN +IPVS++R          +Y 
Sbjct: 587  PAENSHM--LPSMHQH----IAGGHVIPQHVVTQGMSNQDIPVSEMRSTMNGTYNQVEYI 640

Query: 549  NGAVPDYGQYPTHPQMKPDLATQRHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVEAPV 608
             GA       P +PQ  P    Q                               Y+EAP+
Sbjct: 641  QGA-------PGYPQ--PLEGVQ-------------------------------YMEAPM 660

Query: 609  -RPEIDLDXXXXXXXXXXXXXXXXNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQ 667
             RPEIDLD                   L +E +FF++ K+FI NKQ+Y EFLK+LNL+SQ
Sbjct: 661  ARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQ 720

Query: 668  DLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPS 727
            DL++  +LV+KVE+Y+ SSKELF+WF++FVGYQ  PK IENIVHEKHRLDLDLCEACGPS
Sbjct: 721  DLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPS 780

Query: 728  YKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 787
            YK+LPK DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEER
Sbjct: 781  YKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEER 840

Query: 788  HEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKE 847
            HEYD+YIESNLRTIQTLE I NKI+NM+ EEK NFKL PGLGHTSLTIYKKV+RKVYDK+
Sbjct: 841  HEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKVYDKD 900

Query: 848  RGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLT 907
            RGFEIIDALHEHPA+  PIVLKRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLT
Sbjct: 901  RGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLT 960

Query: 908  FKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSEN 967
            FKQADKKLLT KQL+SEISSIKVDQ NKRIH LTPKPKSQL+F+I D E+L+DIL L   
Sbjct: 961  FKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFT 1020

Query: 968  FINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSALPDGT 1027
            F+  +++YS SDK +L+ F K+FISLFFS P+ ++N A+ +R++  + E   + +    +
Sbjct: 1021 FVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSITDQENGEEDSNKSDS 1080

Query: 1028 ENQKKRSIHDIE-LSMSDILHRTKYQKMKLSNRGSDSQXXXXXXXXXXXXXXXRLAEEAD 1086
            E   KR++ D +   M DIL RTK  K   S    +S                   +E +
Sbjct: 1081 EKSNKRTLSDEDSYLMKDILRRTKNAKTSNSEENQNSSSVKSNEE-----------DETE 1129

Query: 1087 LIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMN 1146
            L+ ++A +PWLLG +ID+ N  GI++DR  FNLF NT IYVF RH  TLYERLLE+K+++
Sbjct: 1130 LLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKID 1189

Query: 1147 GEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFE 1206
             EVT EI NRK V+FA DL L+STQL +MGL F D  +Y ELLRLSKRLI  D++HQWFE
Sbjct: 1190 AEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFE 1249

Query: 1207 ESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQIL 1266
            ESLRQAY N+AFK+YT+DKVVQ+LVKH H+++TD K   VM LFE+DRL   T+AKDQIL
Sbjct: 1250 ESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQIL 1309

Query: 1267 YRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPH 1326
            YRL+ R+ M  +E MFRIEYN D  ++ IQY+A+DDLTLKE    +EKW YYVTSYSL H
Sbjct: 1310 YRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSH 1369

Query: 1327 PTEGIDHESLQIPFLQKIXXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYKIKIHPGNYAL 1386
            PTEGI  E +  PFL KI               + N K+SPEGVS S  K+ IHP  Y L
Sbjct: 1370 PTEGITQEDISQPFLGKI----IEKEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYEL 1425

Query: 1387 DIQTGSFDIFSRKSLNKYPVKVNEDHESXXXXXXXXXXXTFLESNNGW 1434
              + GS D+F+RKS+NK+P        S            FL S+ GW
Sbjct: 1426 TFECGSTDVFTRKSVNKFP--------SSQSTQPASKMDKFLNSSKGW 1465

 Score =  176 bits (445), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 90/96 (93%)

Query: 208 ASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGY 267
           +SYRPLNVKDALSYLEQVK QF+SRPD+YN FLDIMKDFKSQ IDTPGVI+RV+TLF+G+
Sbjct: 199 SSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGF 258

Query: 268 PSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSS 303
           P+LIQGFNTFLP GY+I+C +NPNDPIKVTTP G++
Sbjct: 259 PNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTT 294

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%)

Query: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277
           A+SY+ ++K +F  +PDIY QFL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 278 LP 279
           LP
Sbjct: 490 LP 491

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 43/65 (66%), Gaps = 2/65 (3%)

Query: 357 QAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVT 416
           QA+ ++ +P +V+   A++Y+ ++K +F+ +PD+Y +FL+I++ ++ +      V  +VT
Sbjct: 195 QAQYSSYRPLNVK--DALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVT 252

Query: 417 ILFQN 421
            LFQ 
Sbjct: 253 TLFQG 257

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1146 bits (2965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/983 (59%), Positives = 704/983 (71%), Gaps = 69/983 (7%)

Query: 460  SGSYARPPNAPLDMVAQQSLPPIGSFSPPANTGISMHD------QSQRPHMMALPSMLQH 513
            SG Y  P N     + QQ+LPPIGSFSPP N G ++H+        Q PH M LPS++QH
Sbjct: 525  SGYYGHPSNR---GIPQQNLPPIGSFSPPTN-GSTVHEAYQDQQHMQPPHFMPLPSIVQH 580

Query: 514  EQIIDMNNHPKPAVSTQGISNDEIPVSDVRMA---QYPNGAVPDYGQYPTHPQMKPDLAT 570
                       P +  QGI+N+  P+SD+R +   QY   ++    Q+P    + P   T
Sbjct: 581  ----------GPNMVHQGIANENPPLSDLRTSLTEQYAPSSIQHQQQHPQ--SISPIANT 628

Query: 571  QRHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVEAPVRPEIDLDXXXXXXXXXXXXXXX 630
            Q                               Y + PVRPEIDLD               
Sbjct: 629  Q-------------------------------YGDIPVRPEIDLDPSIVPVVPEPTEPIE 657

Query: 631  XNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELF 690
             N +L EE +FF+KAK++I NK +YTEFLK+LNL+SQD++ +DDLV KV++Y+GS+KELF
Sbjct: 658  NNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELF 717

Query: 691  EWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEV 750
             WF+NFVGYQ   K IENIVHEKHRLDLDLCEA GPSYKRLPKSDTFMPCSGRDDMCWEV
Sbjct: 718  TWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEV 777

Query: 751  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNK 810
            LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQ LE IVNK
Sbjct: 778  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNK 837

Query: 811  ISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKR 870
            I NM+E EK NFKL PGLGHTS+TIYKKVIRKVYDKERGFEIIDALHEHPA+ AP+VLKR
Sbjct: 838  IENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKR 897

Query: 871  LKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKV 930
            LKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQADKKLLT KQLISEISSIKV
Sbjct: 898  LKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKV 957

Query: 931  DQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSF 990
            DQ NK+IHWLTPKPKSQL+FD  D  I +DIL L++ FI H++ YS  DKERL D LK F
Sbjct: 958  DQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYF 1017

Query: 991  ISLFFSVPLNEINNALDKRNNQKNSEKVTDSALPDGTENQKKRSIHDIELSMSDILHRTK 1050
            ISLFFS+   +I  +L   ++++N  + + S       ++K+   +  E+S+ DILHR++
Sbjct: 1018 ISLFFSISFEKIEESL--YSHKQNVSESSGSDDGSSIASRKRP--YQQEMSLLDILHRSR 1073

Query: 1051 YQKMKLSNRGSDSQXXXXXXXXXXXXXXXRLAEEADLIRQDAKRPWLLGDIIDKTNTQGI 1110
            YQK+K SN     +                  EE +LI ++AK PWL G+++++ N+QGI
Sbjct: 1074 YQKLKRSN----DEDGKVPQLSEPPEEEPNTIEEEELIDEEAKNPWLTGNLVEEANSQGI 1129

Query: 1111 ITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVST 1170
            I +R  FNLFANTNIY+F RHWTT+YERLLE+K+MN  VTKEIN R +V FA+DL L+S+
Sbjct: 1130 IQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSS 1189

Query: 1171 QLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQAL 1230
            QL  MGLDFV +D+Y+++LRLS+RLI  D+EHQWFEESLRQAYNN+AFKLYT+DKV Q+L
Sbjct: 1190 QLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSL 1249

Query: 1231 VKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDD 1290
            VKH HTLMTD KT E+M LF KDR +S TSAKDQI+YRLQ RSHMSNTE MFRIE++K  
Sbjct: 1250 VKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRT 1309

Query: 1291 RNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKIXXXXXX 1350
             ++ IQYIALDDLTLKE   +E+KWKYYVTSY+LPHPTEGI HE L+IPFL+++      
Sbjct: 1310 LHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLERL-----I 1364

Query: 1351 XXXXXXXXXKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNE 1410
                     + + ++SPEG+S S  KIKI P  Y L I+ GS+D+F+RK+ NKYP   N+
Sbjct: 1365 EFGQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIAND 1424

Query: 1411 DHESXXXXXXXXXXXTFLESNNG 1433
            + +             FL+   G
Sbjct: 1425 NTQKGMVSQKKELISKFLDCAVG 1447

 Score =  246 bits (627), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 156/248 (62%), Gaps = 32/248 (12%)

Query: 207 DASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRG 266
           DA YRPLNVKDALSYLEQVK QF+SRPDIYN FLDIMKDFKSQ IDTPGVIERVSTLFRG
Sbjct: 213 DADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 272

Query: 267 YPSLIQGFNTFLPTGYRIDCPSNPND------PIKVTT------PIGSSTLHEM------ 308
           YP LIQGFNTFLP GYRI+C SNP+D      P+  TT      P G  T          
Sbjct: 273 YPILIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFP 332

Query: 309 ---TRSVQRAXXXXXXXXXXXXXXXXXXXXIPIGSISNNANLNAAVQS---VDDQAKQAN 362
                 VQ+                       +  ++ ++ L +  Q       Q  Q+ 
Sbjct: 333 ESDGNGVQQPSNVPMVPSSVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQ 392

Query: 363 --------KKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQ 414
                   KK  DVEFSQAI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPINEVYAQ
Sbjct: 393 SLVPQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQ 452

Query: 415 VTILFQNA 422
           VT LFQNA
Sbjct: 453 VTHLFQNA 460

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 411 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 470

Query: 278 LP 279
           LP
Sbjct: 471 LP 472

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1141 bits (2951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/966 (59%), Positives = 696/966 (72%), Gaps = 68/966 (7%)

Query: 474  VAQQSLPPIGSFSPPANTGISMHD------QSQRPHMMALPSMLQHEQIIDMNNHPKPAV 527
            V QQ+LPPIGSFSPP N G ++HD        Q PH++ LPSM+QH           P +
Sbjct: 554  VPQQNLPPIGSFSPPTN-GSTVHDNYQDQQHMQPPHLVPLPSMVQH----------GPNM 602

Query: 528  STQGISNDEIPVSDVRMA---QYPNGAVPDYGQYPTHPQMKPDLATQRHIXXXXXXXXXX 584
              QGI+N+ +P+SD+R +   QY         Q P  P + P    Q             
Sbjct: 603  VHQGIANENLPISDLRTSLTDQYAPSTFQQQQQNP--PSISPITDLQ------------- 647

Query: 585  XXXXXXXXXXXXXXXXXXYVEAPVRPEIDLDXXXXXXXXXXXXXXXXNFTLIEETSFFDK 644
                              Y + PVRPEIDLD                N +L EE +FF+K
Sbjct: 648  ------------------YGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEK 689

Query: 645  AKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPK 704
            AK++I NK +YTEFLK+LNL+SQD++ +DDLV KV++Y+GS+KELF WF+NFVGYQ   K
Sbjct: 690  AKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKTK 749

Query: 705  IIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASE 764
             IENIVHEKHRLDLDLCEA GPSYKRLPKSDTFMPCSGRDDMCWE+LNDEWVGHPVWASE
Sbjct: 750  CIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEILNDEWVGHPVWASE 809

Query: 765  DSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKL 824
            DSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQ LE IVNKI NM+E EK +FKL
Sbjct: 810  DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTESEKSDFKL 869

Query: 825  EPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQRE 884
             PGLGHTS+TIYKKVIRKVYDKERGFEIIDALHEHPA+ AP+VLKRLKQKDEEWRRAQRE
Sbjct: 870  PPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQRE 929

Query: 885  WNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKP 944
            WNKVWRELEQKV+FKSLDHLGLTFKQADKKLLT KQLISEI+SIKVDQ NK+IHWLTPKP
Sbjct: 930  WNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIKVDQTNKKIHWLTPKP 989

Query: 945  KSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINN 1004
            KSQL+FD  D +I +DIL L+++FI+H++ YS  DKERL D LK FISLFFS+PL +I  
Sbjct: 990  KSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSIPLEKIEK 1049

Query: 1005 ALDKRNNQKNSEKVTDSALPDGTENQKKRS-IHDIELSMSDILHRTKYQKMKLSNRGSDS 1063
            AL     Q + E V++S+  D   +   R   +  E+S+ DILHR +YQK+K SN     
Sbjct: 1050 AL-----QFHKENVSESSGSDDGGSSTSRKRPYQQEMSLLDILHRNRYQKLKRSN----D 1100

Query: 1064 QXXXXXXXXXXXXXXXRLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANT 1123
            +                  EE +LI ++A+ PWL G+++++ N+QGII +R  FNLFANT
Sbjct: 1101 EEGKIPQLSEPLDEESNTIEEEELISEEARNPWLTGNLVEEANSQGIIQNRSIFNLFANT 1160

Query: 1124 NIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKD 1183
            NIY+F RHWTT+YERLLE+K+MNG++TKE+N R +V FA+DL L+S QL  MGLDF+ +D
Sbjct: 1161 NIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGED 1220

Query: 1184 SYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKT 1243
            +Y+++LRLS+RLI  D+EHQWFEESLRQAYNN+AFKLYT+DKV Q+LVKH HTLM D KT
Sbjct: 1221 AYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKT 1280

Query: 1244 TEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDL 1303
             E+M LF KDR +  TSAKDQI+YRLQ RS+MSN E MFRIE NK   ++ +QYIALDDL
Sbjct: 1281 AEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDL 1340

Query: 1304 TLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKIXXXXXXXXXXXXXXXKSNG 1363
            TLKE   +E+KWKYYVTSY LPHPTEGI HE L+IPFL+++               + + 
Sbjct: 1341 TLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERL-----IEFGQDTDGREVDE 1395

Query: 1364 KYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESXXXXXXXXX 1423
            ++SPEG+S S  +IKI P  Y L I+ GS+D+F+RK++NKYP   N+D            
Sbjct: 1396 EFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTAL 1455

Query: 1424 XXTFLE 1429
               FLE
Sbjct: 1456 ISRFLE 1461

 Score =  243 bits (621), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 139/250 (55%), Positives = 158/250 (63%), Gaps = 32/250 (12%)

Query: 205 EDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 264
           ++D  YRPLNVKDALSYLEQVK QF+SRPDIYN FLDIMKDFKSQ IDTPGVIERVSTLF
Sbjct: 219 DEDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLF 278

Query: 265 RGYPSLIQGFNTFLPTGYRIDCPSNPND------PIKVTT------PIGSSTLHEMTRS- 311
           RGYP LIQGFNTFLP GYRI+C +NP+D      P+  TT      P G  T+     S 
Sbjct: 279 RGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSS 338

Query: 312 --------VQRAXXXXXXXXXXXXXXXXXXXXIPIGSISNNANLNAA-----------VQ 352
                   +Q                        +   +N+  L++            +Q
Sbjct: 339 LSEPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSIHPPEIPPHHQILQ 398

Query: 353 SVDDQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVY 412
                 ++  KK  DVEFSQAI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPINEVY
Sbjct: 399 GQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY 458

Query: 413 AQVTILFQNA 422
           AQVT LFQNA
Sbjct: 459 AQVTHLFQNA 468

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478

Query: 278 LP 279
           LP
Sbjct: 479 LP 480

 Score = 36.6 bits (83), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 47/79 (59%), Gaps = 2/79 (2%)

Query: 342 SNNANLNAAVQSVDDQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTY 401
           SN  + + +V + +   +  + +P +V+   A++Y+ ++K +F+ +PDIY  FL+I++ +
Sbjct: 203 SNYVDTSYSVNNENSNDEDPDYRPLNVK--DALSYLEQVKFQFSSRPDIYNLFLDIMKDF 260

Query: 402 QREQKPINEVYAQVTILFQ 420
           + +      V  +V+ LF+
Sbjct: 261 KSQAIDTPGVIERVSTLFR 279

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1139 bits (2945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/957 (60%), Positives = 694/957 (72%), Gaps = 85/957 (8%)

Query: 474  VAQQSLPPIGSFSPPANTGISMHD------QSQRPHMMALPSMLQHEQIIDMNNHPKPAV 527
            + QQ+LPPIGSFSPP N G ++H+        Q PH+M LPSM+QH             +
Sbjct: 567  IPQQNLPPIGSFSPPTN-GSTVHENYQDQQHMQPPHLMPLPSMVQH----------GANI 615

Query: 528  STQGISNDEIPVSDVRMA---QYPNGAVPDYGQYPTHPQMKPDLATQRHIXXXXXXXXXX 584
              QGI+N+ +P+SD+R +   QY    +    Q   HPQ    +A  +            
Sbjct: 616  VHQGIANENLPLSDLRTSLTEQYAPSNIQQQQQ--QHPQSISPIANSQ------------ 661

Query: 585  XXXXXXXXXXXXXXXXXXYVEAPVRPEIDLDXXXXXXXXXXXXXXXXNFTLIEETSFFDK 644
                              Y + PVRPEIDLD                N +L EE +FF+K
Sbjct: 662  ------------------YGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEK 703

Query: 645  AKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPK 704
            AK++I NK +YTEFLK+LNL+SQD++ +DDLV KV++Y+GS+KELF WF+NFVGYQ   K
Sbjct: 704  AKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQERTK 763

Query: 705  IIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASE 764
             IENIVHEKHRLDLDLCEA GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASE
Sbjct: 764  FIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASE 823

Query: 765  DSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKL 824
            DSGFIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQ LE IVNKI NM+E EK NFKL
Sbjct: 824  DSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKVNFKL 883

Query: 825  EPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQRE 884
             PGLGHTS+TIYKKVIRKVYDKERGFEIIDALHEHPA+ AP+VLKRLKQKDEEWRRAQRE
Sbjct: 884  PPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQRE 943

Query: 885  WNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKP 944
            WNKVWRELEQKV+FKSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ NK+IHWLTPKP
Sbjct: 944  WNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKP 1003

Query: 945  KSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINN 1004
            KSQL+FD  D  I  DIL L+++FI+H++ YS  DKERL D LK FISLFFS+ L EI  
Sbjct: 1004 KSQLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKYFISLFFSISLEEIEE 1063

Query: 1005 ALDKRNNQKNSEKVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQ 1064
            +L      K S   +  +   G+   +KRS    E+++ DILHR++YQK+K S +  D +
Sbjct: 1064 SLQAY---KQSVSESSGSDDGGSSVSRKRSYQQ-EMTLLDILHRSRYQKLKRS-KDEDGK 1118

Query: 1065 XXXXXXXXXXXXXXXRLAEEAD----------LIRQDAKRPWLLGDIIDKTNTQGIITDR 1114
                           +L+E  D          LI ++AK PWL G+++++ N+QG+I +R
Sbjct: 1119 -------------VPQLSEAPDEESNIIEEEELINEEAKNPWLTGNLVEEANSQGMIQNR 1165

Query: 1115 KKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKN 1174
              FNLFANTNIY+F RHWTT+YERLLE+K+MN +VTKEIN R +V FA+DL L+S QL  
Sbjct: 1166 GIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSE 1225

Query: 1175 MGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHG 1234
            MGLDF+ +D+Y+++L+LS+RLI  D+EHQWFEESLRQAYNNRAFKLYT+DKV Q+LVKH 
Sbjct: 1226 MGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHA 1285

Query: 1235 HTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNIC 1294
            HTLMTD KT E+M LF KDR  + TSAK QI+YRLQ RSHMSNTE MFRIE++K   ++ 
Sbjct: 1286 HTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVS 1345

Query: 1295 IQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKIXXXXXXXXXX 1354
            IQYIALDDLTLKE   +E+KWKYYVTSY+LPHPTEG+ HE L+IPFL+++          
Sbjct: 1346 IQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPFLERLIEFGQDIDGK 1405

Query: 1355 XXXXXKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNED 1411
                   + K+SPEG+S S  KIKI P  Y LDI+ GS+D+F+RKS NKYP   N+D
Sbjct: 1406 DV-----DEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKYPTVANDD 1457

 Score =  179 bits (455), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 90/96 (93%)

Query: 210 YRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPS 269
           YRPLNVKDALSYLEQVK QF+SRPDIYN FLDIMKDFKSQ IDTPGVIERVSTLFRGYP 
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 270 LIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTL 305
           LIQGFNTFLP GYRI+C +NP+DPI+VTTP+G++T+
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTV 324

 Score =  110 bits (276), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 56/60 (93%)

Query: 363 KKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNA 422
           KK  DVEFSQAI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPINEVYAQVT LFQNA
Sbjct: 414 KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNA 473

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 424 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 483

Query: 278 LP 279
           LP
Sbjct: 484 LP 485

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 32/48 (66%)

Query: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQ 420
           A++Y+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 284

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1130 bits (2922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/944 (60%), Positives = 689/944 (72%), Gaps = 60/944 (6%)

Query: 474  VAQQSLPPIGSFSPPANT-----GISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVS 528
            + QQ+LPPIGSFSPP N      G       Q PH+M LPSM+Q            P + 
Sbjct: 560  IPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQQ----------GPNMV 609

Query: 529  TQGISNDEIPVSDVRMAQYPNGAVPDYGQYPTH-PQMKPDLATQRHIXXXXXXXXXXXXX 587
             QGI N+ IP+SD+R +     A  ++ Q     P + P + +Q                
Sbjct: 610  HQGIVNENIPLSDLRTSLTDQYAPSNFQQQQQQQPSISPIIDSQ---------------- 653

Query: 588  XXXXXXXXXXXXXXXYVEAPVRPEIDLDXXXXXXXXXXXXXXXXNFTLIEETSFFDKAKK 647
                           Y + PVRPEIDLD                N +L EE +FF+KAK+
Sbjct: 654  ---------------YGDVPVRPEIDLDPSIVPVVPEPTEPIEDNISLNEEVTFFEKAKR 698

Query: 648  FINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIE 707
            +I NK +YTEFLK+LNL+SQD++ +DDLV KV++Y+GS+KELF WF+NFVGYQ   K IE
Sbjct: 699  YIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFSWFKNFVGYQEKIKSIE 758

Query: 708  NIVHEKHRLDLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSG 767
            N+VHEKHRLDLDLCEA GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSG
Sbjct: 759  NVVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSG 818

Query: 768  FIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPG 827
            FIAHRKNQYEETLFKIEEERHEYD+YIESNLRTIQ LE IVNKI NM+E EK NFKL PG
Sbjct: 819  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPG 878

Query: 828  LGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNK 887
            LGHTS+TIYKKVIRKVYDKERGFEIIDALHEHPA+ AP+VLKRLKQKDEEWRRAQREWNK
Sbjct: 879  LGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNK 938

Query: 888  VWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQ 947
            VWRELEQKVYFKSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ NK+IHWLTPKPKSQ
Sbjct: 939  VWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQ 998

Query: 948  LNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALD 1007
            L+FD  D +I +DIL L+++FI H++ YS  DKERL D L  FISLFFS+PL +I  AL 
Sbjct: 999  LDFDFPDKDIFYDILYLADSFIAHTTAYSNPDKERLKDLLNYFISLFFSIPLEKIEEAL- 1057

Query: 1008 KRNNQKNSEKVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQXXX 1067
               + K +   +  +    +   +KR     E+S+ DILHR+KYQK+K SN     +   
Sbjct: 1058 --QSYKQNLSDSSGSDDGDSSTPRKRPYQQ-EMSLLDILHRSKYQKLKRSN----DEDGK 1110

Query: 1068 XXXXXXXXXXXXRLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYV 1127
                           EE +LI ++AK PWL G+++++ N+QGII +R  FNLFAN+NIY+
Sbjct: 1111 VPQLSEPLDEESNAIEEEELINEEAKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYI 1170

Query: 1128 FLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEE 1187
            F RHWTT+YERLLE+K+MN +VTKEI+ R  V FA+DL L+S+QL  MGLDF  +D+Y++
Sbjct: 1171 FFRHWTTIYERLLEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQ 1230

Query: 1188 LLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVM 1247
            +L+LS+RLI  ++EHQWFEE LRQAYNN+AFKLYT+DKV+Q LVKH HTLMTD KT E+M
Sbjct: 1231 VLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIM 1290

Query: 1248 KLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKE 1307
             LF KDR +S TSAKDQI+YRLQARS+MSNTE MFR+E+++ + ++ +QYIALDDLTLKE
Sbjct: 1291 ALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKE 1350

Query: 1308 GNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKIXXXXXXXXXXXXXXXKSNGKYSP 1367
               +E+KWKYYVTSY+LPHPTEGI HE L+IPFL+++               + + K+SP
Sbjct: 1351 PRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLERL-----IEYGQDTDGREVDEKFSP 1405

Query: 1368 EGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNED 1411
            EG+S S  KIKI P  Y L I++GS+D+F+RK+ NKYP   N+D
Sbjct: 1406 EGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYPTVANDD 1449

 Score =  266 bits (681), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 144/247 (58%), Positives = 165/247 (66%), Gaps = 29/247 (11%)

Query: 205 EDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 264
           ++D  YRPLNVKDALSYLEQVK QFNSRPDIYN FLDIMKDFKSQ IDTPGVIERVSTLF
Sbjct: 62  DEDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLF 121

Query: 265 RGYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRAXXXXXXXXX 324
           RGYP LIQGFNTFLP GYRI+C +NP+DPI+VTTP+G++T++       R+         
Sbjct: 122 RGYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSS 181

Query: 325 XXXXXXXX----------------------XXXIPIGSISNNANLNA-------AVQSVD 355
                                             P+  ++N + L +         QS  
Sbjct: 182 LPEADGSTIPQSHNVPMVPSNVYHSEQSQDQQQQPLPLLANPSGLPSIHQPELPIPQSQP 241

Query: 356 DQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQV 415
             A++  KK  DVEFSQAI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPINEVYAQV
Sbjct: 242 LTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQV 301

Query: 416 TILFQNA 422
           T LFQNA
Sbjct: 302 THLFQNA 308

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277
           A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318

Query: 278 LP 279
           LP
Sbjct: 319 LP 320

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1097 bits (2837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/884 (61%), Positives = 655/884 (74%), Gaps = 16/884 (1%)

Query: 605  EAPVRPEIDLDXXXXXXXXXXXXXXXXNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNL 664
            EAP RPEIDLD                N TL+EETSFF+K KKFI++K IY EFLKVLNL
Sbjct: 713  EAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLNL 772

Query: 665  FSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEAC 724
            +SQDL+S ++LV +V+YYIGS+KELF+WF+ FVGY   P  IENI+HEKH+LDLDLCEA 
Sbjct: 773  YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAY 832

Query: 725  GPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 784
            GPSYK+LPK+DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 833  GPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 892

Query: 785  EERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVY 844
            EERHEYD++IESNLRTIQTLE I NKI+NM+ EEKKNFKL  GLGHTS TIYKKVIRKVY
Sbjct: 893  EERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVY 952

Query: 845  DKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHL 904
            DKERGFEIIDALHEHPA A PI+L+RLK+KDEEWRRAQREWNKVWRELEQKVY+KSLDHL
Sbjct: 953  DKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 1012

Query: 905  GLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSL 964
            GLTFKQADKKLLT KQLISEISSI+VDQNNKRIHWLTPKPKSQL+F   D +IL DIL L
Sbjct: 1013 GLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDL 1072

Query: 965  SENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSALP 1024
            +  FI+H+STYS S+KERL DFL+ FI LFFS+P +EI+  L  +N++K  +  + S+  
Sbjct: 1073 ANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGSSSSSST 1132

Query: 1025 DGTENQKKRSIHDIELSMSDILHRTKYQKMK------LSNRGSDSQXXXXXXXXXXXXXX 1078
              +    K+   ++++ ++D+L + KYQK+K      L N  ++                
Sbjct: 1133 SNSTPSAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNEYDERDEEFDEELKRQQ 1192

Query: 1079 XRLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYER 1138
                EE  +I ++ K+PWLLG +IDKT+  G+I +R  FNLFANTNIYVF RHWTT+YER
Sbjct: 1193 QEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYER 1252

Query: 1139 LLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIEN 1198
            LLELK++N +VT+EIN+RK   FA+DLGL+STQL  MGLDF   DSY+ELL L+KRLI+N
Sbjct: 1253 LLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKN 1312

Query: 1199 DIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSA 1258
            DIEHQWFEESLRQAYNN+AFKLYT DKV+QALVKH ++++TD K +E+M LFEKDRL S+
Sbjct: 1313 DIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSS 1372

Query: 1259 TSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYY 1318
            T+ +DQI+YRLQ R+HM+NTE MFRIE+N++  ++CIQYIA++DLTLK   T +E W+YY
Sbjct: 1373 TTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYY 1432

Query: 1319 VTSYSLPHPTEGIDHESLQIPFLQKIXXXXXXXXXXXXXXXKSN---GKYSPEGVSNSMY 1375
            VTSY+LPHPTEG+  E L++PFL+K                + N    K SPEG+S S  
Sbjct: 1433 VTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKISPEGISTSKL 1492

Query: 1376 KIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESXXXXXXXXXXXTFLESNNGWX 1435
            KIKI    Y LD++ GSFD+FSRKSLNK+P    +   S            FL S  GW 
Sbjct: 1493 KIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAKKIESSIKEKSEAFNK--FLSSKRGWN 1550

Query: 1436 XXXXXXXXXXXNESEPESAETRTIPAVPASTTDKPPSMEQSTGI 1479
                        E   +  ET     +P     KP + E +TG+
Sbjct: 1551 NQFKPDQVAGIEEGWKKFQETGEFIPIP-----KPITTESTTGV 1589

 Score =  179 bits (453), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 90/100 (90%)

Query: 205 EDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 264
           E+D  YRPLNVKDALSYLEQVK QFNS+P IYNQFLDIMKDFKSQTIDTPGVIERVSTLF
Sbjct: 265 EEDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 324

Query: 265 RGYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSST 304
           +GYP LIQGFNTFLP GY I C  NP+DP++VTTP+G+ST
Sbjct: 325 KGYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTST 364

 Score =  103 bits (258), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/134 (48%), Positives = 78/134 (58%), Gaps = 15/134 (11%)

Query: 367 DVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAXXXX 426
           +VEFSQAINYVNKIK R+ADQP IYK+FLEILQTYQRE+KPI+EVY QVT+LF +A    
Sbjct: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523

Query: 427 XXXXXXXXXSSKEQQYTGQLPQQIPNQEQLEEFSGS----------YARPPNAPLD---- 472
                    +    Q   Q P   P  +QL+    S          Y    N P+     
Sbjct: 524 EDFKKFLPETPANNQPVQQ-PHAHPQLQQLQPRIPSISQQQQPSQLYPFSNNGPVPSGFY 582

Query: 473 MVAQQSLPPIGSFS 486
            + QQ+LPPIGSFS
Sbjct: 583 QIPQQNLPPIGSFS 596

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 46/78 (58%), Gaps = 6/78 (7%)

Query: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277
           A++Y+ ++K ++  +P IY  FL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 278 LPTGYRIDCPSNPNDPIK 295
           LP     + P+N N P++
Sbjct: 530 LP-----ETPAN-NQPVQ 541

 Score = 33.9 bits (76), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 30/48 (62%)

Query: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQ 420
           A++Y+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1087 bits (2812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/836 (63%), Positives = 641/836 (76%), Gaps = 11/836 (1%)

Query: 603  YVEAPVRPEIDLDXXXXXXXXXXXXXXXXNFTLIEETSFFDKAKKFINNKQIYTEFLKVL 662
            Y E  VRPEIDLD                   L+EET+FFDK KK+I NK IY EFLKVL
Sbjct: 825  YEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVL 884

Query: 663  NLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCE 722
            NL+S DL+ VD+LV K++YY+  ++ELF WF+NFVGY   PK IENIVHEKH+LDLDLCE
Sbjct: 885  NLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCE 944

Query: 723  ACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFK 782
            ACGPSYK+LPK+DT MPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   +
Sbjct: 945  ACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLR 1004

Query: 783  IEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRK 842
            ++++ HEYD+YIESNLRTIQTLE I +KI+NM+E EK NFKL  GLGHT+ TIYKKVIRK
Sbjct: 1005 LKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRK 1064

Query: 843  VYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLD 902
            VYDKERGFEIIDALHE+PAIA P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV+FKSLD
Sbjct: 1065 VYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 1124

Query: 903  HLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDIL 962
            HLGLTFKQADKKLLT KQLISEISSIKVDQ +KR+HWLTPKPKSQL+F++ D +I+FDIL
Sbjct: 1125 HLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDIL 1184

Query: 963  SLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRN-NQKNSEKVTDS 1021
            S  E F+ H+STYS  +KERL DF+K F SLFFS+PL EI  A+ KR+  +KN EK+ D 
Sbjct: 1185 SFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDK 1244

Query: 1022 ALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQXXXXXXXXXXXXXXXRL 1081
               +G EN KKR+  DI LS+ DIL RTKYQ++K    G DS                +L
Sbjct: 1245 Q-KNGEENSKKRTSRDITLSLEDILQRTKYQRLKY---GDDSD---EVDGHGNRHDDQKL 1297

Query: 1082 AEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLE 1141
             EE +L+RQ+AK+PWLLG ++++ N QG I  R  FN+F+NTN+Y+F+RH TT+YERL E
Sbjct: 1298 LEEEELLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYERLHE 1357

Query: 1142 LKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIE 1201
            +K+MN +V++EI+ RK  KFA+DL L+STQL  MGLDF + D Y++LL L KRLI  D+E
Sbjct: 1358 IKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILGDLE 1417

Query: 1202 HQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSA 1261
            HQWFEESLRQA+NN+AFKLYT+DKV QALVKH HT+++D KTTE+M LFEKDR  ++TS+
Sbjct: 1418 HQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNSTSS 1477

Query: 1262 KDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTS 1321
            KDQILYRLQ R+ M++ E MFRIEYN   ++ICIQYIALDDLT+K+  T EEKWKYY+TS
Sbjct: 1478 KDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYYITS 1537

Query: 1322 YSLPHPTEGIDHESLQIPFLQKI---XXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYKIK 1378
            Y+L HPTEGI  E++QIPFL++I                  KS  KYSPEG+S S  KIK
Sbjct: 1538 YALSHPTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTLKIK 1597

Query: 1379 IHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESXXXXXXXXXXXTFLESNNGW 1434
            I P NY L+I+ GSFDIFSRKSLN++PVK+ +D +             FL S  GW
Sbjct: 1598 IDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGW 1653

 Score =  174 bits (440), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 88/101 (87%)

Query: 205 EDDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 264
           ++D  YRPLNVKDALSYLEQVK QFNSRPD+YN FLDIMKDFKSQ IDTPGVI RVS+LF
Sbjct: 294 KEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLF 353

Query: 265 RGYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTL 305
             YPSLIQGFNTFLP GYRI+C SNPN PI V TP+G++T+
Sbjct: 354 HDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTV 394

 Score =  112 bits (281), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 89/141 (63%), Gaps = 8/141 (5%)

Query: 363 KKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNA 422
           ++  DVEFSQAI+YVNKIKNRFA+QP IYK+FLEILQTYQREQKPINEVY+QVT+LFQ A
Sbjct: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEA 597

Query: 423 XXXXXXXXXXXXXSSKEQQYTGQLPQQIPNQEQLEEFSGSY--ARPPNAPLDMVAQQSLP 480
                        SS      G +   + +QE+   ++  +   +P   P   +  Q+LP
Sbjct: 598 PDLLEDFKKFLPDSSANNN--GSI---VTSQEENFMYANGFNQQQPHLTPHSEIQAQNLP 652

Query: 481 PIGSFSPPANTGISMHDQSQR 501
           P+GSFS   N G+    +SQ+
Sbjct: 653 PLGSFSTQPN-GVFPKQESQQ 672

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%)

Query: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277
           A+SY+ ++K +F ++P IY  FL+I++ ++ +      V  +V+ LF+  P L++ F  F
Sbjct: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607

Query: 278 LP 279
           LP
Sbjct: 608 LP 609

 Score = 38.1 bits (87), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 356 DQAKQANK-KPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQ 414
           D  K+ N+ +P +V+   A++Y+ ++K +F  +PD+Y +FL+I++ ++ +      V A+
Sbjct: 291 DSPKEDNQYRPLNVK--DALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIAR 348

Query: 415 VTILFQN 421
           V+ LF +
Sbjct: 349 VSSLFHD 355

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1044 bits (2700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/958 (55%), Positives = 673/958 (70%), Gaps = 69/958 (7%)

Query: 477  QSLPPIGSFSPPANTGISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDE 536
            Q+LPP+GSFSPP N G     Q   P +         +Q+    +H  P V    I    
Sbjct: 468  QNLPPLGSFSPPIN-GRENDPQLNLPAVQPPAMEFASQQVPHHPSHVVPQV----IPGGT 522

Query: 537  IPVSDVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHIXXXXXXXXXXXXXXXXXXXXXX 596
            +P+SD+R      GA+   G +   P    D+                            
Sbjct: 523  LPLSDLR------GAMD--GNFAPQPLQSQDV---------------------------- 546

Query: 597  XXXXXXYVEAPVRPEIDLDXXXXXXXXXXXXXXXXNFTLIEETSFFDKAKKFINNKQIYT 656
                  ++E   RPEIDLD                + TLIEETSFFD+AKK++ NKQ+YT
Sbjct: 547  -----QFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYT 601

Query: 657  EFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRL 716
            EFLK+LNLFSQDLI  ++LV+KVE+Y+G S ELF+WF++FV Y   PK IEN++HEKHRL
Sbjct: 602  EFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRL 661

Query: 717  DLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 776
            DLDLCEAC PSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQY
Sbjct: 662  DLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 721

Query: 777  EETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIY 836
            EETLFKIEEERHEYDYYIE+NLRTIQ LE I NKISNM+ EEK+ FKL PGLGHTS+TIY
Sbjct: 722  EETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIY 781

Query: 837  KKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKV 896
            KKVIRKVYDK+RGFEIIDALHE+PA++ PI+LKRLKQKDEEWRRAQREWNKVWRELEQKV
Sbjct: 782  KKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKV 841

Query: 897  YFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFE 956
            ++KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ NKRI+  TPKPKSQL++D+KD  
Sbjct: 842  FYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKG 901

Query: 957  ILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSE 1016
            +LFDIL L  NFI+HSSTYS  DKE+L  F K F+S+FFS+   EI N+        +S+
Sbjct: 902  VLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENS-----TPADSD 956

Query: 1017 KVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQXXXXXXXXXXXX 1076
             V++S       N +KR + + E  + ++L R+K++  K   R + ++            
Sbjct: 957  AVSNS-------NPRKR-LWESEQPLKELL-RSKHKHHK--KRDTSAEDDSISDDQNSPE 1005

Query: 1077 XXXRLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLY 1136
               +  E+ ++IRQ+AK+PWLLG+I+D+ N  G +++RK FNLFANTN+YVF RH TT+Y
Sbjct: 1006 KSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMY 1065

Query: 1137 ERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLI 1196
            +RL E+K MN EVT+EIN+R  V+FA+DL LVSTQL +MGLDF  KD+Y++LL L KRLI
Sbjct: 1066 QRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLI 1125

Query: 1197 ENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLS 1256
             ND++HQWFEESLRQAY N+AFK+YTVDKV+Q+LVKH H+++TD K+ E+M LFEKDR  
Sbjct: 1126 RNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRC 1185

Query: 1257 SATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWK 1316
            +ATS K+QILYRLQ RS+M  TE MFR+E NKD  ++CIQY+A+DDLTLKE  + +++W 
Sbjct: 1186 TATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWH 1245

Query: 1317 YYVTSYSLPHPTEGIDHESLQIPFLQKIXXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYK 1376
            YY+TSY+L HPTEGI HE +++PFL+K                + + + SP G S S  +
Sbjct: 1246 YYLTSYALSHPTEGIPHEEIKVPFLEKT-------LQDDEEADEGSEERSPSGHSLSNLR 1298

Query: 1377 IKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESXXXXXXXXXXXTFLESNNGW 1434
            I+++P +Y L I+ GS DIF+R ++N++      +  +           + L+ + GW
Sbjct: 1299 IQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGW 1356

 Score =  160 bits (404), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 75/99 (75%), Positives = 84/99 (84%), Gaps = 2/99 (2%)

Query: 207 DASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRG 266
           D SYRPLN KDALSYLEQVK QFN+RPD+YN FLDIMKD+KSQ IDT GVIER+STLF+G
Sbjct: 139 DPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 198

Query: 267 YPSLIQGFNTFLPTGYRIDCPSNPNDP--IKVTTPIGSS 303
           YP LIQG NTFLP GY+I+C  NPNDP  IKVTTP  ++
Sbjct: 199 YPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNA 237

 Score =  105 bits (263), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/62 (80%), Positives = 55/62 (88%)

Query: 361 ANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQ 420
            N+   DVEFS AI+YVNKIK RFADQP+IYK+FLEILQTYQREQKPI+EVYAQVT LFQ
Sbjct: 327 GNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQ 386

Query: 421 NA 422
           NA
Sbjct: 387 NA 388

 Score = 50.1 bits (118), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%)

Query: 218 ALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTF 277
           A+SY+ ++K +F  +P+IY  FL+I++ ++ +      V  +V++LF+  P L+  F  F
Sbjct: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKF 398

Query: 278 LP 279
           LP
Sbjct: 399 LP 400

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 35/54 (64%)

Query: 368 VEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQN 421
           + F  A++Y+ ++K +F ++PD+Y +FL+I++ Y+ +      V  +++ LF+ 
Sbjct: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 198

 Score = 33.1 bits (74), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 213 LNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQ 272
           L + +  S+ ++ K+   ++  +Y +FL I+  F    I T  ++++V     G P L  
Sbjct: 578 LTLIEETSFFDRAKKYMGNK-QVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFD 636

Query: 273 GFNTFL 278
            F +F+
Sbjct: 637 WFKSFV 642

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/934 (56%), Positives = 653/934 (69%), Gaps = 70/934 (7%)

Query: 477  QSLPPIGSFSPPANTGISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDE 536
            Q+LPP+G+FSPP N G     Q   P +         +Q    + H    V  QG++N+ 
Sbjct: 578  QNLPPLGNFSPPIN-GRDNEAQVNLPAVQPPALDFPPQQQSQSHRH----VVAQGMTNNS 632

Query: 537  IPVSDVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHIXXXXXXXXXXXXXXXXXXXXXX 596
            +PVSD+R         P  G +   P    D+                            
Sbjct: 633  LPVSDMRG--------PVDGGFAPQPLYSQDV---------------------------- 656

Query: 597  XXXXXXYVEAPVRPEIDLDXXXXXXXXXXXXXXXXNFTLIEETSFFDKAKKFINNKQIYT 656
                  Y+E   RPEIDLD                + TLIEETSFFDKAKK++ NKQ+YT
Sbjct: 657  -----QYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDKAKKYMGNKQVYT 711

Query: 657  EFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRL 716
            EFLK+LNLFSQDLI  D+LV+KVE+Y+G + ELF+WF++FV Y   PK IEN+VHEKHRL
Sbjct: 712  EFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPKHIENVVHEKHRL 771

Query: 717  DLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 776
            DLDLCEAC PSYK+LPK+DTFMPC GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQY
Sbjct: 772  DLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 831

Query: 777  EETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIY 836
            EETLFKIEEERHEYDYYIE+NLRTIQ LE I NKISNM+ EEKK FKL PGLGHTS TIY
Sbjct: 832  EETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKLPPGLGHTSTTIY 891

Query: 837  KKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKV 896
            KKVIRKVYDK+RGFEIIDALHE+PA++ PIVL+RLKQKDEEWRRAQREWNKVWRELEQKV
Sbjct: 892  KKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQREWNKVWRELEQKV 951

Query: 897  YFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFE 956
            ++KSLDHLGLTFKQADKKLLT KQLISEISSIK+DQ NKRI+  T KPKSQL+FDI D  
Sbjct: 952  FYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKPKSQLDFDISDKG 1011

Query: 957  ILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSE 1016
            +LFDIL+L + FI+HS+TYS  DKE+L+ F + F+S+FFS+PL +++N  ++        
Sbjct: 1012 VLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDNPSEEH------- 1064

Query: 1017 KVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQXXXXXXXXXXXX 1076
            KV +       ++ +KRS  D +    D+L     Q  K +++  D              
Sbjct: 1065 KVENG------DSTRKRSRDDDQF-FRDLLKSKHKQAKKKTSQQEDESTSDDQDTAAKTS 1117

Query: 1077 XXXRLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLY 1136
                  EEA  +R DAK+PWLLG+I+D+ N  G +++RK +N+FANTNIYVF RH TT+Y
Sbjct: 1118 PDLEY-EEA--VRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMY 1174

Query: 1137 ERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLI 1196
            +RL E K +N EVTKEIN+RK V+FA+DL L STQL +MGLDF   D+YE+LL L KRLI
Sbjct: 1175 QRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLI 1234

Query: 1197 ENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLS 1256
            ++DIEHQWFEESLRQAY N+AFK+YTVDKV+Q+LVKH H+++TD KT E+M LFEKDR +
Sbjct: 1235 QSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKA 1294

Query: 1257 SATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWK 1316
              TS ++QILYRLQ RS M  TE MFRIE N    ++ IQ++A+DDLTL + N+ +++W+
Sbjct: 1295 PTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQ 1354

Query: 1317 YYVTSYSLPHPTEGIDHESLQIPFLQKIXXXXXXXXXXXXXXXKSNGKYSPEGVSNSMYK 1376
            YY+TSYSL HPTEG+ HE ++ PFL+K                     YSP G S S  +
Sbjct: 1355 YYLTSYSLSHPTEGVPHEEIKAPFLEKTLRDDGDSDEDSEW-------YSPGGQSVSQLR 1407

Query: 1377 IKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNE 1410
            I+I+P +YAL I+  S D+F+R ++NK+P K+ E
Sbjct: 1408 IQINPESYALQIEPNSKDLFTRSTVNKHPTKIGE 1441

 Score =  242 bits (618), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 135/251 (53%), Positives = 153/251 (60%), Gaps = 37/251 (14%)

Query: 207 DASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRG 266
           DASYRPLN KDALSYLEQVK QFN+RPD+YN FLDIMKD+KSQ IDT GVIER+STLF+G
Sbjct: 246 DASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 305

Query: 267 YPSLIQGFNTFLPTGYRIDCPSNPNDP--IKVTTPIGSSTLHEMTRSVQRAXXXXXXXXX 324
           YP LIQG NTFLP GY+I+C SNP+DP  IKVTTP    T  E++               
Sbjct: 306 YPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPF--DTTRELSLDHNTGGSAVGGHLA 363

Query: 325 XXXXXXXXXXXIPIGSISNN--------ANLNAAVQSVDDQAKQA--------------- 361
                      IP    + +         +L A+     DQ   A               
Sbjct: 364 GPATVSTSPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVHHAESDTQREIQKSAQLQ 423

Query: 362 ----------NKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEV 411
                     N+   DVEFS AI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPI+EV
Sbjct: 424 QSQQDQQYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEV 483

Query: 412 YAQVTILFQNA 422
           Y QVT LFQNA
Sbjct: 484 YTQVTSLFQNA 494

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 208 ASYRP---LNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLF 264
           A+ RP   +    A+SY+ ++K +F  +PDIY  FL+I++ ++ +      V  +V++LF
Sbjct: 432 ATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLF 491

Query: 265 RGYPSLIQGFNTFLP 279
           +  P L+  F  FLP
Sbjct: 492 QNAPDLLDDFKKFLP 506

 Score = 39.3 bits (90), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 41/66 (62%), Gaps = 2/66 (3%)

Query: 356 DQAKQANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQV 415
           +  + A+ +P  + F  A++Y+ ++K +F ++PD+Y +FL+I++ Y+ +      V  ++
Sbjct: 242 EHVQDASYRP--LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERI 299

Query: 416 TILFQN 421
           + LF+ 
Sbjct: 300 STLFKG 305

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
           {ON} weakly similar to uniprot|P22579 Saccharomyces
           cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  241 bits (616), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 140/368 (38%), Positives = 204/368 (55%), Gaps = 27/368 (7%)

Query: 641 FFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQ 700
           F    +  + ++ IY EFLK++NLF+Q LI ++    +   + GS   L   F N +   
Sbjct: 206 FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265

Query: 701 GNPKIIENIVHEKHRLDL---------DLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVL 751
            +       +H++ +  L         D     GPSYKRL   +T   C GRD +C EVL
Sbjct: 266 KD-------IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVL 318

Query: 752 NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKI 811
           NDEWVGHPVWASE+ GFIAH+KNQYEETLFK+EEERHEYD+++ S    I         +
Sbjct: 319 NDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSL 378

Query: 812 SNMSEEEKKNFKL----EPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAIAAPIV 867
               ++ ++  ++    EP +   S+T  +KVIR++Y  E G  +IDA+  +P    P +
Sbjct: 379 QLSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGNILIDAIKTNPEKVVPTI 436

Query: 868 LKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTIKQLISEISS 927
           LK  K+K ++W  A+ EWNK WRE+EQK Y+KSLDHLGL FK A+K+ L  KQL+ E  S
Sbjct: 437 LKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKS 496

Query: 928 IKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTSDKERLNDFL 987
            K D+  K  H+       +  ++  D  +L+D+  +    +  +S+ S S K       
Sbjct: 497 EKQDKLLKE-HY----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIF 551

Query: 988 KSFISLFF 995
           ++F  L F
Sbjct: 552 EAFFDLLF 559

 Score =  114 bits (284), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 138/295 (46%), Gaps = 12/295 (4%)

Query: 1111 ITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKEINN--RKSVKFAEDLGLV 1168
             ++R+  N+F + NI     +  TLYER  ++K     + K++    R+    A+ L L+
Sbjct: 617  FSNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLL 676

Query: 1169 STQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQ 1228
              QL + GL+    D YE +   SK+ +  +++HQWFEESLR  + N+A+KLYT+D+V++
Sbjct: 677  PMQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIR 736

Query: 1229 ALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNK 1288
             ++    T+       +++ L   +     T+   Q+ YR + R  M     MFR+E  +
Sbjct: 737  NILGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVR 796

Query: 1289 DDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKIXXXX 1348
            D   I  QYI +DDL   + +  + +   Y   Y     T+ +D + L  P+        
Sbjct: 797  DSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYS------ 850

Query: 1349 XXXXXXXXXXXKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNK 1403
                       + N  +    +      + I+P +Y +DI  GS DI S   + K
Sbjct: 851  ----LNLLKREEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITK 901

>Kpol_2000.45 s2000 (87497..88717) [1221 bp, 406 aa] {ON}
           (87497..88717) [1221 nt, 407 aa]
          Length = 406

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 1/73 (1%)

Query: 465 RPPNAPLDMV-AQQSLPPIGSFSPPANTGISMHDQSQRPHMMALPSMLQHEQIIDMNNHP 523
           R PN  LD V   +S+PPI  F PP    +  H  S    ++ +PS+ Q   ++  +   
Sbjct: 60  RRPNVSLDDVKIIKSIPPIKDFKPPKYPVVLCHGLSGFDRLILVPSVYQLFHLVANSMTM 119

Query: 524 KPAVSTQGISNDE 536
                  G  +DE
Sbjct: 120 STVYDVMGYEDDE 132

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 652 KQIYTEFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQG---NPKIIEN 708
           K +Y ++LKVLN   QD  +V D V   +     S ++ E+  N + YQ      K I+N
Sbjct: 84  KNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTERKKYIDN 143

Query: 709 IVHEK 713
            +H K
Sbjct: 144 FIHSK 148

>Skud_4.541 Chr4 complement(960364..961350) [987 bp, 328 aa] {ON}
           YPL060C-A (REPEAT)
          Length = 328

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 47/93 (50%), Gaps = 17/93 (18%)

Query: 860 PAIAAPIVLKRLKQKDEEWRRAQR---EWNKVWRELEQ-----------KVYFKSLDHLG 905
            AI + + LK    KDE+ RR QR   E+  +   L+Q           +V+ + L  L 
Sbjct: 30  AAINSQLSLKDCSIKDEQMRRYQRSLGEFKHILIGLKQEEETLSETDDIQVFAEKLLRLA 89

Query: 906 LTFKQADKKLLTIKQLISEISSIKVDQNNKRIH 938
            T ++ + +   I++L+ +I SI +++N  R+H
Sbjct: 90  STIEKVESR---IQELVGKIQSIVIEENADRLH 119

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 147,890,252
Number of extensions: 6652508
Number of successful extensions: 23633
Number of sequences better than 10.0: 126
Number of HSP's gapped: 24447
Number of HSP's successfully gapped: 210
Length of query: 1479
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1356
Effective length of database: 39,377,481
Effective search space: 53395864236
Effective search space used: 53395864236
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)