Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A051106.30ON1221226375e-87
ZYRO0C07502g6.30ON1221225976e-81
NCAS0D021206.30ON1221225976e-81
TDEL0G043906.30ON1221225978e-81
NDAI0C026706.30ON1221225961e-80
YOL005C (RPB11)6.30ON1201205899e-80
Smik_15.1656.30ON1201205891e-79
Suva_15.1696.30ON1221225863e-79
Skud_15.1576.30ON1221225863e-79
KNAG0F029106.30ON1221205846e-79
CAGL0E02453g6.30ON1201205846e-79
Kpol_1037.216.30ON1201205821e-78
SAKL0E01562g6.30ON1221225482e-73
TBLA0E031506.30ON1181185482e-73
ACL005C6.30ON1221225456e-73
KLTH0C10934g6.30ON1221225379e-72
TPHA0J004106.30ON1201205371e-71
Kwal_56.224726.30ON1221225361e-71
KLLA0C06160g6.30ON1211225152e-68
TPHA0B029202.163ON1301061384e-11
Kpol_165.22.163ON128921262e-09
CAGL0L03872g2.163ON137921237e-09
Ecym_54232.163ON127901166e-08
TBLA0B012902.163ON102861131e-07
KAFR0B045702.163ON131901141e-07
Suva_14.2252.163ON1421041114e-07
KNAG0I020602.163ON134901105e-07
SAKL0E10692g2.163ON131901106e-07
NCAS0G025502.163ON150901107e-07
ZYRO0B09878g2.163ON130621088e-07
TDEL0F011802.163ON129901071e-06
NDAI0F027502.163ON149901062e-06
YNL113W (RPC19)2.163ON1421021054e-06
Smik_14.2142.163ON1421021035e-06
AFL220C2.163ON135901028e-06
KLTH0D09350g2.163ON146811002e-05
KLLA0F23760g2.163ON12790982e-05
Skud_14.2182.163ON156104993e-05
Kwal_26.84732.163ON15081975e-05
TBLA0J007305.604ON72692710.29
KNAG0B026007.353ON27999632.7
NCAS0B005308.730ON37573633.3
TPHA0B015207.441ON115070633.4
CAGL0L07810g1.423ON59640624.3
NCAS0C058604.15ON1868113624.6
KAFR0A043008.758ON1452108608.3
YHL030W (ECM29)4.15ON186863608.8
Kwal_23.58927.257ON67859609.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A05110
         (122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   249   5e-87
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   234   6e-81
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   234   6e-81
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   234   8e-81
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   234   1e-80
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   231   9e-80
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   231   1e-79
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   230   3e-79
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   230   3e-79
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   229   6e-79
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   229   6e-79
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   228   1e-78
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   215   2e-73
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   215   2e-73
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   214   6e-73
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   211   9e-72
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   211   1e-71
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   211   1e-71
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   202   2e-68
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    58   4e-11
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    53   2e-09
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    52   7e-09
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    49   6e-08
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    48   1e-07
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    49   1e-07
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    47   4e-07
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    47   5e-07
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    47   6e-07
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    47   7e-07
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    46   8e-07
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    46   1e-06
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    45   2e-06
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    45   4e-06
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    44   5e-06
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    44   8e-06
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    43   2e-05
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    42   2e-05
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    43   3e-05
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    42   5e-05
TBLA0J00730 Chr10 (169980..172160) [2181 bp, 726 aa] {ON} Anc_5....    32   0.29 
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...    29   2.7  
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730       29   3.3  
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    29   3.4  
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    28   4.3  
NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]...    28   4.6  
KAFR0A04300 Chr1 (853102..857460) [4359 bp, 1452 aa] {ON} Anc_8....    28   8.3  
YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffo...    28   8.8  
Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL06...    28   9.9  

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  249 bits (637), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  234 bits (597), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 108/122 (88%), Positives = 119/122 (97%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKL++DPDTK+PNA+V+TFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFK+R+QT+EGYDPK+ALKNACN IINKLG+LKTNFETEWNLQTLASD+NF
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  234 bits (597), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 120/122 (98%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKL+IDPDTK+PNAVVITFEKEDHTLGNLIR+ELLND++VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFARFKLR+QT+EGYDPK+ALKNACNSII+KLG+LK NFETEWNLQTLA+DEN 
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  234 bits (597), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 119/122 (97%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKI+PDTK+PNAVVITFEKEDHTLGNLIR+ELLNDTKVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFK+R+QT+EGYDPK+ALKNACN IINKL +LKTNFETEWNLQTLASD+N+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  234 bits (596), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 112/122 (91%), Positives = 118/122 (96%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKL IDPDTK+PNAVVITF+KEDHTLGNLIR+ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFA FKLR+QT+EGYDPK ALKNACN+IINKLGILKTNFETEWNLQTLASDENF
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  231 bits (589), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 111/120 (92%), Positives = 116/120 (96%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKIDPDTK+PNAVVITFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFARFKLR+QT EGYDPK+ALKNACNSIINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  231 bits (589), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 111/120 (92%), Positives = 116/120 (96%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKIDPDTK+PNAVVITFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFARFKLR+QT EGYDPK+ALKNACNSIINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDDAF 120

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  230 bits (586), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 117/122 (95%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKI+PDTK+PNAVVITFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFARFKLR+QT EGYDPK+ALKNACNSIINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 GI 122
            +
Sbjct: 121 NM 122

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  230 bits (586), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 117/122 (95%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKI+PDTK+PNAVVITFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFARFKLR+QT EGYDPK+ALKNACNSIINKLG LKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 GI 122
            +
Sbjct: 121 NM 122

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  229 bits (584), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (96%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLLG+GESKL IDPDTKSPNA+VITF KEDHTLGNLIRAELLND+KVLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFARFKLR+QT+EGYDPK+ALKNACN IINKLGILKTNFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  229 bits (584), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 117/120 (97%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLLGEGESKLKIDPDTK+PNAVVITFEKEDHTLGNLIRAELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHPFFARFKLR+QT+EGYDPK+AL+NAC+SIINKLG LK+NFETEWNLQTLA+D+ F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADDAF 120

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  228 bits (582), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 117/120 (97%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPD+FELFLLGEGESKL I+PDTK+PNAVVITFEKEDHTLGNLIR+ELLND+KVLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFKLR+QT+E YDPK+ALKNACN+IINKLGILKTNFETEWNLQTLASDENF
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  215 bits (548), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLL EGESKL I+PDTK+PNAV+ITFEKEDHTLGNLIRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFK+R+QT+EGYDPK+ALKNACN+II KL  L++NFETEW+LQTLAS+EN+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

Query: 121 GI 122
           G+
Sbjct: 121 GL 122

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  215 bits (548), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 100/118 (84%), Positives = 112/118 (94%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFE FLLGEGESKL+I+PDTK+PN VVITFEKEDHTLGNLI++ELL+D KVLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDE 118
           YKVEHP FARFK+R+QT+EGYDPK+AL+ ACNSII KLGILKTNFETEWNLQTLASD+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  214 bits (545), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 100/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLL EGESKLKI+PDTK+ NAV+ITFEKEDHTLGN+IRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARF++R+QT EGYDPKEALKNACNSIINKL  LK+NFETEWNLQTLAS++ F
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120

Query: 121 GI 122
            +
Sbjct: 121 RL 122

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  211 bits (537), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 97/122 (79%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLL EGE+KLKIDPDTK+PNAV++TFEKEDHTL NLIR ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA+FKLR+QT+EGYDPK+ALKNACN II+KLG L++NFETEWNLQTLAS++N+
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 GI 122
            +
Sbjct: 121 AM 122

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  211 bits (537), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLL EG+SKL+I+ DTK+ NAVVITFEKEDHTLGNLIR ELLND KVLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FARFKLR+QT E YDPK+ALK ACN+IINKLGILKTNF+TEWNLQTLASD+NF
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  211 bits (536), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 97/122 (79%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLL EGE+KLKIDPDTK+PNAV++TFEKEDHTL NLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA+FK+R+QT EGYDPK+ALKNACN II+KLG L++NFETEWNLQTLAS++N+
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 GI 122
            +
Sbjct: 121 AM 122

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  202 bits (515), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 112/122 (91%), Gaps = 1/122 (0%)

Query: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60
           MNAPDRFELFLL EGESKLK++ DTK+ +A+++TFEKEDHTLGNLIRAELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           YKVEHP FA+FK+R+QT+EGYDPK+ALKNACNSIINKL  L++NFETEWNLQTLA+ E++
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLAT-EDY 119

Query: 121 GI 122
           G+
Sbjct: 120 GM 121

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 57.8 bits (138), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 2   NAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFA 59
           + P+  E+ +    E K+KI P+  SP+    +F+  +EDHTLGN +R  ++ + +V F 
Sbjct: 18  SVPEVDEVDVNAVDEDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFC 77

Query: 60  AYKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNF 105
            Y + HP      LR+QT       EAL+     +++   +++  F
Sbjct: 78  GYSIPHPSETLLNLRIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 53.1 bits (126), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 2/92 (2%)

Query: 16  ESKLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKL 73
           E K+KI P   S +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      L
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RVQTIEGYDPKEALKNACNSIINKLGILKTNF 105
           R+QT       EAL+     +++   +++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 52.0 bits (123), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 2/92 (2%)

Query: 16  ESKLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKL 73
           ++K+K+ P   S +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      L
Sbjct: 40  KTKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNL 99

Query: 74  RVQTIEGYDPKEALKNACNSIINKLGILKTNF 105
           R+QT       +AL+   + +I+    +K  F
Sbjct: 100 RIQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 49.3 bits (116), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRV 75
           K+++ P+  S +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      LR+
Sbjct: 31  KIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVLNLRI 90

Query: 76  QTIEGYDPKEALKNACNSIINKLGILKTNF 105
           QT       EAL      +++   +++  F
Sbjct: 91  QTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 48.1 bits (113), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%)

Query: 20  KIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRVQTIE 79
           ++ P T   +A       EDHTLGN +R  L+ +  V F  Y + HP      LRVQT  
Sbjct: 10  QLPPVTPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYG 69

Query: 80  GYDPKEALKNACNSIINKLGILKTNF 105
                +AL      +++   +++  F
Sbjct: 70  DITASDALAQGLQDLMDLCDVVEDTF 95

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 48.5 bits (114), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRV 75
           K+KI P   S +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +R+
Sbjct: 35  KIKILPQATSEDGTSASFQIVEEDHTLGNALRYIIMKNPQVEFCGYSIPHPSENLLNIRI 94

Query: 76  QTIEGYDPKEALKNACNSIINKLGILKTNF 105
           QT       +ALK     +++   +++  F
Sbjct: 95  QTYGEITAVDALKKGLADLMDLCDVVEETF 124

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 47.4 bits (111), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAAY 61
           + PDR ++ LL +  S+     D  S +  ++   +EDHTLGN +R  ++ + +V F  Y
Sbjct: 40  DEPDREKIKLLTQATSE-----DGTSASFQIV---EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNF 105
            + HP      +R+QT       EAL+     +++   ++++ F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 47.0 bits (110), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRV 75
           K+KI P+  + +    +F+   EDHTLGN +R  ++ + +V F  Y + HP      +R+
Sbjct: 38  KVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWLNVRI 97

Query: 76  QTIEGYDPKEALKNACNSIINKLGILKTNF 105
           QT       +A K     +++   +++  F
Sbjct: 98  QTYGKITAVDAFKKGLGDLMDMCDVVEDVF 127

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 47.0 bits (110), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRV 75
           K+K+ P   S +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +R+
Sbjct: 35  KIKLLPQATSDDGTSASFQISEEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNVRI 94

Query: 76  QTIEGYDPKEALKNACNSIINKLGILKTNF 105
           QT       EAL+     +++    ++  F
Sbjct: 95  QTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 47.0 bits (110), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRV 75
           K+KI P+  S +    +F+   EDHTLGN +R  ++ +  V F  Y + HP      +R+
Sbjct: 54  KVKILPEGASEDGTCASFQIVDEDHTLGNALRYIIMKNPNVEFCGYSIPHPSENFLNVRI 113

Query: 76  QTIEGYDPKEALKNACNSIINKLGILKTNF 105
           QT       EA +     +++   +++  F
Sbjct: 114 QTYGDITAVEAFQKGLQDLMDLCDVVEDKF 143

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa]
          {ON} highly similar to uniprot|Q755Q7 Ashbya gossypii
          AFL220C AFL220Cp and similar to YNL113W uniprot|P28000
          Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
          subunit common to RNA polymerases I and III
          Length = 130

 Score = 46.2 bits (108), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 18 KLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRV 75
          K+KI P   S +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      +RV
Sbjct: 34 KIKILPQATSEDGTCASFQIAEEDHTLGNALRYMIMKNPDVEFCGYSIPHPSENLLNIRV 93

Query: 76 QT 77
          QT
Sbjct: 94 QT 95

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRV 75
           K+K+ P   S +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      LR+
Sbjct: 33  KIKLLPQASSEDGTCASFQIAEEDHTLGNALRYVIMKNKDVEFCGYSIPHPSENLLNLRI 92

Query: 76  QTIEGYDPKEALKNACNSIINKLGILKTNF 105
           QT       + L+     +++    ++  F
Sbjct: 93  QTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRV 75
           K+KI     S +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +R+
Sbjct: 53  KIKILQQGASEDGCSASFQILQEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRI 112

Query: 76  QTIEGYDPKEALKNACNSIINKLGILKTNF 105
           QT       EAL      +++   +++  F
Sbjct: 113 QTYGEITAVEALHKGLQDLMDLCDVVEEKF 142

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 45.1 bits (105), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAAYKV 63
           PDR ++ LL +  S+     D  S +  ++   +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATSE-----DGTSASFQIV---EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNF 105
            HP      +R+QT       +AL+     +++   ++++ F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 44.3 bits (103), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAAYKV 63
           PDR ++ LL +  S+     D  S +  ++   +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATSE-----DGTSASFQIV---EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNF 105
            HP      +R+QT       +AL+     +++   ++++ F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 43.9 bits (102), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRV 75
           K+++ P   S +     F+   EDHTLGN +R  ++ + +V F  Y + HP      +R+
Sbjct: 39  KIRLLPQATSEDGTCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFLNIRI 98

Query: 76  QTIEGYDPKEALKNACNSIINKLGILKTNF 105
           QT       +AL      +++   +++  F
Sbjct: 99  QTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query: 27  SPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRVQTIEGYDPK 84
           S +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      LR+QT   +   
Sbjct: 59  SEDGTCASFQISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQTYGKFTAV 118

Query: 85  EALKNACNSIINKLGILKTNF 105
           E L+     +++    ++  F
Sbjct: 119 EVLQKGLQDLMDLCDAVEDKF 139

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 2/90 (2%)

Query: 18  KLKIDPDTKSPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRV 75
           K+K+  +  S +    +F    EDHTLGN +R  ++ + +V F  Y + HP      +R+
Sbjct: 31  KIKLLTEATSEDGTSASFRITDEDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRI 90

Query: 76  QTIEGYDPKEALKNACNSIINKLGILKTNF 105
           QT       EAL      +++    ++  F
Sbjct: 91  QTYGKITAVEALHKGLGDLMDMCDAVEDRF 120

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 42.7 bits (99), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAAY 61
           + PDR ++ LL +  S+          NA     E EDHTLGN +R  ++ +  V F  Y
Sbjct: 54  DEPDREKIKLLTQATSE-------DGTNASFQIVE-EDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNF 105
            + HP      +R+QT       +AL+     +++   +++  F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 42.0 bits (97), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query: 27  SPNAVVITFE--KEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRVQTIEGYDPK 84
           S +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      LR+QT   +   
Sbjct: 63  SEDGTCASFQISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQTYGKHTAL 122

Query: 85  EALKNACNSIINKLGILKTNF 105
           E L+     +++    ++  F
Sbjct: 123 EVLQKGLQDLMDLCDAVEDKF 143

>TBLA0J00730 Chr10 (169980..172160) [2181 bp, 726 aa] {ON} Anc_5.604
           YOR022C
          Length = 726

 Score = 32.0 bits (71), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 43/92 (46%), Gaps = 15/92 (16%)

Query: 40  HTLGNLIRAELLNDTKVLFAAYKVEHPFF-----ARFKLRVQT-IEGYDPKEALKNACNS 93
           H+LGNLI  +LLN+TK     +KV + F        FKL  +T I+G      + N    
Sbjct: 499 HSLGNLILFDLLNNTKKYSLNFKVGNYFCLGSPAGVFKLIQRTNIDG------INNKAGK 552

Query: 94  IINKLGILKTNFETE---WNLQTLASDENFGI 122
            + K   LK  ++ E   W  QTL   E + I
Sbjct: 553 ELGKRKKLKQKYQLEIDNWQTQTLPCKELYNI 584

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 7/99 (7%)

Query: 22  DPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRVQTIEGY 81
           DPD K  N +  T      T G L+ +  LN++ V  AA ++       +  R      +
Sbjct: 51  DPDHKIMNPLFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQ----HWDYRENFPNEF 106

Query: 82  DPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           DP    +    SI+ +L I++ N     N   ++ DENF
Sbjct: 107 DPASDTREDTKSIVLRLPIVELN---GMNTLLISVDENF 142

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score = 28.9 bits (63), Expect = 3.3,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 19/73 (26%)

Query: 22  DPDTKSPNAVVITFEKEDHTLG------NLIRAELLNDTKVLFAAYKVEHPFFARFKLRV 75
           +PD ++ + ++   E +   +G      NL R E+LN T+ L+  ++ E PF        
Sbjct: 258 NPDLEAGDLLIEFNENDKSNMGYRRRGQNLYRTEVLNVTEALYGGWQREIPFL------- 310

Query: 76  QTIEGYDPKEALK 88
                 DPK+ L+
Sbjct: 311 ------DPKKKLQ 317

>TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {ON}
           Anc_7.441 YBL105C
          Length = 1150

 Score = 28.9 bits (63), Expect = 3.4,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 9   LFLLGEGE-SKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAAYKVEHPF 67
           L +LG+G   K+ +     +     I   K+DH + N   A    + KV   A K +HPF
Sbjct: 826 LKVLGKGNFGKVLLSKSKNTGRVCAIKVLKKDHIIQNHDIASARAEKKVFLLATKTKHPF 885

Query: 68  FARFKLRVQT 77
                   QT
Sbjct: 886 LTNLYCSFQT 895

>CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa]
           {ON} similar to uniprot|P25333 Saccharomyces cerevisiae
           YCR008w SAT4 serine/threonine-specific protein kinase
          Length = 596

 Score = 28.5 bits (62), Expect = 4.3,   Method: Composition-based stats.
 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 57  LFAAYKVEHPFFARFKLRVQTIEGYDPKEALKNA-CNSII 95
           L+ A K + PF+ ++    +   GY+P E+LK A C ++I
Sbjct: 503 LWTAAKKDDPFYNKYLQGRRQKSGYEPIESLKRARCRNVI 542

>NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]
           {ON} Anc_4.15 YHL030W
          Length = 1868

 Score = 28.5 bits (62), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 53/113 (46%), Gaps = 6/113 (5%)

Query: 11  LLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAE--LLNDTKVLFAAYKVEHPFF 68
           L  EG  KL++   T + N  ++    +  TLG+++  E  L+ D   +   +       
Sbjct: 391 LHAEGWPKLQLGESTPAFNTTILQRRLQYETLGDILMKEFSLVEDLSFIEFLFDSLQGDL 450

Query: 69  ARFKLRVQ-TIEGYDPKEALKNACNSIINKL-GILKTNFETEWNLQTLASDEN 119
           + F+  +Q  +    P   L+   +S  +KL GILK     ++NLQ  +SD+N
Sbjct: 451 SEFRASIQEALISLTPH--LRKLPSSSKDKLKGILKNLLSDDFNLQEASSDQN 501

>KAFR0A04300 Chr1 (853102..857460) [4359 bp, 1452 aa] {ON} Anc_8.758
           YOR291W
          Length = 1452

 Score = 27.7 bits (60), Expect = 8.3,   Method: Composition-based stats.
 Identities = 30/108 (27%), Positives = 55/108 (50%), Gaps = 14/108 (12%)

Query: 21  IDPDTKSPNAV---VITFEKEDHTLG---NLIRAELLNDTKVLFAAYKVEHPF--FARFK 72
           IDPD    +AV   + +  +ED  L    N I  ++ + +++LF   ++ HPF  F  F 
Sbjct: 438 IDPDWLDLSAVYRGLPSAIQEDRILAFDKNQINLKVKSTSQILFD--EILHPFYIFQIFS 495

Query: 73  LRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120
           + + +++ Y        AC  +I+ L IL++ FET+   + L+   +F
Sbjct: 496 IILWSLDEY----YYYAACIFVISMLSILQSLFETKKASKNLSEISHF 539

>YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffold
           protein that assists in association of the proteasome
           core particle with the regulatory particle; degraded by
           the mature proteasome after assembly; contains HEAT-like
           repeats
          Length = 1868

 Score = 27.7 bits (60), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 5/63 (7%)

Query: 11  LLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRA--ELLND---TKVLFAAYKVEH 65
           L  EG  KL++ P T + N  ++  + +  TLG++++   EL++D    + LF + K + 
Sbjct: 397 LHAEGWPKLQLGPQTPAFNTAILQRQLQYETLGDILKRDFELVSDLSYIEFLFESLKNDL 456

Query: 66  PFF 68
           P F
Sbjct: 457 PQF 459

>Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL067C
           - Hypothetical ORF [contig 11] FULL
          Length = 678

 Score = 27.7 bits (60), Expect = 9.9,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 41  TLGNLIRAELLNDTKVLFAAYKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLG 99
           T G+L+R E  N  K    AY  EHP    +++   T + ++  +A     N I   +G
Sbjct: 547 TRGSLLRGEAGNSWKPPVLAYNQEHPHLLNWQVTNSTEKSFEKLDAYSLLINDIERYVG 605

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,638,734
Number of extensions: 522952
Number of successful extensions: 1454
Number of sequences better than 10.0: 54
Number of HSP's gapped: 1452
Number of HSP's successfully gapped: 54
Length of query: 122
Length of database: 53,481,399
Length adjustment: 91
Effective length of query: 31
Effective length of database: 43,046,793
Effective search space: 1334450583
Effective search space used: 1334450583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)