Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A050806.23ON31131116540.0
KNAG0M011906.23ON38030214330.0
KNAG0K01400singletonON30930212511e-174
NDAI0C026206.23ON31130212321e-171
NCAS0D021706.23ON31030412221e-170
SAKL0E01342g6.23ON34129611791e-163
CAGL0F01815gsingletonON31430411581e-160
NDAI0D008306.23ON37430410941e-149
TDEL0G044606.23ON36930410931e-149
TPHA0M002806.23ON30329110841e-149
KNAG0D02240singletonON35929810901e-149
NCAS0H008406.23ON36029210861e-148
ZYRO0C07722g6.23ON37330110841e-148
CAGL0I08151gsingletonON38229810691e-145
Kpol_1061.27singletonON30629610531e-144
Kpol_385.5singletonON30629610471e-143
KLTH0C11154g6.23ON30529810471e-143
KLLA0D01243g6.23ON31130010341e-141
Kwal_56.224396.23ON32030110071e-137
KAFR0G026806.23ON3832949911e-133
Suva_13.408.824ON113366685.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A05080
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   641   0.0  
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   556   0.0  
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   486   e-174
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      479   e-171
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   475   e-170
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   458   e-163
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   450   e-160
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   426   e-149
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              425   e-149
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   422   e-149
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   424   e-149
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   422   e-148
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   422   e-148
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   416   e-145
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   410   e-144
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   407   e-143
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   407   e-143
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   402   e-141
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   392   e-137
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     386   e-133
Suva_13.40 Chr13 complement(58628..62029) [3402 bp, 1133 aa] {ON...    31   5.1  

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/311 (100%), Positives = 311/311 (100%)

Query: 1   MATTENATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFP 60
           MATTENATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFP
Sbjct: 1   MATTENATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFP 60

Query: 61  DHPHHGQETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGV 120
           DHPHHGQETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGV
Sbjct: 61  DHPHHGQETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGV 120

Query: 121 GLQLWVDLPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVD 180
           GLQLWVDLPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVD
Sbjct: 121 GLQLWVDLPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVD 180

Query: 181 FYHFISNKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSD 240
           FYHFISNKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSD
Sbjct: 181 FYHFISNKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSD 240

Query: 241 DDTEFAIIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGIL 300
           DDTEFAIIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGIL
Sbjct: 241 DDTEFAIIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGIL 300

Query: 301 EKDVPKFEGSA 311
           EKDVPKFEGSA
Sbjct: 301 EKDVPKFEGSA 311

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/302 (85%), Positives = 283/302 (93%)

Query: 10  FRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQET 69
           FRTI KHF+A EQEEGVGARVRRSVGSMRQRNF+PFLLLDHFTVSHPAGFPDHPHHGQET
Sbjct: 75  FRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQET 134

Query: 70  ITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 129
           ITYVR GMIAHEDF GSKG+LRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP
Sbjct: 135 ITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 194

Query: 130 QEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKK 189
           ++MKDC PRYRNLRG EIPI EPNEHLK+KVISG+S+G++SVKELAYTPVDFYH+IS+KK
Sbjct: 195 KDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKK 254

Query: 190 GTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIG 249
           GT FVQ+ P NFN FLYVMKG+VKI  + FPQYST+F+NA+G+ I+G+V DDDTEFAIIG
Sbjct: 255 GTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIG 314

Query: 250 GLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKFEG 309
           GLILDQPVIQHGPF+E+TREK+IEVFQNFQYGINGFERAVGWKSSIRNGILEKDVP FE 
Sbjct: 315 GLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPAFEA 374

Query: 310 SA 311
           + 
Sbjct: 375 AG 376

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  486 bits (1251), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 222/302 (73%), Positives = 263/302 (87%)

Query: 7   ATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHG 66
           A  FR++ K F A+EQ EGVGA VRRS+G  RQRNF+PFLLLDHFTVSHP+GFPDHPHHG
Sbjct: 2   AQVFRSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHHG 61

Query: 67  QETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWV 126
           QETITY++ GMIAHEDFTGSKGILRPGDLQFMTAGKGI+HSEIPVL ++  A VGLQLWV
Sbjct: 62  QETITYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWV 121

Query: 127 DLPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFIS 186
           DLP+ MKDC PRYRNLR  EIPI +PNEHLKVKVISG+SYGVESVKELAYTPVDFYH+IS
Sbjct: 122 DLPKNMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYIS 181

Query: 187 NKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFA 246
           +K+G +FVQ+ PEN+N FLYVM+GSV +  + +PQYSTIF+NA+GN IKGV  + +TEFA
Sbjct: 182 DKEGINFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEFA 241

Query: 247 IIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPK 306
           II GLILDQ ++QHGPF+E++ EK+ EVF+N+Q+GINGFE+A+ W+SSI NGI EKD+  
Sbjct: 242 IIAGLILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKDITN 301

Query: 307 FE 308
           FE
Sbjct: 302 FE 303

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  479 bits (1232), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 218/302 (72%), Positives = 266/302 (88%), Gaps = 1/302 (0%)

Query: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70
           R++ K+F+A+EQEEGVGA VRRS+GSM+QRNF+PFLL+DHFTVSHPAGFPDHPHHGQETI
Sbjct: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHGQETI 67

Query: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130
           TYV NGMIAHEDFTGSKG+LRPGDLQFMTAGK IMHSEIPV MENG  G+G+QLWV LP 
Sbjct: 68  TYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALPI 127

Query: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190
           ++K+ EPRYRNLRG +IPI++PNE+L V+VISG+SYG ESVK+LAYTP+D+Y F  NKKG
Sbjct: 128 DLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNMNKKG 187

Query: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKG-VVSDDDTEFAIIG 249
            +F Q+TP NFNFFLY+ KG+V+I    +P+YST+FF+ DG+ IKG   +D++TEFAIIG
Sbjct: 188 VEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFAIIG 247

Query: 250 GLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKFEG 309
           GLILDQP++QHGPF+E+ RE L++VF+N+QY INGFERA GW+SSI +GILEKDVP FE 
Sbjct: 248 GLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDVPAFEK 307

Query: 310 SA 311
           S+
Sbjct: 308 SS 309

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  475 bits (1222), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 216/304 (71%), Positives = 259/304 (85%)

Query: 7   ATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHG 66
           +  FR++ K FVA+EQEEGVGA VRRS+GSM+QRNF+PFLL+D+FTVSHPAGFPDHPHHG
Sbjct: 4   SMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHG 63

Query: 67  QETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWV 126
           QETITYV  GMIAHEDFTGS+G+LRPGDLQFMTAGK IMHSEIPV M NGDAG+G+QLWV
Sbjct: 64  QETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWV 123

Query: 127 DLPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFIS 186
           DLP+++K+CEPRYRNLR  EIPIV+PN+ L V+V+SG+SYGVESVK+LAYTP+D+Y   +
Sbjct: 124 DLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNT 183

Query: 187 NKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFA 246
            K GT+FVQ+ P +FN FLY++KGSVKI D   PQYSTIFF  DG+ IKG  + +DTEF 
Sbjct: 184 KKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFV 243

Query: 247 IIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPK 306
           ++GG ILDQP+IQHGPF+ES RE L+EVF+N+QY INGFERA GW+S I +GI E DV  
Sbjct: 244 LVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEA 303

Query: 307 FEGS 310
           FE S
Sbjct: 304 FEKS 307

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  458 bits (1179), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 206/296 (69%), Positives = 256/296 (86%)

Query: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70
           RTI KHFVAVEQ EGVGARVRRS+G+ + RNFTPFL+LDHF V+ PAGFPDHPHHGQETI
Sbjct: 41  RTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETI 100

Query: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130
           TYV  GM+AHEDFTGSKG+LRPGDLQFMTAGKGI+HSEIPV ME+G+  VGLQLWVDLP+
Sbjct: 101 TYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPE 160

Query: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190
            +K+CEPRYR+LRG E PI EP+++LKV+VISG SYGV+S  ELAYTPV FYHFIS+KKG
Sbjct: 161 RLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKG 220

Query: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIGG 250
           T F Q+ PE+FN F+YV+KGS+ +  + FPQYS IFF  DG G++G+ + DDTEFA++GG
Sbjct: 221 TPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGG 280

Query: 251 LILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPK 306
            IL+QPV+QHGPF+E+++E++I+VFQ++Q+G+NGFERA  WKSSI +GI +++  K
Sbjct: 281 SILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEK 336

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  450 bits (1158), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 204/304 (67%), Positives = 254/304 (83%)

Query: 8   TTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQ 67
           TT+R+I KHF+  EQEEGVGARVRRSVG+M+QR F+PFL+LD F V HPAGFPDHPHHGQ
Sbjct: 2   TTYRSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHGQ 61

Query: 68  ETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVD 127
           ETITYV NGM+AHEDFTG+KG+L  GDLQFMTAGKGI+HSEIPV ME+G+A  GLQ WVD
Sbjct: 62  ETITYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWVD 121

Query: 128 LPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISN 187
           LP+++K CEPRYRNLRG +IP+V PNE+L VKVISG+SYGV+SV++LAYTP+  YH+++N
Sbjct: 122 LPKDLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLTN 181

Query: 188 KKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAI 247
           K GT + Q+ P+NFN F+YVMKG V +GD+ FP+++ +FFN DG+ +KG  + DD +FAI
Sbjct: 182 KAGTQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFAI 241

Query: 248 IGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKF 307
           +GG ILDQ  IQHGPF+E+ RE L++VF N+QYGINGFERA GW+SSI +GI EK V + 
Sbjct: 242 MGGQILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQVREN 301

Query: 308 EGSA 311
           E   
Sbjct: 302 EAKG 305

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  426 bits (1094), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 201/304 (66%), Positives = 251/304 (82%), Gaps = 6/304 (1%)

Query: 1   MATTENATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHP-AGF 59
           +ATT++A   RTI K+F+  EQ EGVGARVRR++G+     F PFL+LDHF V+ P  GF
Sbjct: 66  IATTDDA---RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGF 122

Query: 60  PDHPHHGQETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAG 119
           PDHPHHGQETITY+ +GMIAHEDFTGSKG+LRPGDLQFMTAGKGI+HSE+PVLM++G  G
Sbjct: 123 PDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPG 182

Query: 120 VGLQLWVDLPQEMKDCEPRYRNLRGGEIPIVEPNE--HLKVKVISGRSYGVESVKELAYT 177
           +GLQLWVDLP+E+K+CEPRYRNLR  EIPIV  ++  H+ VKVISG +YGV+SV++LAYT
Sbjct: 183 IGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYT 242

Query: 178 PVDFYHFISNKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGV 237
           P+ FYH+IS+K G +F Q  P++FN FLYVMKG+V I D+ F Q + +FFN DG+ IKG 
Sbjct: 243 PIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQ 302

Query: 238 VSDDDTEFAIIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRN 297
            + +DTEFAIIGG ILDQP++QHGPF+E+TRE L +VF+N+Q GINGFERAV W+SSI +
Sbjct: 303 SATNDTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIAD 362

Query: 298 GILE 301
           GI E
Sbjct: 363 GIDE 366

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  425 bits (1093), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 189/304 (62%), Positives = 246/304 (80%)

Query: 3   TTENATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDH 62
           T       R+I K+FVA +QEEGVGA VRRS+G+M+ R F+PFL+LDHFTVS PAGFPDH
Sbjct: 57  TMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDH 116

Query: 63  PHHGQETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGL 122
           PHHGQETITY+  GM+AHEDF+ SKGIL PGDLQFMTAGK I+HSEIPV M++G   VGL
Sbjct: 117 PHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGL 176

Query: 123 QLWVDLPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFY 182
           QLWVDLP+++K+CEPRYR+L+  +IP+++P+EHLKV VISG SYGV+S ++LAYTPV +Y
Sbjct: 177 QLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYY 236

Query: 183 HFISNKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDD 242
           HF ++KKGT+FVQ+ P  FN F+Y++KGS+ IG++ FPQ+ST+FF+ DG+ ++G  + D+
Sbjct: 237 HFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDN 296

Query: 243 TEFAIIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEK 302
            EF +IGG IL Q V+QHGPF+E+ RE+LIEVF N+Q  INGF+R   W+S+I  GI E 
Sbjct: 297 AEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITES 356

Query: 303 DVPK 306
           +  K
Sbjct: 357 EAKK 360

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  422 bits (1084), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 194/291 (66%), Positives = 239/291 (82%)

Query: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70
           R+I KHF+A EQ EGVGARVRRS+G+ + R F+PFL+LDHF V  PAGFPDHPHHGQETI
Sbjct: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65

Query: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130
           TYVR GM+AHEDFTGSKGILRPGDLQFMTAGK + HSE+PVLMENG+   GLQLWVDLP 
Sbjct: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125

Query: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190
            +K+ EPRYR+L    IPI +P+E+L+++VISG+SYG+ESVK+LAYTPVDFY + + KKG
Sbjct: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185

Query: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIGG 250
           + F Q    ++N FLY++KGSV IG+E FPQ+S+IFFN DG+ ++G+V  DDTEFAIIGG
Sbjct: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245

Query: 251 LILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILE 301
            IL Q  +QHGPF+E T EKL++VF N++    GFERA+ W+SSIRNGI E
Sbjct: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDE 296

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  424 bits (1090), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 193/298 (64%), Positives = 242/298 (81%)

Query: 10  FRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQET 69
            R+I  HF+  E  EGVGARV+RSVGSM+QR FTPFL+LD FTV  P+GFPDHPHHGQET
Sbjct: 60  LRSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDFTVKSPSGFPDHPHHGQET 119

Query: 70  ITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 129
           ITYV +G+IAHEDFTGSKG+LRPGDLQFMTAGKGI+HSE+PV ME+G    GLQLWVDLP
Sbjct: 120 ITYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVEMEDGRPARGLQLWVDLP 179

Query: 130 QEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKK 189
           +++K+CEPRYRNLR  +IP+V+P+E+L+V+VISG+SYG ESVK+LAYTP+DFY+ +++K 
Sbjct: 180 KDLKNCEPRYRNLRSEDIPVVKPHENLEVRVISGKSYGTESVKDLAYTPIDFYYMLASKA 239

Query: 190 GTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIG 249
           GT+F Q+ P +FN FLYVMKGSV I ++ F Q + IFF+ DG G+ G    DDTEFAIIG
Sbjct: 240 GTEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFDTDGEGVAGQAGSDDTEFAIIG 299

Query: 250 GLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKF 307
           G ILDQP++QHGPF+E+ +EKL E F N++    GFERA GW+S I +GI E +  + 
Sbjct: 300 GKILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERAKGWRSDIASGINESEAKQL 357

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  422 bits (1086), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 193/292 (66%), Positives = 238/292 (81%)

Query: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70
           R+I KHF+A EQ EG GA VRRSVGS +   F+PFL+LD F V+ P GFPDHPHHGQETI
Sbjct: 62  RSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETI 121

Query: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130
           TYV  G++AHEDFTGSKG+L PGDLQFMTAGKGI+H E+PV M +     GLQ WVDLP 
Sbjct: 122 TYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPA 181

Query: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190
           ++K+CEPRYRNLR   IP+V+ N++L VKVISG+SY VESVK+LAYTP+DFY+FISNK G
Sbjct: 182 DLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAG 241

Query: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIGG 250
           T+F Q+ P +FN F+YV KG++ IG+E F  +S++FF  DGN I+G  + D+TEFA+IGG
Sbjct: 242 TEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVIGG 301

Query: 251 LILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEK 302
            ILDQ V+QHGPF+E+TREKLIEVF N++ GINGFE+A+GWKSSI NGI E+
Sbjct: 302 KILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQ 353

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  422 bits (1084), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 190/301 (63%), Positives = 244/301 (81%)

Query: 7   ATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHG 66
           + + R++ K+F+A+EQEEGVGARVRRS+G+M+ R F PFL+LD F V  PAGFPDHPHHG
Sbjct: 70  SISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHG 129

Query: 67  QETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWV 126
           QETITY   GMIAHEDFTGSKG+L PGDLQFMTAGKGI+HSEIPV +E+G A  GLQLWV
Sbjct: 130 QETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWV 189

Query: 127 DLPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFIS 186
           DLP E+K+CEPRYR+LR  + P V+ N++L V+VISG+SYGV+SV+ELAYTPV FYHFI+
Sbjct: 190 DLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFIT 249

Query: 187 NKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFA 246
           +KKGT+F Q+ P++FN F Y++KGS+ + D+ FP++S +FF+ DG G+ G    DD EF 
Sbjct: 250 SKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFV 309

Query: 247 IIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPK 306
           +IGG ILDQ V+QHGPF+E++RE++I+VF+N+QYG+NGFE A  W S I  GI E +  K
Sbjct: 310 LIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARK 369

Query: 307 F 307
            
Sbjct: 370 L 370

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  416 bits (1069), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 192/298 (64%), Positives = 238/298 (79%)

Query: 10  FRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQET 69
           +R+I  HF+A EQEEGVGARVRRSVG+ + R FTPFL+LD FTV+ P GFPDHPHHGQET
Sbjct: 82  YRSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQET 141

Query: 70  ITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 129
           ITYV +GMIAHED TGSKG+L  GDLQFMTAGKGI+HSEIPV  ++G    GLQLWVDLP
Sbjct: 142 ITYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLP 201

Query: 130 QEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKK 189
            +MK+ +PRYRNLRG E P+  PNE+L+V+VISG+SYGVES+++LAYTPV  YHF++NK 
Sbjct: 202 SDMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLANKT 261

Query: 190 GTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIG 249
           GT+FVQ  PE+FN F+YVMKGS+++ D     +S+ FF+ DGN I+G    +D +FAII 
Sbjct: 262 GTEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAIIA 321

Query: 250 GLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKF 307
           G ILDQ VIQHGPF+E+ REKL+EVF+N+Q   NGFE A  W+SSI +GI E++  K 
Sbjct: 322 GRILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEALKL 379

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  410 bits (1053), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 190/296 (64%), Positives = 234/296 (79%)

Query: 10  FRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQET 69
            R+I KHF++ EQ EGVGARVRRS+G+M  R F+PFL+LDHF V+  AGFPDHPHHGQET
Sbjct: 7   LRSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQET 66

Query: 70  ITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 129
           ITYV  GMIAHEDFTG KG+L  GDLQFMTAGK I H+E+PV   +G+  VGLQLWVDLP
Sbjct: 67  ITYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVDLP 126

Query: 130 QEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKK 189
            +MK+ EPRYR+LR  +IP   P + L+++VISG SYGV+SVK+LAYTP+DFY +   K 
Sbjct: 127 TDMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYMYRGKKA 186

Query: 190 GTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIG 249
           GT+F Q+   +FN F+YV+KG+V IGD+ FPQYS+IFFN DG+ + G V+ DDTEFAIIG
Sbjct: 187 GTEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDTEFAIIG 246

Query: 250 GLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVP 305
           G ILDQ  +QHGPF+E T+EKLI+VF ++Q   NGFERA  W+SSIR+GI E D P
Sbjct: 247 GKILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDDAP 302

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  407 bits (1047), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 189/296 (63%), Positives = 233/296 (78%)

Query: 10  FRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQET 69
            R+I KHF+A EQ EGVGARVRRS+G+M  R F+PFL+LDHF V+  AGFPDHPHHGQET
Sbjct: 7   LRSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQET 66

Query: 70  ITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 129
           ITYV  GMIAHEDFTG KG+L  GDLQFMTAGK I H+E+PV   +G+  VGLQLWVDLP
Sbjct: 67  ITYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVDLP 126

Query: 130 QEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKK 189
            +MK+ EPRYR+L+  EIP   P + L+V+VISG SYGV+SVK+LAYTP+DFY +   K 
Sbjct: 127 TDMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYMYRGKKA 186

Query: 190 GTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIG 249
           GT+F Q    +FN F+YV++G++ IGD+ FPQYS+IFFN DG+ + G ++ D+TEFAIIG
Sbjct: 187 GTEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNTEFAIIG 246

Query: 250 GLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVP 305
           G ILDQ  +QHGPF+E T+EKLI+VF ++Q   NGFERA  WKSSIR+GI E D P
Sbjct: 247 GKILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKENDAP 302

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  407 bits (1047), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 193/298 (64%), Positives = 238/298 (79%)

Query: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70
           R+I K+F A+EQ EGVGA+VRRS+GS   RNFTPFL+LDHF VS PAGFPDHPHHGQETI
Sbjct: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64

Query: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130
           TYV  GMIAHEDFTGS+G+LRPGDLQFMTAGKGI+HSEIPV +E+G   VGLQLWVDLP 
Sbjct: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124

Query: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190
            +KDCEPRYR+L   EIP V+P   L+V+VISG SYGV S+ ELAYTPV FYH+I+ K G
Sbjct: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184

Query: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIGG 250
           T F Q  P NFN F+YV+KGSV +  +TF QYS++FFN DG+ ++G  S +++EF +IGG
Sbjct: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFILIGG 244

Query: 251 LILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKFE 308
            +LDQP++Q+GPF+E++++ + EV  N+Q G NGFERA GW SSI  G++  DV K E
Sbjct: 245 EVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIE 302

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 181/300 (60%), Positives = 240/300 (80%)

Query: 8   TTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQ 67
           +  R++ KHFVA+EQ EG GA V+RS+G+++ RNF PFL+LD+F VS PAGFP+HPHHGQ
Sbjct: 7   SKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQ 66

Query: 68  ETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVD 127
           ETITYV  GM+AHEDFTGSKG+LR GDLQFMTAGK I+HSEIPV M+NG++  GLQLWVD
Sbjct: 67  ETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVD 126

Query: 128 LPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISN 187
           LP ++K+ EPRYR+LR  EIP+  P+++L VKVISG SYGV+S+ ELAYTPV+FYHFI+N
Sbjct: 127 LPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIAN 186

Query: 188 KKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAI 247
           KK T+F Q   ++F+ F+Y+MKGS+ I D+ +P+ S IFF  DG+GI+G  + D+ EFAI
Sbjct: 187 KKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAI 246

Query: 248 IGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKF 307
           I G   +Q V+Q+GPF+ES+RE +++V QN+Q G+NGFE A  W   I+NG+ E +V ++
Sbjct: 247 IAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQY 306

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  392 bits (1007), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 232/301 (77%)

Query: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70
           R+I K+F A+EQ EGVGA+VRRS+G+ + RNFTPFL+LDHFT++ PAGFPDHPHHGQET+
Sbjct: 19  RSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQETV 78

Query: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130
           T++  G +AHEDFTGSKG+LR GDLQFMTAGKG +HSEIPV +E+GD   G+QLWVDLP 
Sbjct: 79  THILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDLPA 138

Query: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190
            +KDC+PRYR+L+   IP       L + VISG+SYGV+S++ELAYT V +YH++ ++  
Sbjct: 139 RLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSEAN 198

Query: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIGG 250
             F Q  P +FN FLYV+KG + I  + F ++S+IFF  DG+ + G    +D EF + GG
Sbjct: 199 ISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILAGG 258

Query: 251 LILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKFEGS 310
            ILDQP++Q+GPF+E+++E+++EVFQN+Q G NGFE+A GW SSI NGI+E D+  F  S
Sbjct: 259 QILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISDFVKS 318

Query: 311 A 311
           +
Sbjct: 319 S 319

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  386 bits (991), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 181/294 (61%), Positives = 229/294 (77%)

Query: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70
           R+I  HF+  E  EG GARV+RS+GS  QR F PFL+LD F V+ PAGFPDHPHHGQETI
Sbjct: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144

Query: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130
           TYV +GMIAHEDFTG  GIL PGDLQFMTAG+GI+HSEIPV MENG +  GLQLWVDLPQ
Sbjct: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204

Query: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190
           ++K  EPRYRNLR  +IPI  P E+LKV VISG+SY VES+ +LAYTPV  YHF++ K G
Sbjct: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264

Query: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIGG 250
           T F+Q+ P++FN FLYV+KG+V I ++ F + + IFF+ DG  I+G  + DD+EF ++GG
Sbjct: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324

Query: 251 LILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 304
            IL+QPV+Q GPF+E+ ++KL++VF +F+   NGFERA  W+S+IR GI E + 
Sbjct: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEA 378

>Suva_13.40 Chr13 complement(58628..62029) [3402 bp, 1133 aa] {ON}
           YML104C (REAL)
          Length = 1133

 Score = 30.8 bits (68), Expect = 5.1,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 30/66 (45%)

Query: 220 PQYSTIFFNADGNGIKGVVSDDDTEFAIIGGLILDQPVIQHGPFIESTREKLIEVFQNFQ 279
           P+YS +F + D N  K  + DDD +      L+ DQ  + H     ST  K  +   +  
Sbjct: 643 PRYSQLFGSEDNNIFKDKLFDDDNDNTSEFYLVEDQLDLPHSVEKSSTSSKNWDSNHSQH 702

Query: 280 YGINGF 285
           YG N F
Sbjct: 703 YGSNNF 708

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.139    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,098,294
Number of extensions: 1604463
Number of successful extensions: 2996
Number of sequences better than 10.0: 21
Number of HSP's gapped: 3060
Number of HSP's successfully gapped: 21
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)