Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A050706.22ON56453427580.0
Kpol_1037.276.22ON54653621680.0
TDEL0G044706.22ON54253421260.0
CAGL0E02629g6.22ON54853421210.0
KNAG0F028906.22ON56353121130.0
NCAS0D021606.22ON56353220900.0
Smik_15.1716.22ON54453620680.0
YOR002W (ALG6)6.22ON54453620660.0
Suva_15.1776.22ON54453620620.0
NDAI0C026306.22ON58053720600.0
TBLA0G009706.22ON55954420460.0
Skud_15.1636.22ON54453620410.0
TPHA0J003506.22ON55953520380.0
SAKL0E01364g6.22ON54153320290.0
KLLA0D01221g6.22ON56652920090.0
ZYRO0C07744g6.22ON54753419980.0
Ecym_30276.22ON54953419560.0
KLTH0C11176g6.22ON53653019520.0
Kwal_56.224376.22ON53652919290.0
ACR004W6.22ON56353219190.0
TPHA0J013805.669ON5752672908e-27
Kpol_1018.735.669ON6212722839e-26
YOR067C (ALG8)5.669ON5772722802e-25
TBLA0A093105.669ON5462702774e-25
KLTH0F17666g5.669ON5552722731e-24
ADR210C5.669ON5722742731e-24
NCAS0G004505.669ON5702562722e-24
Smik_15.2475.669ON5772722712e-24
Kwal_55.217425.669ON5552672693e-24
CAGL0L10450g5.669ON5502672694e-24
Suva_8.1185.669ON5762722678e-24
Skud_15.2345.669ON5772722668e-24
NDAI0F005105.669ON5704252642e-23
KLLA0F16621g5.669ON5612702606e-23
ZYRO0A11506g5.669ON5562692588e-23
TDEL0B025405.669ON5692742571e-22
KAFR0D024405.669ON5752932543e-22
SAKL0G00836g5.669ON5612722526e-22
KNAG0L019205.669ON5682722517e-22
Ecym_40515.669ON6042712421e-20
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A05070
         (564 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...  1066   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   839   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   823   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   821   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   818   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   809   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   801   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   800   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   798   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   798   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   792   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   790   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   789   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   786   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   778   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   774   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   758   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   756   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   747   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   743   0.0  
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   116   8e-27
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   113   9e-26
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   112   2e-25
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   111   4e-25
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   109   1e-24
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   109   1e-24
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   109   2e-24
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   108   2e-24
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   108   3e-24
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   108   4e-24
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   107   8e-24
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   107   8e-24
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   106   2e-23
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   104   6e-23
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   103   8e-23
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   103   1e-22
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   102   3e-22
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   101   6e-22
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...   101   7e-22
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...    98   1e-20

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score = 1066 bits (2758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/534 (97%), Positives = 522/534 (97%)

Query: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90
           NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD
Sbjct: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90

Query: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150
           FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR
Sbjct: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150

Query: 151 GIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLML 210
           GIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLML
Sbjct: 151 GIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLML 210

Query: 211 IDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKS 270
           IDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKS
Sbjct: 211 IDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKS 270

Query: 271 LFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVA 330
           LFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVA
Sbjct: 271 LFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVA 330

Query: 331 NFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSF 390
           NFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSF
Sbjct: 331 NFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSF 390

Query: 391 FLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAV 450
           FLFSFQVHEK            YTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAV
Sbjct: 391 FLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAV 450

Query: 451 CFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSM 510
           CFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSM
Sbjct: 451 CFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSM 510

Query: 511 AVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
           AVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL
Sbjct: 511 AVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/536 (74%), Positives = 449/536 (83%), Gaps = 2/536 (0%)

Query: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90
           N+ +EE F+ASPLYDFL PFRP  NQWL +YIIV FALI+RCAIGLGSYSGMG+ PMFGD
Sbjct: 11  NKPVEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGMGNPPMFGD 70

Query: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150
           FEAQRHWMEITQHLPISKWY+FDL+YWGLDYPPLTAYHSY+LG IGSF+   WF LNDSR
Sbjct: 71  FEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDSR 130

Query: 151 GIEMEG--IKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSL 208
           G E E   +K+YMRTTV+ISE +FY P +IYF+KW G+HR QS IGQYIAA AILFQPSL
Sbjct: 131 GYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPSL 190

Query: 209 MLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLS 268
           MLIDHGHFQYNSVMLGLTVYAINNLLD+FY+ A++CFVLSICFKQM+LYYAPIFFGYLL 
Sbjct: 191 MLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLLG 250

Query: 269 KSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDK 328
           +SLF  + FNI R + IA  T+  F +MY+PLY+FGGGL N+IQSVHRIFPFARG+FEDK
Sbjct: 251 RSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIFPFARGLFEDK 310

Query: 329 VANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSM 388
           VANFWCVTNI IKYKI +TQ +LQLYSL ATV+GFLPA+V I+ YPKKHLLPYALAACSM
Sbjct: 311 VANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLPYALAACSM 370

Query: 389 SFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQY 448
           SF+LFSFQVHEK            YTSTDWNVLS V W+NNV LFTLWPLLKKDGL LQY
Sbjct: 371 SFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPLLKKDGLTLQY 430

Query: 449 AVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYL 508
            VCF LSNWL+GNFSF+TPKFLPKMLTPGP +    + YHRRSLLPHNILWK++IVSSY+
Sbjct: 431 GVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWKIIIVSSYI 490

Query: 509 SMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
            M + H  + FV PP  YPDIW+ +NC +GFG FV FW+W YY +FTL NKTL  L
Sbjct: 491 VMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKTLQYL 546

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/534 (72%), Positives = 448/534 (83%), Gaps = 1/534 (0%)

Query: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90
              +EE FYASPLYDFLYPFRPAG+QWL +Y+IV FALII CA+G GSYSG    PMFGD
Sbjct: 10  RNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSPPMFGD 69

Query: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150
           FEAQRHWMEITQHL  S+WYWFDL+YWGLDYPPLTAYHSY+LGKIGSFI P+WF LN+SR
Sbjct: 70  FEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFELNESR 129

Query: 151 GIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLML 210
           GIE   +K++MR TVL+SE +FY PA++YF+KW GKHR +SPIGQ+I+A AILFQPSLML
Sbjct: 130 GIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPSLML 189

Query: 211 IDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKS 270
           IDHGHFQYN VMLGLTVYAIN+L ++FY+VA++CFVLSICFKQM+LYYAPIFF YLLSKS
Sbjct: 190 IDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLLSKS 249

Query: 271 LFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVA 330
           LF PR FN PRL  IA  T+++F AMY+PLYIFGGGL N+IQSVHRIFPFARGIFEDKVA
Sbjct: 250 LFSPR-FNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARGIFEDKVA 308

Query: 331 NFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSF 390
           NFWCVTN+  KYK  F Q+QLQLYSL AT+LGFLPA+++I LYPKKH++ YALA CSMSF
Sbjct: 309 NFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATCSMSF 368

Query: 391 FLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAV 450
           +LFSFQVHEK            YTS++W+VLSM  WINNV LFTL+PLLKKDGL LQY V
Sbjct: 369 YLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKKDGLTLQYFV 428

Query: 451 CFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSM 510
           CF LSNWLLGNFSFVTPKFLPK LTPGPS+S++  NY RRS LP N++WK++IVSSY +M
Sbjct: 429 CFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIVSSYTAM 488

Query: 511 AVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
            V H +DF + PP +YPD+W+ LNC +GFG F  FW+W+YYMLFT+  KTL  L
Sbjct: 489 GVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL 542

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/534 (70%), Positives = 451/534 (84%), Gaps = 1/534 (0%)

Query: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90
           +E  EE FYASPLYDFL+PFRPAG+QWL ++II+ FA+IIRCAIGLG YSG    PM GD
Sbjct: 16  SEQGEESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGD 75

Query: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150
           FEAQRHWMEITQHLPISKWY++DL+YWGLDYPPLTA+HSY+LGK+G+F  P WF L+ SR
Sbjct: 76  FEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSR 135

Query: 151 GIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLML 210
           GIE +G+K+YMR TVL+SEA+FY PA++YF+KW G+ RNQSPIGQ+IAA AILFQPSLML
Sbjct: 136 GIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSLML 195

Query: 211 IDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKS 270
           IDHGHFQYNS+MLG TVYAINNLLD+FY+ A++CFVLSICFKQMSLYYAPIFF YLL +S
Sbjct: 196 IDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLGRS 255

Query: 271 LFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVA 330
           +FFP+LFNIPR + I+  T+VTF AM+SP YIF GGL+ L Q+V RIFPFARGIFEDKVA
Sbjct: 256 MFFPKLFNIPRFISISIATLVTFTAMFSPFYIF-GGLDGLAQTVRRIFPFARGIFEDKVA 314

Query: 331 NFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSF 390
           NFWCV N ++K+K+ FT DQL++YSL  TV+GF PA+++I+LYP+KHLLPYALAACSMSF
Sbjct: 315 NFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSMSF 374

Query: 391 FLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAV 450
           +LFSFQVHEK            +TS DWNVLSMV WINNVALFTLWPLLK++GL LQY V
Sbjct: 375 YLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQYFV 434

Query: 451 CFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSM 510
           CF LSNWL+GNFSF+TP+FLPK +TPGPSIS++ +NY RRSLLPH+I WK++IVSSY+ M
Sbjct: 435 CFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYIGM 494

Query: 511 AVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
             +H+LD F+E P  +PD+W+ LNC IGF SF  FW+WTYY   TL  K + DL
Sbjct: 495 TAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/531 (71%), Positives = 444/531 (83%), Gaps = 1/531 (0%)

Query: 34  IEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGDFEA 93
           +EE FYASP+YDFLYPFR  G+QW+ +YIIV F LII+ AIGLGSYSG    PMFGDFEA
Sbjct: 34  VEECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEA 93

Query: 94  QRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSRGIE 153
           QRHWMEITQHLP+S+WYWFDLQYWGLDYPP TAYHSY+LGKIG+FIYP WF L+ SRG+E
Sbjct: 94  QRHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGME 153

Query: 154 MEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLMLIDH 213
            +GIKSYMR TVL+SE +FY PAI+YF+KW G+ + QSPIGQ++AA AILFQP+LMLIDH
Sbjct: 154 TDGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDH 213

Query: 214 GHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKSLFF 273
           GHFQYN VMLGLTVYAINNLLD FY++A+VCFVLSICFKQM+LYYAPIFF  LLSKSLFF
Sbjct: 214 GHFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSLFF 273

Query: 274 PRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVANFW 333
           PRLFNIPR + +A  T+ +   M++PLYIF GG+ N++QS+HRIFPFARGIFEDKVANFW
Sbjct: 274 PRLFNIPRFLSVAFATLASLFVMFAPLYIF-GGVGNVLQSIHRIFPFARGIFEDKVANFW 332

Query: 334 CVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSFFLF 393
           CVTN+  KYK  FTQ +LQ YSL ATV+GF PA +I++ YPKK L+PY LAACSM+FFLF
Sbjct: 333 CVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFFLF 392

Query: 394 SFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAVCFA 453
           SFQVHEK            +TST+WN LSMV W+NNVALFTLWPLLKKDGL LQY VC  
Sbjct: 393 SFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCLV 452

Query: 454 LSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSMAVF 513
           + NWLLGNFSF+TP+FLPK+LTPGPSIS I ENY RRSLLPHNI+WK++I+ SYL M + 
Sbjct: 453 MYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCMLMI 512

Query: 514 HYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
           H L++ +  P+ YPD+W+ LNC +GFG FV FWMWTYY L TLRNKT+ +L
Sbjct: 513 HVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/532 (71%), Positives = 440/532 (82%), Gaps = 2/532 (0%)

Query: 35  EEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGDFEAQ 94
           EE FYASPLYD LYPFRPAG+QW+ +Y IV F+LIIRCA+GLG +SG G  PMFGDFEAQ
Sbjct: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91

Query: 95  RHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSRGIEM 154
           RHWMEITQHLPI KWYWFDL+YWGLDYPPLTAYHSYI GKIGSF  P WF L+ SRG E 
Sbjct: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151

Query: 155 EGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLMLIDHG 214
           + +K++MR TVL+SEA+FY P ++YF KW GKHR QSPIGQ+IAA AIL QPSL+LIDHG
Sbjct: 152 QDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILIDHG 211

Query: 215 HFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKSLFFP 274
           HFQYNSV LGLTVYAINNLLD+FY++A+VCFVLSICFKQM+LYY+PIFF YLLSKSLF P
Sbjct: 212 HFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLFTP 271

Query: 275 RLFNIPRLVGIAAVTIVTFVAMYSPLYIFGG--GLENLIQSVHRIFPFARGIFEDKVANF 332
           +LFNIPR + IA  T+ +F+ MY PLY+FGG  GL N++QS+HRIFPFARGIFEDKVANF
Sbjct: 272 KLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVANF 331

Query: 333 WCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSFFL 392
           WCVTN++ KYK+ FTQ +LQLYSL  TV+GFLPA++II+ YPKK+LLPYAL+ACSM+F+L
Sbjct: 332 WCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAFYL 391

Query: 393 FSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAVCF 452
           FSFQVHEK            YTSTD NVLS V W+NN+ LFTLWPLLKKDGL LQY VC 
Sbjct: 392 FSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWVCL 451

Query: 453 ALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSMAV 512
            LSNWL+GNFSF+TP FLPK+LTPGPS+S I ENYH RSLLP NI WKV+IV SY++M  
Sbjct: 452 LLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAMGA 511

Query: 513 FHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
            H LD FV PP  YPD+W+ LNC +GFG F  FW+W YY LF++  K+L  L
Sbjct: 512 IHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/536 (69%), Positives = 447/536 (83%), Gaps = 3/536 (0%)

Query: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90
           N+  EE FYASP+YDFLYPFRP GNQWL +YII   A+I+RC IGLG YSG G  P+ GD
Sbjct: 10  NKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLHGD 69

Query: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150
           FEAQRHWMEITQHLP+SKWYW+DLQYWGLDYPPLTA+HSY+LG IGSF  P WF L+ SR
Sbjct: 70  FEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDKSR 129

Query: 151 GIEM--EGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSL 208
           G E    G+K+YMR+TV+IS+ +FYFPA+IYF+KW G++RNQSPIGQ IAA+AILFQPSL
Sbjct: 130 GFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSL 189

Query: 209 MLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLS 268
           MLIDHGHFQYNSVMLGLT YAINNLLD++Y++A++CFVLSICFKQM+LYYAPIFF YLLS
Sbjct: 190 MLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLS 249

Query: 269 KSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDK 328
           +SL FP+ FNI RL  I+  T+ TF  M +PLY  GGGL+N+ Q +HRIFPFARGIFEDK
Sbjct: 250 RSLLFPK-FNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPFARGIFEDK 308

Query: 329 VANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSM 388
           VANFWCVTN+ +KYK +F+  QLQLYSL ATV+GFLPA+V+ +L+PKKHLLPY L ACSM
Sbjct: 309 VANFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVLIACSM 368

Query: 389 SFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQY 448
           SFFLFSFQVHEK            Y+STDWNVLS+V WINNVALFTLWPLLK+DGL LQY
Sbjct: 369 SFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDGLHLQY 428

Query: 449 AVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYL 508
           AV F LSNWL+GNFSF+TP+FLPK LTPGPSIS+I+ +Y RRSLLP+N++WK  I+ +Y+
Sbjct: 429 AVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYI 488

Query: 509 SMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
           +M ++H+LD FV PP+ YPD+W+ LNC +GF  F  FW+W+YY +FT  +K++ DL
Sbjct: 489 AMGLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKDL 544

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/536 (69%), Positives = 447/536 (83%), Gaps = 3/536 (0%)

Query: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90
           N+  EE FYASP+YDFLYPFRP GNQWL +YII   A+I+RC IGLG YSG G  P++GD
Sbjct: 10  NKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGD 69

Query: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150
           FEAQRHWMEITQHLP+SKWYW+DLQYWGLDYPPLTA+HSY+LG IGSF  P WF L  SR
Sbjct: 70  FEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSR 129

Query: 151 GIEM--EGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSL 208
           G E    G+K+YMR+TV+IS+ +FYFPA+IYF+KW G++RNQSPIGQ IAA+AILFQPSL
Sbjct: 130 GFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSL 189

Query: 209 MLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLS 268
           MLIDHGHFQYNSVMLGLT YAINNLLD++Y++A+VCFVLSICFKQM+LYYAPIFF YLLS
Sbjct: 190 MLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLS 249

Query: 269 KSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDK 328
           +SL FP+ FNI RL  IA  T+ TF  +++PLY  GGGL+N+ Q +HRIFPFARGIFEDK
Sbjct: 250 RSLLFPK-FNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPFARGIFEDK 308

Query: 329 VANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSM 388
           VANFWCVTN+ +KYK +FT  QLQLYSL ATV+GFLPA+++ +L+PKKHLLPY L ACSM
Sbjct: 309 VANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSM 368

Query: 389 SFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQY 448
           SFFLFSFQVHEK            Y+STDWNVLS+V WINNVALFTLWPLLKKDGL LQY
Sbjct: 369 SFFLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQY 428

Query: 449 AVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYL 508
           AV F LSNWL+GNFSF+TP+FLPK LTPGPSIS+I+ +Y RRSLLP+N++WK  I+ +Y+
Sbjct: 429 AVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYI 488

Query: 509 SMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
           +M  +H+LD FV PP+ YPD+W+ LNC +GF  F  FW+W+YY +FT  +K++ DL
Sbjct: 489 AMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/536 (69%), Positives = 445/536 (83%), Gaps = 3/536 (0%)

Query: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90
           N+  EE FYASP+YDFLYPFRP GNQWL +YII   A+I+RCAIGLG YSG    P+ GD
Sbjct: 10  NKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLHGD 69

Query: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150
           FEAQRHWMEITQHLP+SKWYW+DLQYWGLDYPPLTA+HSY+LG IG+F  P WF L+ SR
Sbjct: 70  FEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDKSR 129

Query: 151 GIEM--EGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSL 208
           G E    G+K+YMR+TV+IS+ +FYFPA+IYF+KW G++RNQSPIGQ IAA AILFQPSL
Sbjct: 130 GFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSL 189

Query: 209 MLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLS 268
           MLIDHGHFQYNSVMLGLT YAINNLLD++Y++A++CFVLSICFKQM+LYYAPIFF YLLS
Sbjct: 190 MLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLS 249

Query: 269 KSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDK 328
           +SLFFP+ FNI RL  IA  T+ TF  M++PLY  GGGL N+ Q +HR+FPFARGIFEDK
Sbjct: 250 RSLFFPK-FNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPFARGIFEDK 308

Query: 329 VANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSM 388
           VANFWCV+NI +KYK +F+  QLQLYSL ATVLGFLPA+++ +L+PKKHLLPY L ACSM
Sbjct: 309 VANFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVLIACSM 368

Query: 389 SFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQY 448
           SFFLFSFQVHEK            Y+STDWNVLS+V WINNVALFTLWPLLKKDGL LQY
Sbjct: 369 SFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQY 428

Query: 449 AVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYL 508
            V F L+NWL+GNFSF+TP+FLPK LTPGPSIS+I+ +Y RRSLLP+N++WK  I+ +Y+
Sbjct: 429 VVSFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYI 488

Query: 509 SMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
           +M ++H+LD FV PP  YPD+W+ LNC +GF  F  FW+W+YY +FT  NK++ DL
Sbjct: 489 AMGLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKDL 544

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/537 (69%), Positives = 442/537 (82%), Gaps = 3/537 (0%)

Query: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90
            E  +E FYASPLYDFLYPFRPAG+QW+ +YIIV FA+IIRCA+GLG YSG    PMFGD
Sbjct: 44  TETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGD 103

Query: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150
           FEAQRHWMEITQ+LPIS+WYWFDLQYWGLDYPPLTA+HSY+ GKIGSF  P WFTL DSR
Sbjct: 104 FEAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSR 163

Query: 151 GIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLML 210
           G E + +K++MR TVL SE++ Y PA++YF+KW GK RNQSPIGQ+IA  AILFQPSL+L
Sbjct: 164 GYEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLIL 223

Query: 211 IDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKS 270
           IDHGHFQ+NSVMLGLTVY +NNLLD+FY+ A+VCFVLSICFKQM+LYY+PIFF YLLSKS
Sbjct: 224 IDHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKS 283

Query: 271 LFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFG---GGLENLIQSVHRIFPFARGIFED 327
           LF PRLFNIPR   I+  TI TF +M+ P+Y FG   GG+ NL+QS+ RIFPFARGIFED
Sbjct: 284 LFHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFED 343

Query: 328 KVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACS 387
           KVANFWCVTN++ KYK  FTQ+QLQLYSL  T++ FLPA+++I+LYP+K+LL YAL+ACS
Sbjct: 344 KVANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACS 403

Query: 388 MSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQ 447
           MSF+LFSFQVHEK            YTSTD NVLS V W+NN+ LFTLWPLLKKDGL LQ
Sbjct: 404 MSFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQ 463

Query: 448 YAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSY 507
           Y VC  LSNWL+GNFSF+TP+FLPK+LTPGPSI  + ENY R +LLP N +WKV+IV SY
Sbjct: 464 YWVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSY 523

Query: 508 LSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
           + M V H++D+F+EPP+ YPD+W+ LNC +GFG FV FW+W YY LF++  K +  L
Sbjct: 524 VMMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/544 (70%), Positives = 445/544 (81%), Gaps = 15/544 (2%)

Query: 35  EEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGDFEAQ 94
           EE FYASPL+DFLYPFRP G+QWL +Y+I+ FA+IIRCAI LGSYSG G  PMFGDFEAQ
Sbjct: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEAQ 76

Query: 95  RHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSRGIEM 154
           RHWMEITQHLPISKWYWFDLQYWGLDYPP TAYHSY  GK+GSF  P WF LN SRG E 
Sbjct: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136

Query: 155 E--GIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLMLID 212
           +  G+K+YMR TV++SEAVFY PA++YF+KW GKHRNQSPIGQ+IAA AILFQPSLMLID
Sbjct: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196

Query: 213 HGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKSLF 272
           HGHFQYNSVMLGLTVYAINNLLD+FY  A++CFVLS+CFKQM+LYY+PIFFGYLLSKSL 
Sbjct: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256

Query: 273 FPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGG------------GLENLIQSVHRIFPF 320
            P   NI R + +A  T+V+FV M+ P+Y+FG             GL NLIQ + RIFPF
Sbjct: 257 HPSC-NISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315

Query: 321 ARGIFEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLP 380
           ARGIFEDKVANFWCVTN++IKY+  FTQ+QLQ YSL AT++GFLP+++ I LYP+K L+P
Sbjct: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375

Query: 381 YALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLK 440
           YALAACSMSFFLFSFQVHEK            YTSTDWNVLS+VCWINNVALFTLWPLL+
Sbjct: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435

Query: 441 KDGLILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWK 500
           KDGL+LQY VC+ LSNWL+GNFSF+TPKFLP  LTPGPSIS I ++Y R SLLPHNILWK
Sbjct: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495

Query: 501 VVIVSSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKT 560
           ++I+SSY+ M     LD F +PPTNYPD+WI LNC +GFG F+ FW+W  Y +  +RNKT
Sbjct: 496 IIIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555

Query: 561 LMDL 564
           L DL
Sbjct: 556 LNDL 559

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/536 (69%), Positives = 441/536 (82%), Gaps = 3/536 (0%)

Query: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90
           N+  EE FYASP+YDFLYPFRP GNQWL +YII   A+I+RCAIGLG YSG    P+ GD
Sbjct: 10  NKPAEESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGD 69

Query: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150
           FEAQRHWMEITQHLP+SKWYW+DLQYWGLDYPPLTA+HS + G IG+F  P WF L+ SR
Sbjct: 70  FEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSR 129

Query: 151 GIEM--EGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSL 208
           G E    G+K+YMR+TV+IS+ +FYFPA+IYF+KW G++RNQSPIGQ IAA AILFQPSL
Sbjct: 130 GFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSL 189

Query: 209 MLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLS 268
           MLIDHGHFQYNSVMLGLT YAINNLLD++Y++A+VCFVLSICFKQM+LYYAPIFF YLLS
Sbjct: 190 MLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLS 249

Query: 269 KSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDK 328
           +SL FP+ FNI RL  IA  T+ TF  + +PLY  GGGL N+ Q ++RIFPF+RGIFEDK
Sbjct: 250 RSLLFPK-FNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDK 308

Query: 329 VANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSM 388
           VANFWCVTNI +KYK +FT  QLQLYSL ATV+GFLPA+++ +L+PKKHLLPY L ACSM
Sbjct: 309 VANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSM 368

Query: 389 SFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQY 448
           SFFLFSFQVHEK            Y+STDWNVLS+V WINNVALFTLWPLLKKDGL LQY
Sbjct: 369 SFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQY 428

Query: 449 AVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYL 508
            V F LSNWL+GNFSF+TP+FLPK LTPGPSIS+I+ +Y RRSLLP+N++WK  I+ +Y+
Sbjct: 429 TVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYI 488

Query: 509 SMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
           +M V+H LD FV PP+ YPD+W+ LNC +GF  F  FW+W+YY +FT  NK++ DL
Sbjct: 489 AMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/535 (69%), Positives = 437/535 (81%), Gaps = 1/535 (0%)

Query: 31  NEAIE-EVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFG 89
           +E ++ E FYASPLY FL PF+   NQWL+ YIIV FALIIRCAIGLG YSGM  +PMFG
Sbjct: 25  DETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFG 84

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DFEAQRHWMEITQHLPIS+WY++DLQYWGLDYPPLTAYHSYI G IG F  P WF L  S
Sbjct: 85  DFEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETS 144

Query: 150 RGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLM 209
           RG+EM+ +K++MR T ++SE +FY PAIIYF+ W GK R QSP+GQYIAA AILFQP LM
Sbjct: 145 RGMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLM 204

Query: 210 LIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSK 269
           LIDHGHFQYNSVMLGLTVYAINNLLDD Y+ A++ FV+SICFKQMSLYYAPIFF YLL +
Sbjct: 205 LIDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGR 264

Query: 270 SLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKV 329
           SLF  + FN+ R + IA  T+V+F  +++PLY+FGGG  N+IQSVHRIFPFARGIFEDKV
Sbjct: 265 SLFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKV 324

Query: 330 ANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMS 389
           ANFWCVTN+++KYK+ +TQD+LQLYSL  TV+GFLPA+V I+ +PKKHLLPY+LAAC+MS
Sbjct: 325 ANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMS 384

Query: 390 FFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYA 449
           FFLFSFQVHEK            YTSTDWNVLS+V WINNVALFTLWPLLKKDG++LQY 
Sbjct: 385 FFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYG 444

Query: 450 VCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLS 509
           VCF LSNWL+GNFSF TP+FLPK+LTPGP I  ++ +Y RRSLLP+NI+WK++IV SY+ 
Sbjct: 445 VCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIV 504

Query: 510 MAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
           M     L+ FVEPP  YPDI++ LNC +GF  F  FW+W YY LFTL +K L  L
Sbjct: 505 MVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQYL 559

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/533 (70%), Positives = 440/533 (82%), Gaps = 2/533 (0%)

Query: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90
            + ++E F+ASPL+DFL PFRP  NQW A+YIIV FALIIRC +GLGS+SGM   PM GD
Sbjct: 10  RKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGD 69

Query: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150
           FEAQRHWME+T +LP+S+WYW+DL YWGLDYPPLTAYHSYILGK+G    P WF L  SR
Sbjct: 70  FEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSR 129

Query: 151 GIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLML 210
           G E   +KSYMR TVL+SE + Y P +IYF+KW GKHR Q+PIGQYIAA AILFQPSL+L
Sbjct: 130 GQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLIL 189

Query: 211 IDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKS 270
           IDHGHFQYNSVMLGLTVYAINNLLD++Y+ A++CFVLS+CFKQM+LYYAPIFF YLLSKS
Sbjct: 190 IDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFFSYLLSKS 249

Query: 271 LFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVA 330
           LF P LFN+PRL+ +AA T+++F AM+ PLY++GG + N++QS+HRIFPF+RGIFEDKVA
Sbjct: 250 LFSP-LFNLPRLLAVAAATLISFAAMFFPLYMWGG-IRNVLQSIHRIFPFSRGIFEDKVA 307

Query: 331 NFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSF 390
           NFWC +NI IKYK+ +TQ QLQ+YSL AT LGFLPA ++I  YPKKHL+PYAL ACSMSF
Sbjct: 308 NFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSF 367

Query: 391 FLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAV 450
           FLFSFQVHEK            YTSTDWNVLSMV WINN+A FTLWPLLKKDGL+LQYA 
Sbjct: 368 FLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYAT 427

Query: 451 CFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSM 510
              LSNWL+GNFSFVTP+FLPK LTPGPS S + ENY RRSLLP NI WK++IV+SY+SM
Sbjct: 428 LLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISM 487

Query: 511 AVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMD 563
            + H LDF+V+PP  YPD+W+ LNC +GF SF  FW+W YY +FTLRNKTL D
Sbjct: 488 GILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/529 (68%), Positives = 430/529 (81%), Gaps = 2/529 (0%)

Query: 36  EVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGDFEAQR 95
           E F+ASP+YDFL PFRP GNQW A+Y+IV FALIIRCA+GLG YSGM   PMFGDFEAQR
Sbjct: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99

Query: 96  HWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSRGIEME 155
           HWMEITQHLP+ +WYW+DLQYWGLDYPPLTAYHSY+LGK+GSF    WF L  SRG E  
Sbjct: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159

Query: 156 GIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLMLIDHGH 215
            +KSYMR TV+ISE + Y PA+IYF+KW GK+R+QSPIGQYIAA AILFQP+L+L+DHGH
Sbjct: 160 NLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGH 219

Query: 216 FQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKSLFFPR 275
           FQYN VMLG+TVY +NNLLD FY++ ++CFVLS+CFKQM+LYY+PIFF YLLSKS + P 
Sbjct: 220 FQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPG 279

Query: 276 LFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVANFWCV 335
           + N+PRL  I+  T + F+  + P+YIF GG +NL+QS+HRIFPFARGIFEDKVANFWCV
Sbjct: 280 I-NLPRLFAISVSTALAFIGSFGPIYIF-GGYKNLVQSMHRIFPFARGIFEDKVANFWCV 337

Query: 336 TNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSFFLFSF 395
           +NI IKY+  FTQ  LQLYSL ATV+G LP+ +I  LYPK+HLLPYALAACSMSFFLFSF
Sbjct: 338 SNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLFSF 397

Query: 396 QVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAVCFALS 455
           QVHEK            YTS DWNVLS+VCWINNVALFTLWPLLKKD L+LQY V F  S
Sbjct: 398 QVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFMFS 457

Query: 456 NWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSMAVFHY 515
           NWL+GNFSFVTP+FLPK LTPGPSIS I  +Y R SLLP +++W+++IV SY++M + H+
Sbjct: 458 NWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGIIHF 517

Query: 516 LDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
           LD++V PP+ YPD+W+  NC +GF  FV FW+W  Y LF +RN TL DL
Sbjct: 518 LDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/534 (69%), Positives = 435/534 (81%), Gaps = 1/534 (0%)

Query: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90
           +   EE FYASPLYDFLYPF+P G+QWL +YII+ FA+IIRCAIGLG YSG    PM GD
Sbjct: 15  DNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVKPMHGD 74

Query: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150
           FEAQRHW+EITQHLPIS+WY+FDL+YWGLDYPPLTAYHSYILGK+GS I P WF LN SR
Sbjct: 75  FEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVSR 134

Query: 151 GIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLML 210
           G+E   +K+YMR TV++SE +FY PA++YF+KW G+HR  SP+GQ+IAA AILFQP+LML
Sbjct: 135 GLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPALML 194

Query: 211 IDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKS 270
           IDHGHFQYN VMLG TVYAIN+L+D+FY+ A+ CFVLSICFKQM+LYY+PIFF YLL + 
Sbjct: 195 IDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLGRC 254

Query: 271 LFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVA 330
           +F   +   PR + IA  TI TF+ MY PLYI G G +N++QSVHRIFPFARGIFEDKVA
Sbjct: 255 VFKTGI-RFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGIFEDKVA 313

Query: 331 NFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSF 390
           NFWCVTNI +KYK  FTQ QLQLYSL AT LGFLPA+V+++LYPKKHL+P+ALAACSMSF
Sbjct: 314 NFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALAACSMSF 373

Query: 391 FLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAV 450
           FLFSFQVHEK            YTST+W+VLS+V WINNV LFTLWPLLKKDGL LQY V
Sbjct: 374 FLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGLALQYCV 433

Query: 451 CFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSM 510
           CFA  NWL+GNFSFVTP FLPK LTPGPS+S++  NY RRSLLP +I+WK++IV SY+SM
Sbjct: 434 CFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIVGSYISM 493

Query: 511 AVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
              H LD FV PP NYPD+W+ LNC +GFG F+ FW+W YY LF+L  ++L  L
Sbjct: 494 GAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/534 (65%), Positives = 424/534 (79%), Gaps = 2/534 (0%)

Query: 31  NEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGD 90
              +EE F+ASPLYDFLYP RP  NQW A+YII+ FALI+R A+GLG YSG G  P+FGD
Sbjct: 18  RSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKGKGPLFGD 77

Query: 91  FEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSR 150
           FEAQRHWMEIT  LPIS+WY++DL+YWGLDYPPLTAYHSYILG++GSF+   WF LN SR
Sbjct: 78  FEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSR 137

Query: 151 GIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLML 210
           G E   +KS+MR TVL+SE V Y PA++YF++W G+HRNQSPIGQY+A  AILFQPSL+L
Sbjct: 138 GFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLIL 197

Query: 211 IDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKS 270
           IDHGHFQYN VMLGL VY INNLLD+FY  A++CFVLS+ FKQM+LYY+P+ F YL S+S
Sbjct: 198 IDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRS 257

Query: 271 LFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVA 330
            ++PR FN PR  GIA  T++TF A+Y+PL +F G   N+IQSV+R+FPF+RGIFEDKVA
Sbjct: 258 AYYPR-FNFPRFAGIAIATLLTFGALYAPLCLF-GDFRNIIQSVYRVFPFSRGIFEDKVA 315

Query: 331 NFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSF 390
           NFWCVTN++IKY+  +TQ QLQ Y L  T +   PA +II LYPKK LLPYALAACSM+F
Sbjct: 316 NFWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYALAACSMAF 375

Query: 391 FLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAV 450
           FLFSFQVHEK            + ST+W+VLSMV WINNVALFTLWPLLKKDGL+LQYA+
Sbjct: 376 FLFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDGLLLQYAI 435

Query: 451 CFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSM 510
            F LSNWLLGNFSFVTP FLPK LTPGPS+S + ++Y RRSLLP NI W+++IVSSY+ M
Sbjct: 436 MFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCM 495

Query: 511 AVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
           A  H LD +V+PP NYPDIW+   C +GF  F  FW+W YY L+ +RN +L +L
Sbjct: 496 AFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/530 (65%), Positives = 427/530 (80%), Gaps = 2/530 (0%)

Query: 35  EEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGDFEAQ 94
           +E F+ASPLYDFL PFRP  NQ+ A+Y+IV FAL+IRCA+GLGS+SG    PM GDFEAQ
Sbjct: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68

Query: 95  RHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSRGIEM 154
           RHWME+T +LP+S+WYWFDLQYWGLDYPPLTAYHSY LGK+GS + P+WF L  SRG E 
Sbjct: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128

Query: 155 EGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLMLIDHG 214
             +K+YMR TV++SEA  Y PA++YF+KWFG  R QSPIGQYIAA AILFQPSL+LIDHG
Sbjct: 129 PELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188

Query: 215 HFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKSLFFP 274
           HFQYNSVMLGLTVYAINNLLD F+  A++CF+LS+CFKQM+L+Y+PIFF YLLS+SLF P
Sbjct: 189 HFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLFSP 248

Query: 275 RLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVANFWC 334
             F   R + +A  T++TF  M+SPLY+F GG++N++QS+HRIFPF+RGIFEDKVANFWC
Sbjct: 249 S-FKFSRFMSVALSTVITFCLMFSPLYVF-GGMKNVLQSIHRIFPFSRGIFEDKVANFWC 306

Query: 335 VTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSFFLFS 394
           V+N+++KY   FTQDQLQ  S  AT  GFLP+  ++VLYPKKH++PY LAACSM+FFLF 
Sbjct: 307 VSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLFG 366

Query: 395 FQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAVCFAL 454
           FQVHEK            + STDWNVL++V WINNVALFTLWPLLKKD L LQY +   L
Sbjct: 367 FQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMMLL 426

Query: 455 SNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSMAVFH 514
           SNWL+GNFSFVTP+FLP  +TPGPS+S + E Y RRS LP+NI+WK++I++SY+ MAV H
Sbjct: 427 SNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVIH 486

Query: 515 YLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
            LD FV+PP   PD+W+ +NC +GF  F  FW+W  Y LFT+RNK+++DL
Sbjct: 487 ILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/529 (65%), Positives = 422/529 (79%), Gaps = 2/529 (0%)

Query: 35  EEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGDFEAQ 94
            E F+ASPLYDFL PFRP  NQ+ A+Y+IV FAL+IRCA+GLGS+SG    P+ GDFEAQ
Sbjct: 9   NEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHGDFEAQ 68

Query: 95  RHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSRGIEM 154
           RHWME+T HLP+S+WYW+DLQYWGLDYPPLTAYHSY+LGK+GS +  +WF L  SRGIE 
Sbjct: 69  RHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSSRGIEN 128

Query: 155 EGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLMLIDHG 214
             IK+YMR TV++SEA  Y PA++YF+KWFG  R QSPIGQYIAA AILFQPSL+LIDHG
Sbjct: 129 PDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188

Query: 215 HFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKSLFFP 274
           HFQYNSVMLGLTVY+INNLLD +Y  A++CFVLS+CFKQM+LYY+P+FF YLLS+ L  P
Sbjct: 189 HFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSECLISP 248

Query: 275 RLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVANFWC 334
            L N+PR + +A  T+++F  ++SPLY+FGG  +N++QS+HRIFPF+RGIFEDKVANFWC
Sbjct: 249 SL-NVPRFLSVAFSTVISFCIIFSPLYVFGGT-KNVLQSIHRIFPFSRGIFEDKVANFWC 306

Query: 335 VTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSFFLFS 394
           V+N+L KY   +TQ +LQ +S+ AT  GFLP+ ++++ YPKKH++P+ALAACSM+FFLFS
Sbjct: 307 VSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAFFLFS 366

Query: 395 FQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAVCFAL 454
           FQVHEK            Y STDWNVLSMV WINNVALFTLWPLLKKD L LQY +   L
Sbjct: 367 FQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGILMLL 426

Query: 455 SNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSMAVFH 514
           SNWL+GNFSFVTP+FLPK +TPGPSIS + E Y RRS LP N  WK++IV+SYL MA  H
Sbjct: 427 SNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIMAAIH 486

Query: 515 YLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMD 563
            LDFFV  P   PD+W+ LNC +GF  F  FW+W +Y LFT+RN  L D
Sbjct: 487 ILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/532 (64%), Positives = 420/532 (78%), Gaps = 2/532 (0%)

Query: 33  AIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGDFE 92
            ++E F+ASPLYDFLYP RP  NQW A+YIIV FALIIR A+GLG YSGMG  PMFGDFE
Sbjct: 34  GLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFE 93

Query: 93  AQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSRGI 152
           AQRHWME+TQH+P+SKWY+  LQYWGLDYPPLTAYHSY+LGK+GS+I P+WF+L+ SRG 
Sbjct: 94  AQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRGY 153

Query: 153 EMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLMLID 212
           E E +KSYMR TV++SE  FY PA++YF++W G+ R QSPIGQYIA  AILFQP+L+LID
Sbjct: 154 ESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALILID 213

Query: 213 HGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKSLF 272
           HGHFQYN VMLGLTV AINNLLD +Y++A+V FV S+ FKQM+LYYAP+ F YLLS+S++
Sbjct: 214 HGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIY 273

Query: 273 FPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVANF 332
           +PRL NIPR V +A  T++ F  +Y+PLY+  G +  + QS+HR+FPF RG+FEDKVANF
Sbjct: 274 YPRL-NIPRFVAVAVATLIAFGVLYAPLYLL-GNISAIFQSIHRVFPFERGLFEDKVANF 331

Query: 333 WCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSFFL 392
           WCVTN+L+KYK K+T  QL+ +SL  T    LP+L+I  LYPKK +LPYALAACSMSFFL
Sbjct: 332 WCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFFL 391

Query: 393 FSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAVCF 452
           F FQVHEK            YTSTDWNVLSMV WINN+ALFTLWPLLKKDGL LQYA+ F
Sbjct: 392 FGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIMF 451

Query: 453 ALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSMAV 512
            LSNWL+GNFSF+TP FLPK+LTPGPS+S + + Y RRSLLP NI+W+++IV SY+ +  
Sbjct: 452 LLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYICVGA 511

Query: 513 FHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564
            H  + +  P    PDIW+  NC++G  SF  FWMW  Y +F +RN T+ DL
Sbjct: 512 IHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  116 bits (290), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 133/267 (49%), Gaps = 26/267 (9%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT +LPISKWY+ +   W LDYPP  AY  ++L +    I      L D 
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFAPEIVKNDGCL-DI 122

Query: 150 RGIEMEGIKS--YMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPS 207
             +   G+ +  + R TV+ISE + +     Y +    K R Q     ++ A++I+  P 
Sbjct: 123 VEVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASSIVLSPG 178

Query: 208 LMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLL 267
            ++IDH HFQYN  +  + + +I       Y   +V + +S+CFK + LY AP +F +LL
Sbjct: 179 FLIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFVFLL 238

Query: 268 S------KSLFFPRLFNI------PRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVH 315
                  ++  F    ++       RL  +A +    F   ++P +IF      L Q + 
Sbjct: 239 RAYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAP-FIF-----QLPQVLS 292

Query: 316 RIFPFARGIFEDKVA-NFWCVTNILIK 341
           R+FPF+RG+     A NFW + + + K
Sbjct: 293 RLFPFSRGLTHAYWAPNFWAMYSFIDK 319

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  113 bits (283), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 132/272 (48%), Gaps = 36/272 (13%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+WM IT  LPISKWY+ +   W LDYPP  AY  + L +      PK   + D 
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQF----VPK--IVRDD 162

Query: 150 RGIEMEGIKSY-------MRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAI 202
             +++  +  +        R TV+ISE   +     Y +      R QS    ++ A++I
Sbjct: 163 GCLDIVEVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSI 218

Query: 203 LFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIF 262
           +  P  +++DH HFQYN+ +  + + +I       Y   +V + +++CFK + LY AP +
Sbjct: 219 VLSPGFLIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCY 278

Query: 263 FGYLLSKSLFFPRLFNIP------------RLVGIAAVTIVTFVAMYSPLYIFGGGLENL 310
           F +LL   +   + F               RL+ + ++ +  F   ++P +IF      +
Sbjct: 279 FVFLLRAYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAP-FIF-----QM 332

Query: 311 IQSVHRIFPFARGIFEDKVA-NFWCVTNILIK 341
            Q + R+FPF+RG+     A NFW + + L K
Sbjct: 333 PQVLSRLFPFSRGLTHAYWAPNFWAIYSFLDK 364

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  112 bits (280), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 129/272 (47%), Gaps = 36/272 (13%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LPIS+WY+     W LDYPP  AY  + L +      PK  ++ D 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQF----VPK--SVRDD 119

Query: 150 RGIEMEGIKSY-------MRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAI 202
             +++  I  +        R TV+ SE + +    IY +      R+QS    ++ A++I
Sbjct: 120 GCLDIVEIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSI 175

Query: 203 LFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIF 262
           +  P  ++IDH HFQYN  +  + + +I    +  Y + +V +  +ICFK + LY AP +
Sbjct: 176 VLSPGFLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCY 235

Query: 263 FGYLLSKSLF------------FPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENL 310
           F +LL   +             F  L     L+ +A V +  F   + P          +
Sbjct: 236 FVFLLRAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPF------AHQM 289

Query: 311 IQSVHRIFPFARGIFEDKVA-NFWCVTNILIK 341
            Q + R+FPF+RG+     A NFW + + + K
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWALYSFMDK 321

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  111 bits (277), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 128/270 (47%), Gaps = 32/270 (11%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LP+ +WY+ +   W LDYPP  AY  + L +      PK+   +  
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQF----VPKFVKEDGC 98

Query: 150 RGIEMEG-----IKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILF 204
             I  EG        + R TV+ISE + +    ++ +      + QS    ++ A++I+ 
Sbjct: 99  LDILPEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIIL 154

Query: 205 QPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFG 264
            P  ++IDH HFQYN  + G+ + +I    +  Y +  + + +++CFK + LY AP +F 
Sbjct: 155 SPGFLMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFV 214

Query: 265 YLLSKSLFFPRLFNIP------------RLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQ 312
           +LL   +   + F                L+ +  + +      + P +       ++ Q
Sbjct: 215 FLLRAYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFW------RDMNQ 268

Query: 313 SVHRIFPFARGIFEDKVA-NFWCVTNILIK 341
            + R+FPF+RG+     A NFW + + + K
Sbjct: 269 LLSRLFPFSRGLTHAYWAPNFWAIYSFVDK 298

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 127/272 (46%), Gaps = 36/272 (13%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LP+ KWY+     W LDYPP  AY  ++L +      P+   + D 
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQF----VPQ--RVQDD 97

Query: 150 RGIEMEGIKSY-------MRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAI 202
             +++  +  +        R TV++SE + +    +Y +K     R+      ++ A++I
Sbjct: 98  GCLDIVAVGQFGLPTIVFQRVTVIVSEILLFVVLQVYINKSHISDRS----ANFVVASSI 153

Query: 203 LFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIF 262
           +  P  ++IDH HFQYN  +  + + +I       Y +    F  ++CFK + LY AP F
Sbjct: 154 VLSPGFLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSF 213

Query: 263 FG-----YLLSKSLFFPRLFNI-------PRLVGIAAVTIVTFVAMYSPLYIFGGGLENL 310
           F      Y+L  S F  R +N          L  +  V +  F   ++P       +  L
Sbjct: 214 FAFLLRVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPF------IYQL 267

Query: 311 IQSVHRIFPFARGIFEDKVA-NFWCVTNILIK 341
            Q + R+FPF+RG+     A NFW + + L K
Sbjct: 268 PQLMSRLFPFSRGLTHAYWAPNFWALYSALDK 299

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 126/274 (45%), Gaps = 40/274 (14%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DFE  R+W+ +T  LP+ KWY      W +DYPPL A+  + L ++     P     +  
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQV----VPGAVRRDGC 114

Query: 150 RGIEMEG-----IKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILF 204
             +  EG        + R TV+ SE + Y    +Y S    + R  +    ++  T++  
Sbjct: 115 LKLVAEGRYGWPTVVFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVAL 170

Query: 205 QPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFG 264
            P+ +L+DH HFQYN  +  + V +I    +  Y +    F +++C K + LY AP +F 
Sbjct: 171 SPAFLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFV 230

Query: 265 YLLS--------------KSLFFP-RLFNIPRLVGIA-AVTIVTFVAMYSPLYIFGGGLE 308
           +LL               + L F  R  N+ RL G+  A+  VTF         F G + 
Sbjct: 231 FLLRAYVLDLGEFRFRSYRDLVFAVRWGNLCRLGGVVLAIMAVTFAP-------FAGVMP 283

Query: 309 NLIQSVHRIFPFARGIFEDKVA-NFWCVTNILIK 341
            L+    R+FPF+RG+     A NFW + + + K
Sbjct: 284 QLMA---RLFPFSRGLTHAYWAPNFWAIYSFVDK 314

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 123/256 (48%), Gaps = 16/256 (6%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ +T  LP+ +WY+     W LDYPP  AY  +I+ +      P+   + D 
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQF----VPQ--VVRDD 109

Query: 150 RGIEMEGIKSYMRTTVLISEAVFYFPAIIYFS--KWFGKHRNQSPIGQ-YIAATAILFQP 206
             +++  I  +   TV+          I+ F   +WF    N     Q +I AT+I+  P
Sbjct: 110 GCLDIVEIGKFGEPTVIFQRLSVITSEILLFVVLQWFINTSNVKERTQSFIVATSIILSP 169

Query: 207 SLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYL 266
             +++DH HFQYN  +  + + +I       Y + +V +  ++CFK + LY AP +F +L
Sbjct: 170 GFLIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVFL 229

Query: 267 LS------KSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPF 320
           L       K   F    ++ RLV    +  +  V +      FG  + ++ Q + R+FPF
Sbjct: 230 LRAYVLNVKGFQFKSYKDLVRLVQWTNLFRLAGVVLSIVGVCFGPFIFDMPQLLTRLFPF 289

Query: 321 ARGIFEDKVA-NFWCV 335
           +RG+     A NFW +
Sbjct: 290 SRGLTHAYWAPNFWAI 305

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 126/272 (46%), Gaps = 36/272 (13%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LPIS+WY+     W LDYPP  AY  + L +      PK   + D 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQF----VPK--VVRDD 119

Query: 150 RGIEMEGIKSY-------MRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAI 202
             +++  +  +        R TV+ SE + Y    IY +      R+QS    ++ A++I
Sbjct: 120 GCLDIVEVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSI 175

Query: 203 LFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIF 262
           +  P  ++IDH HFQYN  +  + + +I    +  Y + +  +  +ICFK + LY AP +
Sbjct: 176 VLSPGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCY 235

Query: 263 FGYLLSKSLF------------FPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENL 310
           F +LL   +             F  L     L  + ++ I  F   + P          +
Sbjct: 236 FVFLLRAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFVPF------AHQM 289

Query: 311 IQSVHRIFPFARGIFEDKVA-NFWCVTNILIK 341
            Q + R+FPF+RG+     A NFW + + + K
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWALYSFMDK 321

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  108 bits (269), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 132/267 (49%), Gaps = 26/267 (9%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LP+ +WY+ +   W LDYPP  AY  + L ++   I  +   L D 
Sbjct: 44  DFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCL-DI 102

Query: 150 RGIEMEGIKS--YMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPS 207
             +   G+ +  + R TV+ SE + +    +Y +K     R+      ++ A++I+  P 
Sbjct: 103 VKVGQFGMPTIVFQRLTVIASEILLFVVLQVYINKSHISERS----ANFVVASSIVLSPG 158

Query: 208 LMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLL 267
            ++IDH HFQYN  +  + + +I    +  Y +  + F ++ICFK + LY AP FF +LL
Sbjct: 159 FLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFVFLL 218

Query: 268 SKSLF---------FPRLFNIPR---LVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVH 315
              +          +  L +I +   L  + +V +  F   ++P       +    Q + 
Sbjct: 219 RVYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPF------ISQWPQLLS 272

Query: 316 RIFPFARGIFEDKVA-NFWCVTNILIK 341
           R+FPF+RG+     A NFW + ++L K
Sbjct: 273 RLFPFSRGLTHAYWAPNFWAMYSLLDK 299

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 127/267 (47%), Gaps = 26/267 (9%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  + L +     Y K     D 
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQFVP-SYVKSDGCLDI 94

Query: 150 RGIEMEGIKS--YMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPS 207
             +   G+ +  + R TV+ SE + +    +Y +      R QS    ++ A++I   P 
Sbjct: 95  VEVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAISPG 150

Query: 208 LMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLL 267
            ++IDH HFQYN  +  + + +I    +  Y      + +++CFK + LY AP +F +LL
Sbjct: 151 FLIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFVFLL 210

Query: 268 SKSLFFPRLFNIP------------RLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVH 315
              +   + F                LV + +V I TF   + P +IF     +L Q + 
Sbjct: 211 RAYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGP-FIF-----DLPQLLT 264

Query: 316 RIFPFARGIFEDKVA-NFWCVTNILIK 341
           R+FPF+RG+     A NFW + + + K
Sbjct: 265 RLFPFSRGLTHAYWAPNFWAIYSTIDK 291

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  107 bits (267), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 126/272 (46%), Gaps = 36/272 (13%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LP+S+WY+     W LDYPP  AY  + L +      PK   + D 
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQF----VPK--VVRDD 119

Query: 150 RGIEMEGIKSY-------MRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAI 202
             +++  +  +        R TV+ SE + +    IY +      R+QS    ++ A++I
Sbjct: 120 GCLDIVEVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSI 175

Query: 203 LFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIF 262
           +  P  ++IDH HFQYN  +  + + +I    +  Y   +V +  SICFK + LY AP +
Sbjct: 176 VLSPGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCY 235

Query: 263 FGYLLSKSLF------------FPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENL 310
           F +LL   +             F  L     L  + ++ I  F   + P          +
Sbjct: 236 FVFLLRAYVLNVNNFKFKSYKDFLFLIRWTNLFKLGSIVIGIFTICFLPF------AHQM 289

Query: 311 IQSVHRIFPFARGIFEDKVA-NFWCVTNILIK 341
            Q + R+FPF+RG+     A NFW + + + K
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWALYSFMDK 321

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  107 bits (266), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 125/272 (45%), Gaps = 36/272 (13%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LPISKWY+     W LDYPP  AY  + L +      PK   + D 
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQF----VPK--VVRDD 119

Query: 150 RGIEMEGIKSY-------MRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAI 202
             +++  +  +        R TV+ S+ + +    +Y +      R+QS    ++ A++I
Sbjct: 120 GCLDIVEVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSI 175

Query: 203 LFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIF 262
           +  P   +IDH HFQYN  +  + + +I       Y + ++ +  +ICFK + LY AP +
Sbjct: 176 VLSPGFFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCY 235

Query: 263 FGYLLSKSLF------------FPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENL 310
           F +LL   +             F  L     L  + ++ I  F   + P          +
Sbjct: 236 FVFLLRAYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFLPF------AHQM 289

Query: 311 IQSVHRIFPFARGIFEDKVA-NFWCVTNILIK 341
            Q + R+FPF+RG+     A NFW + + + K
Sbjct: 290 PQVLSRLFPFSRGLTHAYWAPNFWALYSFMDK 321

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 99/425 (23%), Positives = 172/425 (40%), Gaps = 89/425 (20%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  + + +      PK   + D 
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQF----VPK--VVRDD 107

Query: 150 RGIEMEGIKSY-------MRTTVLISEAVFYFPAIIYFSKWF-GKHRNQSPIGQYIAATA 201
             +++  +  +        RT+V+ISE + +        +WF  K ++      +I AT+
Sbjct: 108 GCLDIVPVGQFGWATVVFQRTSVIISEILLFVVL-----QWFINKSKDNERTQSFIVATS 162

Query: 202 ILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPI 261
           I+  P  ++IDH HFQYN  +  + + +I     + Y +  + + +++CFK + LY AP 
Sbjct: 163 IILSPGFLIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPC 222

Query: 262 FFGYLLSKSLFFPRLFNIP------------RLVGIAAVTIVTFVAMYSPLYIFGGGLEN 309
           +F +LL   +   + F                L  +  + +  F   + P       + +
Sbjct: 223 YFVFLLRAYVLNVKNFKFKSYKDLILLIQWNNLFKLGGIVLSIFGICFLPF------IYH 276

Query: 310 LIQSVHRIFPFARGI--------------FEDKVANFW-------------CVTNILIKY 342
           L Q   R+FPF RG+              F DK+A                C+ + L   
Sbjct: 277 LPQVFTRLFPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPT 336

Query: 343 KIKFTQDQLQLY----------------------SLAATVLGF--LPALVIIVLYPKKHL 378
             +  Q ++  Y                       L+  + GF  L A+V ++  P    
Sbjct: 337 TREEIQSRIMEYGNNGSKGLVEDVYFIILPQIIPKLSFILTGFYQLLAVVPLLFDPSFKR 396

Query: 379 LPYALAACSMSFFLFSFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVCWINNVALFTLWPL 438
              +L  C M+ FLF + VHEK                D  +L+    +++    +L+PL
Sbjct: 397 FIGSLTLCGMASFLFGWHVHEKAILLVIIPFSFL-VVCDRRLLTSFMLVSSAGYVSLFPL 455

Query: 439 LKKDG 443
           L K+ 
Sbjct: 456 LYKND 460

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  104 bits (260), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 131/270 (48%), Gaps = 44/270 (16%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LP++KWY      W LDYPP  AY  + L +      PK  ++ + 
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQF----VPK--SVAED 105

Query: 150 RGIEMEGIKSY-------MRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQ----YIA 198
             +++  + S+        R TV++SE V Y    ++         N S I +    ++ 
Sbjct: 106 GCLDIVKVGSFGLPTIIFQRITVILSELVLYAALQVFI--------NTSDISEKSANFVV 157

Query: 199 ATAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYY 258
           A++I+  P L+++DH HFQYN  + G+ + +I    +  Y + +  F +++CFK + LY 
Sbjct: 158 ASSIVLSPGLLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYL 217

Query: 259 APIFFGYLLSKSLF---------FPRLFNIPR---LVGIAAVTIVTFVAMYSPLYIFGGG 306
           AP +F +LL   +          +  L +I +   L+ +A+V +  F   + P       
Sbjct: 218 APAYFVFLLRAYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIFSLAFLPF------ 271

Query: 307 LENLIQSVHRIFPFARGIFEDKVA-NFWCV 335
           +    Q + R+FPF+RG+     A N W V
Sbjct: 272 ITTWQQLLARLFPFSRGLTHAYWAPNVWAV 301

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  103 bits (258), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 129/269 (47%), Gaps = 30/269 (11%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKI--GSFIYPKWFTLN 147
           DF+  R+W+ IT +LP+ +WY+     W LDYPP  AY  + L +   G+        + 
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEIV 104

Query: 148 DSRGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPS 207
           D +G        + R+TV++SE + +    ++ +      R QS    ++ A++I+  P+
Sbjct: 105 D-KGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVLSPA 159

Query: 208 LMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLL 267
            +++DH HFQYN  +  + + +I       Y   +  + +++CFK + LY AP +F +LL
Sbjct: 160 FLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFLL 219

Query: 268 S--------------KSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQS 313
                          K L F  +     L  + ++ I  F   + P       +++L Q 
Sbjct: 220 RAYCLNFQDFKFKSYKDLIF--IVKWRHLFQLGSIVIGVFALCFGPF------VKDLPQV 271

Query: 314 VHRIFPFARGIFEDKVA-NFWCVTNILIK 341
           + R+FPF+RG+     A NFW + + L K
Sbjct: 272 LTRLFPFSRGLTHAYWAPNFWALYSFLDK 300

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 127/274 (46%), Gaps = 40/274 (14%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  ++L +      PK   + + 
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQF----VPK--IVKED 108

Query: 150 RGIEMEGIKSY-------MRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAI 202
             +++  I  +        R TV+ SE + +    ++ +      + +S    ++ A++I
Sbjct: 109 GALDIVEIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSI 164

Query: 203 LFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIF 262
           +  P  ++IDH HFQYN  +    + +I       Y   +  + +++CFK + LY AP +
Sbjct: 165 VLSPGFLMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCY 224

Query: 263 FGYLLS--------------KSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLE 308
           F +LL               K L F  +     L  +A+V +  F   + P       L 
Sbjct: 225 FVFLLRAYVLNFKNFEFKSYKDLIF--IVQWKHLFKMASVVLGIFFICFGPF------LY 276

Query: 309 NLIQSVHRIFPFARGIFEDKVA-NFWCVTNILIK 341
           +L Q + R+FPF+RG+     A NFW + + L K
Sbjct: 277 DLPQVMTRLFPFSRGLTHAYWAPNFWAIYSFLDK 310

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  102 bits (254), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 135/293 (46%), Gaps = 36/293 (12%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  + +  WY+     W LDYPP  AY  + +    S + P +   +  
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFI----SHLVPSFVRRDGC 119

Query: 150 RGIEMEG-----IKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILF 204
             I   G        + R TV+ SE++ +    IY +    + R QS    +I A++I+ 
Sbjct: 120 LDIVEVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVL 175

Query: 205 QPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFG 264
            P  +++DH HFQYN  +  + V +I    +  Y + ++ + +++CFK + LY AP +F 
Sbjct: 176 SPGFLIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFV 235

Query: 265 YLLS--------------KSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENL 310
           +LL               K L F  L     L  +  + +  F   + P +IF     ++
Sbjct: 236 FLLRVYVLNFENFKFRSYKDLIF--LIRWKNLCQLGMIVVGVFSLCFGP-FIF-----DM 287

Query: 311 IQSVHRIFPFARGIFEDKVA-NFWCVTNILIKYKIKFTQDQLQLYSLAATVLG 362
            Q + R+FPF+RG+     A NFW + + L K    F      +++ AA  + 
Sbjct: 288 PQLLSRLFPFSRGLTHAYWAPNFWALYSFLDKVLTVFALRLHYVHNFAAKFIA 340

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  101 bits (252), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 128/272 (47%), Gaps = 36/272 (13%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LP+ +WY      W LDYPP  AY  + L +      PK   + D 
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQF----VPK--IVRDD 101

Query: 150 RGIEMEGIKSY-------MRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAI 202
             +++  + ++        R TV++SE + +    I+ +K     ++      +I A++I
Sbjct: 102 GCLDIVEVGNFGMPTIIFQRITVIVSEVLLFVVLQIFINKSATNEKS----ANFIVASSI 157

Query: 203 LFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIF 262
           +  P  +++DH HFQYN  +  + + AI       Y +    F  ++CFK + LY AP F
Sbjct: 158 VLSPGFLIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSF 217

Query: 263 FGYLLSKSLF---------FPRLFNI---PRLVGIAAVTIVTFVAMYSPLYIFGGGLENL 310
           F +LL   +          +  L +I    R + +  V +  F   ++P       +  +
Sbjct: 218 FVFLLRAYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPF------ISEM 271

Query: 311 IQSVHRIFPFARGIFEDKVA-NFWCVTNILIK 341
            Q + R+FPF+RG+     A NFW + ++L K
Sbjct: 272 PQLLERLFPFSRGLTHAYWAPNFWALYSLLDK 303

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score =  101 bits (251), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 128/272 (47%), Gaps = 36/272 (13%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  ++L +      P     +  
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQF----VPAAVRADGC 108

Query: 150 RGIEMEGIKS-----YMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILF 204
             I  +G+       + R TV+ SE + +    +Y +      + QS    ++ A++I+ 
Sbjct: 109 LDIVPQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVL 164

Query: 205 QPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFG 264
            P L+++DH HFQYN  +  + + +I       + + +  +  ++CFK + LY AP +F 
Sbjct: 165 SPMLLIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFM 224

Query: 265 YLLS--------------KSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENL 310
           +LL               K LF  R+ +  RL  +  V +   V  ++P         ++
Sbjct: 225 FLLRTYVLQFEGFRFKSYKDLF--RIIHWGRLFKLGGVVLGVAVVCFAPF------ARDM 276

Query: 311 IQSVHRIFPFARGIFEDKVA-NFWCVTNILIK 341
            Q + R+FPF+RG+     A NFW + ++  K
Sbjct: 277 PQLLSRLFPFSRGLTHAYWAPNFWALYSLCDK 308

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 118/271 (43%), Gaps = 46/271 (16%)

Query: 90  DFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDS 149
           D E  R+W+ +T  LP+  WY      W LDYPP  AY  ++L +      P     +  
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQF----VPAVVRDDGC 148

Query: 150 RGIEMEG-----IKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILF 204
             I  EG        ++R TV+ +E + +    ++ +      R  +    +I A++I  
Sbjct: 149 LDIVKEGKFGWPTVVFLRLTVIGTEILLFVVLQVFINTSDESERTVN----FIIASSIAL 204

Query: 205 QPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFG 264
            P  +++DH HFQYN  +  + + +I     + Y +    F   +CFK + LY AP +F 
Sbjct: 205 SPGFLIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFT 264

Query: 265 YLL---------------SKSLFFPRLFNIPRL----VGIAAVTIVTFVAMYSPLYIFGG 305
           +LL                  +F  R FN+ +L    V I AV  V F+ +         
Sbjct: 265 FLLRAYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPV--------- 315

Query: 306 GLENLIQSVHRIFPFARGIFEDKVA-NFWCV 335
               L Q + R+FPF+RG+     A NFW V
Sbjct: 316 ----LPQLISRLFPFSRGLTHAYWAPNFWAV 342

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.144    0.474 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,046,393
Number of extensions: 2375076
Number of successful extensions: 6292
Number of sequences better than 10.0: 44
Number of HSP's gapped: 6334
Number of HSP's successfully gapped: 46
Length of query: 564
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 449
Effective length of database: 40,294,809
Effective search space: 18092369241
Effective search space used: 18092369241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)