Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A050606.15ON26926913550.0
NDAI0I022506.15ON2712298531e-115
SAKL0E01056g6.15ON2692148341e-112
NCAS0D026606.15ON2612368291e-111
KNAG0F028806.15ON2692408231e-110
Kwal_56.223996.15ON2742198221e-110
KLTH0C11352g6.15ON2682148181e-110
KLLA0D01023g6.15ON2682198151e-109
Suva_15.1796.15ON2592188131e-109
ZYRO0C07920g6.15ON2932168131e-109
CAGL0E02673g6.15ON2632648041e-108
Kpol_1045.746.15ON2572147961e-106
Skud_15.1656.15ON2572327931e-106
Smik_15.1736.15ON2512297841e-105
YOR004W (UTP23)6.15ON2542107781e-104
ACR011C6.15ON2532147741e-103
TDEL0G045406.15ON2452357491e-100
TPHA0J002806.15ON2712177414e-98
Ecym_30196.15ON2662157127e-94
TBLA0A072906.15ON2592136153e-79
KLTH0E02860g5.392ON1891461777e-15
Kwal_55.200895.392ON1891461761e-14
Kpol_1055.185.392ON1891461732e-14
ZYRO0A06754g5.392ON1891461715e-14
NDAI0C045505.392ON1891461707e-14
AEL102W5.392ON1891461681e-13
NCAS0F030905.392ON1891461681e-13
TPHA0D023105.392ON1891461681e-13
TDEL0E023305.392ON1891461672e-13
CAGL0M01056g5.392ON1891461672e-13
Ecym_74695.392ON1891461653e-13
SAKL0G07766g5.392ON1891461645e-13
Smik_4.5995.392ON1891461636e-13
YDR339C (FCF1)5.392ON1891461636e-13
Skud_4.6065.392ON1891461636e-13
Suva_2.5095.392ON1891461636e-13
KNAG0C052705.392ON1891461637e-13
KAFR0D042805.392ON1891461627e-13
TBLA0H017505.392ON1891461592e-12
KLLA0A07018g5.392ON1891431512e-11
Suva_16.2048.594ON15163638.6
Ecym_32647.285ON31156658.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A05060
         (269 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   526   0.0  
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   333   e-115
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   325   e-112
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   323   e-111
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   321   e-110
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   321   e-110
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   319   e-110
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   318   e-109
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   317   e-109
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   317   e-109
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   314   e-108
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   311   e-106
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   310   e-106
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   306   e-105
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   304   e-104
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   302   e-103
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   293   e-100
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   290   4e-98
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   278   7e-94
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   241   3e-79
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    73   7e-15
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    72   1e-14
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    71   2e-14
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    70   5e-14
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    70   7e-14
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    69   1e-13
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    69   1e-13
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    69   1e-13
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    69   2e-13
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    69   2e-13
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    68   3e-13
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    68   5e-13
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    67   6e-13
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    67   6e-13
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    67   6e-13
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    67   6e-13
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    67   7e-13
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    67   7e-13
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    66   2e-12
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    63   2e-11
Suva_16.204 Chr16 (357733..358188) [456 bp, 151 aa] {ON} YPL108W...    29   8.6  
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...    30   8.7  

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/269 (95%), Positives = 257/269 (95%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKKVKTLNEPKQTDKNDDVQEETTEXXXX 240
           LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKKVKTLNEPKQTDKNDDVQEETTE    
Sbjct: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKKVKTLNEPKQTDKNDDVQEETTEKKKR 240

Query: 241 XXXXXXXXDTGINEDTNINDEKEYEQESN 269
                   DTGINEDTNINDEKEYEQESN
Sbjct: 241 RRKHRPKKDTGINEDTNINDEKEYEQESN 269

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  333 bits (853), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 158/229 (68%), Positives = 189/229 (82%), Gaps = 2/229 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVY+HTFKFR PYQVLVDN+IV   SNSN+DL KGLK TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCCMQALYE  +Q+AI++A+ FERRRCNH PKEPKT IEC+ SVVN+NG+NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           SQD+  RR+LR+VPGVPL+HISR+VMIMEPLSD SA++S R E EKLYKGLNDPK+ G+K
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 181 --LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKKVKTLNEPKQTDKN 227
             +D+E   E + + ++  K+K GPKGPNPLS++KK    N   +  KN
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNENIKN 229

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  325 bits (834), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 182/214 (85%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+HTFKFREPYQVLVD++IV  +  S+FDL KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCCMQALY T+DQ AI+MAK +ERRRCNHPPKE KT +EC+ SVVN NGKNKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           +QDIDIRR+LRRVPGVPL++++RSVM+MEPLS+ S ++S   E+EKL+KGLNDPK+AGL 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKK 214
            DE          ++ +KKK GPK PNPLSV++K
Sbjct: 181 HDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRK 214

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  323 bits (829), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/236 (67%), Positives = 190/236 (80%), Gaps = 5/236 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQ+LVDN+IVT  S SN+DL KGL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCCMQALYE  DQNAI++A+ FERRRCNH PK+PKTPIEC+ SVVN+NG+NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           +QD+ IRR+LR+VPGVPLVHISR+VMIMEPLSD SAK+S R E EKLYKGLNDPKY G+K
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKKVKTLNEPKQTDKNDDVQEETTE 236
              E+         K +K     K PNPLS++KK +   EPK+  ++    +E++E
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGP--KSPNPLSMKKKKQ---EPKRNREDSTEDQESSE 231

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  321 bits (823), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 192/240 (80%), Gaps = 4/240 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQV++D+EIV  ++ S FDL K L+RT+QAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCCMQALY T ++ AIDMAK +ERRRCNHPPK+PK+P EC+ SVV++ G+NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
            Q+ID+RR+LRRVPGVPL+H+SR+VMIMEPLSD SA+IS RMEQ+KL+ GLND K AG+K
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 181 LDEEEATETQGSGEKTAKKKR---GPKGPNPLSVRKKVKTLN-EPKQTDKNDDVQEETTE 236
             E E  E +G     AK K+   GPK PNPLS++KK K  N E K      D ++++T+
Sbjct: 181 AAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKKKDGNSEQKNVGTKKDNEDDSTD 240

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  321 bits (822), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 182/219 (83%), Gaps = 5/219 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD++IV  +  + FDLVKGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCC+QA+YET DQ AI++AK FERRRCNHPPKE K P+EC+ SVVNVNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           +Q+ +IR  LR+VPGVPLV ++RSVM+MEPLS  S  +S   E+EKL+KGLNDPK+AGL 
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 181 LDEEEATETQGSGEK-----TAKKKRGPKGPNPLSVRKK 214
           L E+ AT T  + +K      AKK++GPKGPNPLS++KK
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKK 219

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  319 bits (818), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 149/214 (69%), Positives = 182/214 (85%), Gaps = 1/214 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD++IV  +  ++FDLVKGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCC+QA+YET++Q+AI++AK FERRRCNHPPKE K PIEC+ SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           SQD  IR++LR+VPGVPL++++RSVM+MEPLS  S   S   E+EKL+KGLNDPKYAGL 
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKK 214
             EEE  +T    E +  K++GPKGPNPLS++KK
Sbjct: 181 A-EEEGGKTDNGTEVSKNKRKGPKGPNPLSIKKK 213

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  318 bits (815), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 186/219 (84%), Gaps = 5/219 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+HTFKFR+PYQVLVD+++V  + NS+FD VKGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCCMQ+LY+T +Q AID  K FERRRCNH PKEPK+ +EC+ SVV+VNGKNKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           +QD++IRR+LR++PGVPLV+++RSVM+MEPLS+ S K+S  +E++KLYKGLNDPK+AG+ 
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 181 LDE--EEATETQGSGEKTAKKKRGPKGPNPLSVRKKVKT 217
            DE  E   E Q   E   KK++GPK PNPLS++KK  T
Sbjct: 181 RDENDEAGAENQ---ENKPKKRKGPKEPNPLSMKKKKTT 216

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  317 bits (813), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 154/218 (70%), Positives = 179/218 (82%), Gaps = 6/218 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDN++V+  S SNFDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCC+QALYETR++ AID+AK FERRRCNH  K+PK+P EC+ SVVNVNG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           SQDID+RR+LR VPGVPL+H++RSVMIMEPLS  SAK S   E++KLYKGLNDP      
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP-----N 175

Query: 181 LDEEEATETQGSGEKTAKKKR-GPKGPNPLSVRKKVKT 217
           +++ EA       E T KK++ GPK PNPLS++KK KT
Sbjct: 176 IEKAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKKKT 213

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  317 bits (813), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 146/216 (67%), Positives = 181/216 (83%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSY+KQ+LVY++ F+FREPYQVL+D+++V+    S++DLV GLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCCMQALY T++Q+AI++ K FERRRCNHPPKE K P EC+ SVVNVNG NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           SQD+ +RR+LR+VPGVPL+H+SRSVM+MEPLS+ S++++   E+EKL KGLNDPK AGLK
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKKVK 216
                  E +   +  AKK++GPKGPNPLSVRKK K
Sbjct: 181 TTPSVENELESESQPPAKKRKGPKGPNPLSVRKKQK 216

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  314 bits (804), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 163/264 (61%), Positives = 201/264 (76%), Gaps = 6/264 (2%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVY+HTFKFREPYQVL+D++IV  S+ S +DLVK LKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCCMQALYET++++AID+ K FERRRC H P E  +P EC+L+VV+V GKNKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
            QD++IRR LR+VPGVPL+HISRSVMIMEPLSD SAK+S   E+ KL++GLNDPKYAGLK
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

Query: 181 LDEEEATETQGSGEKTAKKKR--GPKGPNPLSV-RKKVKTLNEPKQTDKNDDVQEETTEX 237
            + EE  +   S E+T  KKR  GPK PNPLS+ +KK +   + +QT+ + D  + T   
Sbjct: 181 GEHEEEEQ---SKEQTVAKKRKIGPKQPNPLSMKKKKKENTKKEQQTETSADQSQPTKRR 237

Query: 238 XXXXXXXXXXXDTGINEDTNINDE 261
                       T  NE+ N+++E
Sbjct: 238 RSRKHKHGSKNSTDTNENGNLSEE 261

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  311 bits (796), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 141/214 (65%), Positives = 183/214 (85%), Gaps = 3/214 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQ+RAKSYRKQ+LVY+HTFKFREPYQ +VD+++V     S FD++KGLKRTLQAEVK M
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCCMQALY+T +Q AI +AK FERRRCNHPPK+PK+P+EC+ S+V++ G NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           SQD+DIRR+LR++PGVP+VH+SR+VMI+EPLSD S KIS R+E++KLYKGLND K+    
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTA-G 179

Query: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKK 214
           LDE ++ +++ + E  +KK +GPK PNPLS++K+
Sbjct: 180 LDEPKSEKSEKTSE--SKKNKGPKQPNPLSMKKR 211

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  310 bits (793), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 188/232 (81%), Gaps = 9/232 (3%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDN++V+  S SNF+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCC+QALYETR++ AID+AK FERRRCNH  K+PK+P EC+ SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           SQDI +RR+LR VPGVPL+H++RSVMIMEPLS  SAK S + E++KL+KGLNDP    ++
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP---NVE 177

Query: 181 LDEEEATETQGSGEKTAKKKR--GPKGPNPLSVRKKVKTLNEPKQTDKNDDV 230
             E+ ++E   SG+++A KKR  GPK PNPLSV+KK KT     +T   DD 
Sbjct: 178 KTEKVSSE---SGKESAPKKRKIGPKAPNPLSVKKK-KTSQPSNETKGEDDA 225

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  306 bits (784), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 148/229 (64%), Positives = 178/229 (77%), Gaps = 4/229 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDN++V   + SNF+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCC+QALYETR++ AID+AK FERRRCNH  K+PK+P +C+ SVV++NG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           SQDI +RR+LR VPGVPL+H++RSVM+MEPLS  SAK S   E+ KLYKGLNDP    + 
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKV- 179

Query: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKKVKTLNEPKQTDKNDD 229
              +E +E  G    T K+K GPK PNPLSV+KK K  +   +    +D
Sbjct: 180 ---QEISEGSGKESVTKKRKFGPKAPNPLSVKKKKKAYSTSDEARGKED 225

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  304 bits (778), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 171/210 (81%), Gaps = 4/210 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDN++V   +NSNF+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCC+QALYETR+  AI++AK FERRRCNH  K+PK+P EC+ SVVN++G NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           SQDID+RR+LR VPGVPL+H++RSVM+MEPLS  SAK S   E++KLYKGLNDP    L 
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKL- 179

Query: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLS 210
              +E+ +  G    T K+K GPK PNPLS
Sbjct: 180 ---QESGDGSGKESITKKRKLGPKAPNPLS 206

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  302 bits (774), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 177/214 (82%), Gaps = 2/214 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVY+HTFKFREPYQVLVD++IV  ++ S+FDL+KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCCMQ LY+T++Q+AI   K +ERRRCNH  KEPK PIEC+ SVV VNG+N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           SQDI IRR LR+VPGVPLV+I+R+VM+MEPLS TS ++S   E++KL+KGLNDPKY G+ 
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKK 214
            +   A      G  T K+K GPK PNPLS++K+
Sbjct: 180 ENSAPAGAQPAEGAPTLKRK-GPKAPNPLSMKKR 212

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  293 bits (749), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 160/235 (68%), Positives = 181/235 (77%), Gaps = 12/235 (5%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAK+YRKQ+LVY+HTFKFREPYQVLVDN+IV     SNFDLVKGL+RTLQAEVK M
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCCMQALYET  Q AI++AK FERRRCNHPPKEPK PIEC+ S+V VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           SQDID RR LRR PGVPLVH  RSVM+MEPLSD SAK+SS  E EKL+KGLNDP+ AG+K
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRK-KVKTLNEPKQTDKNDDVQEET 234
            +  +          T+ KKR  K PNPLSV+K K ++  EPK     + V   T
Sbjct: 181 TENPQ----------TSIKKRT-KQPNPLSVKKRKTESKGEPKAAQDTEPVASNT 224

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  290 bits (741), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 134/217 (61%), Positives = 177/217 (81%), Gaps = 1/217 (0%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAE-VKP 59
           MRQKRAKSY+KQ++VY+HTFKFREPYQ+LVD +IV  S  SN++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVV 119
           MITQCCMQ LY T +Q  ID AK FERRRCNH  K+PK P+EC+ S+VN++G+NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ASQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGL 179
           A+Q++++RR+LRRVPGVP++H+SRSVMIMEP+SD+S +++ + EQ KLYKGLNDPKY+  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 KLDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKKVK 216
              +E   +T+G+     KK++G K PNPLS +KKVK
Sbjct: 181 PTPKEGTPDTEGTQPAATKKRKGVKEPNPLSKKKKVK 217

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  278 bits (712), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 178/215 (82%), Gaps = 3/215 (1%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVY+HTFKFR+PYQVLVD+++V  ++ S+FDL+KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120
           ITQCC+Q LYE+++Q AI  AK +ERRRCNH  KEPK P EC+ SVV++NG+N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180
           +QDI+IRR LRRVPGVPL++++RSVM+MEPLS  S ++S ++E EKL KGLNDPKYAG  
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 181 LDEEEATETQGS--GEKTAKKKRGPKGPNPLSVRK 213
            + E+A+    S    +  +K +GPK PNPLS++K
Sbjct: 180 NNTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKK 214

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  241 bits (615), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 115/213 (53%), Positives = 157/213 (73%), Gaps = 14/213 (6%)

Query: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAE--VK 58
           MRQKRAKSY+KQL+VY+HTFKFREPYQV++D+ +V  +  + ++L+KGL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  PMITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYV 118
           PMITQCC+ ALY++ DQ +I + K FERRRCNH  KEP +P EC+LS+V+VNGKNKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VASQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAG 178
           VA+QD+++RR+LR++PGVPL+H  RSVM+MEPLSD S + +  +E +KL  GLN  K   
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK--- 177

Query: 179 LKLDEEEATETQGSGEKTAKKKRGPKGPNPLSV 211
                      +G G++   KK+  KG NPLS+
Sbjct: 178 --------ASVEG-GQENGIKKKKVKGVNPLSM 201

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 72.8 bits (177), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D+V+G+  TL A+  PMIT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H         +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R+VPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 72.4 bits (176), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     DLV+G+  TL A+  P+IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H         +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R+VPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 71.2 bits (173), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 78/146 (53%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D++KG+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H   +     +C+     VN   +H+ Y+VA+ D+ +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDVGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R+VPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 70.5 bits (171), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    R PYQVL+D   +  S     D+VKG+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C H   +     +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCTH---KGTYADDCL-----VNRVMQHKCYIVATNDAPLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDA 188

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 70.1 bits (170), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     DLV+G+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H   +     +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     DLV+G+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H   +     +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R+VPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     DLVKG+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H         +C+     VN   +H+ ++VA+ D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCFIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L +      R PYQVL+D   +  S     D++KG+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H         +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDQGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     DLV+G+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C H         +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +      +E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPDA 188

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D+VKG+   L A+  P+IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C H         +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D+V+G+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H         +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCSH---RGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R+VPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKLPDV 188

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 67.8 bits (164), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D+V+G+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H   +     +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R+VPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.4 bits (163), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D+V+G+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H   +     +C++  V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCLVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 67.4 bits (163), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D+V+G+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H         +C++  V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCLVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.4 bits (163), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D+V+G+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H   +     +C++  V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCLVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.4 bits (163), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D+V+G+   L A+  P+IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H         +C++  V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCLVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 67.4 bits (163), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D+V+G+   L A+  P+IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H         +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D+V+G+   L A+  P+IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H   +     +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 76/146 (52%), Gaps = 13/146 (8%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D+V+G+   L A+  P+IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H         +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCSH---RGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPLSDT 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKLPDV 188

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 74/143 (51%), Gaps = 13/143 (9%)

Query: 14  LVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCMQALYET- 72
           L + +    + PYQVL+D   +  S     D+VKG+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 73  -RDQNAIDMAKG--FERRRCNHPPKEPKTPIECVLSVVNVNGKNKHR-YVVASQDIDIRR 128
            + + A+ +A+    +R  C+H         +C++  V      +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCIVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 129 QLRRVPGVPLVHISRSVMIMEPL 151
           ++R+VPG+PL+ +     ++E L
Sbjct: 163 RVRKVPGIPLMSVGGHSYVIEKL 185

>Suva_16.204 Chr16 (357733..358188) [456 bp, 151 aa] {ON} YPL108W
           (REAL)
          Length = 151

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 7   KSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPMITQCCM 66
           K  R+ L  + H F ++  Y+  +D     +     F++   +KR L+ E+K MI QC  
Sbjct: 90  KHQRQVLSGFCHRFYYQRKYEQCLDLSSYLLGLFEPFNVKNKMKRELE-ELKYMIEQCRK 148

Query: 67  QAL 69
           Q L
Sbjct: 149 QVL 151

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 41  SNFDLVKGLKRTLQAEVKPMITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEP 96
           SNF  ++ L+R   AE+KP + +    A  + +  N  + AK  +   C + P  P
Sbjct: 157 SNFR-IEDLERLKDAEIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFP 211

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,679,928
Number of extensions: 1241205
Number of successful extensions: 4189
Number of sequences better than 10.0: 103
Number of HSP's gapped: 4325
Number of HSP's successfully gapped: 103
Length of query: 269
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 161
Effective length of database: 41,097,471
Effective search space: 6616692831
Effective search space used: 6616692831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)