Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A050506.18ON94894848240.0
TDEL0G045106.18ON96994627150.0
NDAI0I022606.18ON96795926670.0
NCAS0D026506.18ON95094426410.0
KNAG0F028706.18ON95494626300.0
ZYRO0C07854g6.18ON94494325900.0
Suva_15.1806.18ON94894825870.0
YOR005C (DNL4)6.18ON94494525330.0
Smik_15.1746.18ON94594625120.0
Skud_15.1666.18ON94794924630.0
CAGL0E02695g6.18ON94694024380.0
Kpol_1032.76.18ON96594724360.0
TPHA0M002606.18ON96695923660.0
TBLA0G010406.18ON97295223290.0
Kwal_56.224146.18ON96394422410.0
KLTH0C11286g6.18ON95194521530.0
KLLA0D01089g6.18ON90794420400.0
ACR008W6.18ON98196220060.0
SAKL0F10912g7.343ON6934182674e-23
Kwal_56.246167.343ON7154552523e-21
KLLA0D12496g7.343ON7004532513e-21
NDAI0A019407.343ON7652952442e-20
TBLA0E020507.343ON7203802408e-20
ACL155W7.343ON6973802399e-20
CAGL0I03410g7.343ON7244142391e-19
ZYRO0F11572g7.343ON7314192353e-19
TDEL0C020407.343ON7054112344e-19
Kpol_2001.717.343ON7264352282e-18
KLTH0H01408g7.343ON7234022238e-18
YDL164C (CDC9)7.343ON7552522221e-17
Suva_4.827.343ON7552562211e-17
TPHA0D045707.343ON7363982193e-17
Smik_4.747.343ON8452532184e-17
Skud_4.937.343ON7552522174e-17
NCAS0A141107.343ON7532562158e-17
KNAG0C037407.343ON7272412077e-16
KAFR0B008307.343ON7103811952e-14
TPHA0C018608.469ON607109910.036
KAFR0C051907.46ON89694890.071
CAGL0E05588g7.46ON88790830.39
AFR095C1.276ON670100791.00
SAKL0H03322g4.237ON1111124753.6
NDAI0C009105.555ON36256734.0
TPHA0C040502.497ON1473120744.0
KNAG0E004107.46ON817117744.7
ZYRO0D04664g7.46ON817108735.4
Suva_6.1691.271ON148476736.3
Kwal_23.44912.29ON74392719.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A05050
         (948 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...  1862   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...  1050   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...  1031   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...  1021   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...  1017   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...  1002   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...  1001   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   980   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   972   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   953   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   943   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   942   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   915   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   901   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   867   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   833   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   790   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   777   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   107   4e-23
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   101   3e-21
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   101   3e-21
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...    99   2e-20
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...    97   8e-20
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...    97   9e-20
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...    97   1e-19
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    95   3e-19
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...    95   4e-19
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...    92   2e-18
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...    91   8e-18
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...    90   1e-17
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...    90   1e-17
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...    89   3e-17
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...    89   4e-17
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...    88   4e-17
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    87   8e-17
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    84   7e-16
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    80   2e-14
TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.4...    40   0.036
KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7...    39   0.071
CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} simila...    37   0.39 
AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON} S...    35   1.00 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    33   3.6  
NDAI0C00910 Chr3 complement(175497..176585) [1089 bp, 362 aa] {O...    33   4.0  
TPHA0C04050 Chr3 (867505..871926) [4422 bp, 1473 aa] {ON} Anc_2....    33   4.0  
KNAG0E00410 Chr5 complement(65732..68185) [2454 bp, 817 aa] {ON}...    33   4.7  
ZYRO0D04664g Chr4 (387336..389789) [2454 bp, 817 aa] {ON} simila...    33   5.4  
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    33   6.3  
Kwal_23.4491 s23 (743016..745247) [2232 bp, 743 aa] {ON} YNL216W...    32   9.9  

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 1862 bits (4824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 911/948 (96%), Positives = 911/948 (96%)

Query: 1   MDLTVPEVEVPRNFAPSPQFKWLCEELFSKLEEVPNQRHLTTKRITLRYYEIITNFVNLW 60
           MDLTVPEVEVPRNFAPSPQFKWLCEELFSKLEEVPNQRHLTTKRITLRYYEIITNFVNLW
Sbjct: 1   MDLTVPEVEVPRNFAPSPQFKWLCEELFSKLEEVPNQRHLTTKRITLRYYEIITNFVNLW 60

Query: 61  RTTVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADR 120
           RTTVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADR
Sbjct: 61  RTTVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADR 120

Query: 121 SVKLSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYC 180
           SVKLSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYC
Sbjct: 121 SVKLSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYC 180

Query: 181 IEKMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIR 240
           IEKMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIR
Sbjct: 181 IEKMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIR 240

Query: 241 LRHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIK 300
           LRHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIK
Sbjct: 241 LRHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIK 300

Query: 301 FLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSA 360
           FLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSA
Sbjct: 301 FLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSA 360

Query: 361 AMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNF 420
           AMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNF
Sbjct: 361 AMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNF 420

Query: 421 TRCSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLI 480
           TRCSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLI
Sbjct: 421 TRCSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLI 480

Query: 481 VIGRDSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFC 540
           VIGRDSAKKDSFYCGLT               GVVNLVSDESDYENPENNRHIKKVVSFC
Sbjct: 481 VIGRDSAKKDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFC 540

Query: 541 MIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARS 600
           MIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARS
Sbjct: 541 MIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARS 600

Query: 601 LDNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTXXX 660
           LDNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDT   
Sbjct: 601 LDNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLK 660

Query: 661 XXXXXXXXXXXXXXXXXXXRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLE 720
                              RDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLE
Sbjct: 661 SKKRRKKQLLTPLNQNLNPRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLE 720

Query: 721 NGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEP 780
           NGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEP
Sbjct: 721 NGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEP 780

Query: 781 SHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFEK 840
           SHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFEK
Sbjct: 781 SHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFEK 840

Query: 841 VPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRES 900
           VPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRES
Sbjct: 841 VPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRES 900

Query: 901 MKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDYVPM 948
           MKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDYVPM
Sbjct: 901 MKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDYVPM 948

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/946 (53%), Positives = 675/946 (71%), Gaps = 9/946 (0%)

Query: 9   EVPRNFAPSPQFKWLCEELFSKLEEVPNQ--RHLTTKRITLRYYEIITNFVNLWRTTVGD 66
           + P NFAPSP F WLCEELF KLE+V  Q   HL  K +++RYYE+I++F+ LWR TVG+
Sbjct: 25  KAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFIRLWRKTVGN 84

Query: 67  DIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSV 126
           +I+PAL+L+LPYRDRR+YN+KDYTL+KAIC+YL LPK S TEKRLL WK+RA R V+LS 
Sbjct: 85  NIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRRATRGVRLSN 144

Query: 127 SCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSF 186
            CV E+RKRKSEP     IT+D+LN  LD L ++RN KG G+K LS+S  F +C++ MSF
Sbjct: 145 FCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLSDSPTFNFCLQNMSF 203

Query: 187 MELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDEL 246
           +ELR+FFDI+LK RVIG  EHKLLN WHPDA DYLSVVSDL+TV +RLW+P  RLR D+L
Sbjct: 204 IELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWDPEHRLRRDDL 263

Query: 247 SINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRG 306
           SIN+GYAF P LAKK++ISY+KIC KL NDF IEEKMDGERIQ+HYMDYG  I+FLSRRG
Sbjct: 264 SINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRG 323

Query: 307 VDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALT 366
           VDYT LYGENL +GT+A YL  + +V++CVLDGEM+T+D D++++LPFGMVKS+A  AL+
Sbjct: 324 VDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALS 383

Query: 367 KEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNE 426
            E I  Q + P+LMV DLV+LNG SL++ PLYQRK++L  VL+P    V+I+ + RCS  
Sbjct: 384 TEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEH 443

Query: 427 NIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDS 486
             IRKSLE +IS+GSEGIVLK+Y +RY IG+RND WIK+KPEYLEQFGEN+DL++IGR  
Sbjct: 444 TAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTP 503

Query: 487 AKKDSFYCGLT--XXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFCMIAN 544
            KKDS  CGL                   +VNL S+  + ++ +  + IK  +SFC+IAN
Sbjct: 504 GKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIAN 563

Query: 545 GISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNT 604
           GISQ E+KEI RKTRG W K+++  P  +L+ FG+++P EWI+P++S++LE+KARSLDNT
Sbjct: 564 GISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDNT 623

Query: 605 ESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTXXXXXXX 664
           ESS K+F AGCTL+GGYCRRIRDD DW   +S +EL ++R  K   G    +        
Sbjct: 624 ESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSSTGVGSFNKQYSKKMK 683

Query: 665 XXXXXXXXXXXXXXXR-DIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGG 723
                          + D+  ++ IF GL FY+LSDY D + NVRI+K +   L+L+N G
Sbjct: 684 SKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRITKSEFDDLILQNSG 743

Query: 724 KISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHC 783
           K+  N++SK  S+S  RI+ GKYTAEC  LI+RGYDILSPQW++DC+ N+ +VK+EP HC
Sbjct: 744 KLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDCIRNRMVVKLEPRHC 803

Query: 784 FSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSS-KDISPDLLSPANMSLDFEKVP 842
           F+VS +LM +   RVD+YGDS+ + ++  +L  ++ ++ K   P+L+  AN  LD   VP
Sbjct: 804 FNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNMKQTEPNLMREANSELDV--VP 861

Query: 843 YFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRESMK 902
            FLF  R  ++    F+         K +L+GG +  +I  CN++I P     +  +S+ 
Sbjct: 862 LFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLIIMPNENQRLGTQSLV 921

Query: 903 FIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDYVPM 948
            +R ++ + +  +   P +P IV+ +W++ SIE+N QVPEED+ P+
Sbjct: 922 EMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDFTPV 967

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/959 (53%), Positives = 689/959 (71%), Gaps = 35/959 (3%)

Query: 10  VPRNFAPSPQFKWLCEELFSKLEEVPNQRHLTTKR-------ITLRYYEIITNFVNLWRT 62
            P NFAPSP F+WLC+ELF KLE +  Q+  T+K        I ++YYE+I +F+NLWR 
Sbjct: 18  TPHNFAPSPSFRWLCDELFVKLERI--QQASTSKASKEFQKPINVQYYEVIQHFINLWRK 75

Query: 63  TVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSV 122
           TVG+DIYPALIL LPYRDRR+YNV+DYTLIKAIC+YLKLPKNSFTEKRLL+WKQRA RSV
Sbjct: 76  TVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSV 135

Query: 123 KLSVSCVNEMRKRKSEPV--EKSPITLDELNTLLDFLSQDRNIKGR-GYKNLSESSIFTY 179
           +LS   V+E++KRKSEP    +  IT+D+LN  LD LS++RN KG  GY+ LS+S  F +
Sbjct: 136 RLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVF 195

Query: 180 CIEKMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNI 239
           C+E M+F+EL++FFDIILK+RVIG HEHK LN WHPDA+DYLSVVSDLKTV  +LW+P +
Sbjct: 196 CLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAV 255

Query: 240 RLRHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDI 299
            L++D+L+IN+G  FAP  AKKLSISY+KIC KLK+DFFIEEKMDGERIQ+HY DYGN +
Sbjct: 256 HLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKL 315

Query: 300 KFLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKS 359
            FLSRRG DYTYLYGE++  GT++ YL L+ +V+ CVLDGEMVT+D++++ LLPFG+VKS
Sbjct: 316 SFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKS 375

Query: 360 AAMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVN 419
           +A + +T+E ++ + Y PLLMVFDLV+LNG SLV  PLYQRK YL  +  P R  V+++ 
Sbjct: 376 SARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLR 435

Query: 420 FTRCSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDL 479
             RCS+E  I+ +LEHAIS+GSEG+VLK+YNSRY + SRND WIK+KPEYLEQFGENMDL
Sbjct: 436 SKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDL 495

Query: 480 IVIGRDSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDES--DYENPENN-----RH 532
           IVIG+D  KKDS  CGL                 +VNL S +S  + E+ E N     + 
Sbjct: 496 IVIGKDPGKKDSLMCGLAVVEEDEPEIDEDGNE-IVNLDSQDSIGEGEDKEGNEIEREKT 554

Query: 533 IKKVVSFCMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSV 592
           IK+ VSFC IANGISQ E+K I R T+G WKK++E+PPP +L+EFG++VP EWI+P+ S+
Sbjct: 555 IKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSI 614

Query: 593 VLEIKARSLDNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGT 652
           V+E+KARSL+N E + K+FK G TLYGGYCR+IR+D DWK+ ++L+ELRR +R K     
Sbjct: 615 VIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNK 674

Query: 653 SEKDTXXXXXXXXXXXXXXXXXXXXXXRDIQT-----TSKIFDGLFFYILSDYFDTNENV 707
              +                          QT      S+IFDGL+FY++SD  D   + 
Sbjct: 675 RANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVVDATGS- 733

Query: 708 RISKDDLQKLLLENGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVI 767
           R+S+++L   +L  GG I HN+++K   ++  RILCGKYTAEC  LI RGYDI+ PQWV+
Sbjct: 734 RVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVL 793

Query: 768 DCVENKKIVKIEPSHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPD 827
           DC+++  ++K+EP +CF+VS++LM +A RRVD +GDS+E+ +S    S ++   +++   
Sbjct: 794 DCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLI--ERNVRSL 851

Query: 828 LLSPANMSLDF-EKVPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNI 886
             +P ++  D  + VP FLF+ R   ++    DK+   +  ++I+LYGGK   +++ CN+
Sbjct: 852 RNAPPSIQYDMVDTVPLFLFYGRT--ILLRIKDKALFTKLKVQIRLYGGKTTGDLASCNL 909

Query: 887 VIFPKAEITVIRESMKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945
           V+  + EI V ++    +R++L K  S + + P+LP IV+ EWID+SI +  QVPEED+
Sbjct: 910 VVIQQNEIAVAKD----VRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDH 964

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 1021 bits (2641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/944 (52%), Positives = 670/944 (70%), Gaps = 12/944 (1%)

Query: 6   PEVEVPRNFAPSPQFKWLCEELFSKLEEVPNQRHLTT--KRITLRYYEIITNFVNLWRTT 63
           P V  P NF+PSP F+WLC+ELF KLE++ ++R      K +T+RYYE+I +F+ LWR T
Sbjct: 12  PPVMTPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKT 71

Query: 64  VGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVK 123
           VG+DI+PALIL LPYRDRR++N++DYTLIKAIC YLKLP+NSFTEKRLL+WK RA + VK
Sbjct: 72  VGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVK 131

Query: 124 LSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEK 183
           LS  CVNE++KRKSEP +K  IT+D LN  LD L+++RN KGRG+K L++S  F +C+E 
Sbjct: 132 LSQFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLEN 191

Query: 184 MSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRH 243
           MSF+EL++FFDI+LK RVIG  EHK LNAWHPDA+DYLSVVSDL+TV TRLW+P IRL++
Sbjct: 192 MSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQN 251

Query: 244 DELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLS 303
           ++L IN G+AFAP LAKKLSISY+KIC KLKNDF IEEKMDGERIQ+HY DYG  +KF S
Sbjct: 252 NDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFS 311

Query: 304 RRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMN 363
           RRG DYTYLYGE++  G I  +LKLN+DVK+C+LDGEM+TYD+ Q+++LPFG+VKS+A +
Sbjct: 312 RRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARS 371

Query: 364 ALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRC 423
            LTK+ I  + Y PL MVFDL+F+NG+SL   PL  RK+YL  +  P    +++++    
Sbjct: 372 MLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHR 431

Query: 424 SNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIG 483
            NE+ IRKSLE AIS+GSEGIVLK Y+SRY + SRND WIK+KPEYLEQFGENMDLIVIG
Sbjct: 432 FNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 491

Query: 484 RDSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFCMIA 543
           RD  KKDS  CGL                  V ++ D+ D    E  R I K VSFC+IA
Sbjct: 492 RDPGKKDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAP-VEQERTIHKFVSFCVIA 550

Query: 544 NGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDN 603
           NG+SQ E+K+I RKTRG W +++E+PPP  L++FGT++P+EWI+P+ SVV+E+KARS+D 
Sbjct: 551 NGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDA 610

Query: 604 TESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTXXXXXX 663
            ES+ ++F  GCTLYGGYCR IR+D DW++ ++L+E  R + +K     S++        
Sbjct: 611 AESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIHGVKRQ 670

Query: 664 XXXXXXXXXXXXXXXXRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGG 723
                             +   +  F  L+FY++SD FD     RI K+ + K + E GG
Sbjct: 671 KKNRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGG 730

Query: 724 KISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHC 783
            + HNI+SK+    NLRI+ GK T EC+ LI+RGYD+++PQW++DCV++K ++K+EP +C
Sbjct: 731 TLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYC 790

Query: 784 FSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDI--SPDLLSPANMSLDFEKV 841
           F+VS +L  L  +RVD +GDSYE  ++  +LS +L +  ++     L++P     +  K+
Sbjct: 791 FNVSTELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRVQGLVTPY-ADEELIKI 849

Query: 842 PYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRESM 901
           P FLF  R   ++  N +  +I     KI+LYGGK+  +I +CN++I P     +++ + 
Sbjct: 850 PLFLFQDR--IMLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGNQQLLQRT- 906

Query: 902 KFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945
              R+ L K +  S E+P +P IV+  WI+ SIE+N QVPEEDY
Sbjct: 907 ---RDLLTKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDY 947

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 1017 bits (2630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/946 (52%), Positives = 670/946 (70%), Gaps = 11/946 (1%)

Query: 9   EVPRNFAPSPQFKWLCEELFSKLEEVPNQ-RHLTTKRITLRYYEIITNFVNLWRTTVGDD 67
           E P NFAPSP F+WLC+ELF K + V  Q R +  K IT+RYYE+++NFV LWR TVG++
Sbjct: 7   EGPTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNN 66

Query: 68  IYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVS 127
            YP LILALPYRDRR YN+KD TLIKAIC YL LPK S TEK+LLNWKQRA R+ +LS  
Sbjct: 67  FYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSF 126

Query: 128 CVNEMRKRKS--EPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMS 185
           CV E+RKRKS  +P ++  ITLD+LN++LD L+  ++ +G+G + L++SS F +C+E MS
Sbjct: 127 CVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMS 186

Query: 186 FMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDE 245
           F+EL+YFFDI+LK R+IG HEHKLLNAWHPDA DY SVVSDL +V  +L+ P++RLR+++
Sbjct: 187 FIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNED 246

Query: 246 LSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRR 305
           L++ IG AFAPHLAK+L+ISY+KI KKL +DF IEEKMDGERIQIHYMDYGN+IKFLSRR
Sbjct: 247 LTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRR 306

Query: 306 GVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNAL 365
           G DYTYLYG + STGTIACYLKLN +VKEC+LDGEMVTYD+++ ++LPFG+VKS+A N L
Sbjct: 307 GTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFL 366

Query: 366 TKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSN 425
           +KE IS   YHPL M FDLV+LNG+SLV+ PLYQRKDYL+ +L      V IV+F RC+N
Sbjct: 367 SKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNN 426

Query: 426 ENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRD 485
              I KSL  AISVGSEGI+LK  NSRYM+ SRNDSWIKIKP+YL+QFGENMDLI+IGRD
Sbjct: 427 LESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRD 486

Query: 486 SAKKDSFYCGLTXXXXXXXXXXXXXXXGV-VNLVSDESDYENPENNRHIKKVVSFCMIAN 544
             KKD+F C L                 V ++L +++S+ E P+ +R I K VSFC IAN
Sbjct: 487 PGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASR-IVKFVSFCTIAN 545

Query: 545 GISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNT 604
           GIS  E+KEI +KTRG W++ ++V PP E ++FGT+ P+EWI+P+ S+VLE+K+RSLDNT
Sbjct: 546 GISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNT 605

Query: 605 ESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTXXXXXXX 664
           ES+ K+++AG TL+GGYCR +R D DW + ++++E  RDR+ K  P  +  ++       
Sbjct: 606 ESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYK-LPKVNAGESITTSNKG 664

Query: 665 XXXXXXXXXXXXXXXRDIQTT----SKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLE 720
                          R  +T     S IF  L F +LSDY D     RI ++ L +L+++
Sbjct: 665 RKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIID 724

Query: 721 NGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEP 780
            GGK+ +N+++K   +  LRI+C  +  ECN LIKRGYDILSP WV+DC+E+ +++K+E 
Sbjct: 725 YGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLER 784

Query: 781 SHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSS-KDISPDLLSPANMSLDFE 839
           +HCF+VS +LM L+  RVD+Y DS+E+ +S +RL  ++     ++     S  N+  +  
Sbjct: 785 NHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELR 844

Query: 840 KVPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRE 899
            +P  LF+ R  F+ E         +   + +L+GG+V   I +CN++I P  +     +
Sbjct: 845 GLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDEDKIQ 904

Query: 900 SMKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945
            ++ IR  LA  +        +P IVS EW+  SI++N+QVPEE+Y
Sbjct: 905 VLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENY 950

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/943 (52%), Positives = 667/943 (70%), Gaps = 14/943 (1%)

Query: 11  PRNFAPSPQFKWLCEELFSKLEEVPNQR--HLTTKRITLRYYEIITNFVNLWRTTVGDDI 68
           P NFAPSP FKWLC+ELF K++ V  Q   H   K +T++Y+EII+ FV LWR TVGD+I
Sbjct: 11  PHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGDNI 70

Query: 69  YPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSC 128
           YPALIL LPYRDRR++N+KDYTLIKAIC++L+LP NS TEKRLL WK+RA R +KLS  C
Sbjct: 71  YPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSDFC 130

Query: 129 VNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSFME 188
           V E+R+R+SEP+    IT+D+LN  LD L+++RN KGRG+K+L++SS+F YC+E MSF E
Sbjct: 131 VEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMSFTE 190

Query: 189 LRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSI 248
           ++Y+FDIILK+RVIG  EHK LN WHPDA DYLSVVSDLKTV  +LW+P+ RL++D+L +
Sbjct: 191 MKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDLGV 250

Query: 249 NIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVD 308
           N+G  FAP LAK+L ISYDK+  +LK+DF+IEEKMDGERIQ+HYMDYG  +K+ SRRG D
Sbjct: 251 NLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGND 310

Query: 309 YTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKE 368
           YTYLYGE++ TGT+A YL+L+  V+ECVLDGEM+++D +++ +LPFG+VKS+A ++LT E
Sbjct: 311 YTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAE 370

Query: 369 EISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENI 428
            I  Q Y PL MV D ++LNG SL+  PL  RK YL+++L P    V+I+    C ++  
Sbjct: 371 GILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTS 430

Query: 429 IRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSAK 488
           I+ SLE AI +GSEGI+LK++ S+Y IG+R D+WIKIKPEYLEQFGEN+DL+VIGRD  K
Sbjct: 431 IKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGK 490

Query: 489 KDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFCMIANGISQ 548
           KDS  CGL                 VVNL S+E +    E  + +KK +SFC IANGISQ
Sbjct: 491 KDSLMCGLAVLEGDEEPGAQSDKQ-VVNLDSEEEE----EPRKAVKKFISFCTIANGISQ 545

Query: 549 NEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNTESSC 608
            E+K+I RKT G WK TE+   PP+++EFG+++P EWI PE SVVLE+KARSLDNTESS 
Sbjct: 546 EEFKQIERKTAGKWKNTED-HKPPKILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESSG 604

Query: 609 KRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTXXXXXXXXXXX 668
           ++FK GCTL+GGYCRRIR+D +W   ++L EL ++RR K  P + + +            
Sbjct: 605 RKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERR-KKVPLSEDSNNQKPMKSKKIRR 663

Query: 669 XXXXXXXXXXXR--DIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKIS 726
                         D   TS IFDGL FY++SDY  + ++ RISK+ L  L+  NGGK++
Sbjct: 664 PRIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKLT 723

Query: 727 HNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHCFSV 786
            N++S    K  LRI+ GKYT EC  LI+RGYDILSPQW++DCV    +V IEP HCFSV
Sbjct: 724 FNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHCFSV 783

Query: 787 SDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPA-NMSLDFEKVPYFL 845
           S+D+  +A  RVD +GDSY+  ++  RL  IL +SK+   D  + + ++  D E +P FL
Sbjct: 784 SEDMEKIARTRVDHFGDSYDVEITEDRLRDIL-TSKEFDSDFSTGSLDVISDVEDIPLFL 842

Query: 846 FWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRESMKFIR 905
           F RR  F+ E  F     +    K++LYGG++  N+++CN++I P  +I +    +  +R
Sbjct: 843 FSRRIVFIPE-GFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGRIISDLR 901

Query: 906 NTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDYVPM 948
             L+   + +   P +P IV   WID SIE+N+QVPEED++ +
Sbjct: 902 RLLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDFLAV 944

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 1001 bits (2587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/948 (52%), Positives = 673/948 (70%), Gaps = 17/948 (1%)

Query: 4   TVPEVEVPRNFAPSPQFKWLCEELFSKLEEV-PNQRHLTTKRITLRYYEIITNFVNLWRT 62
            +PE   P NFAPSP F+WLCEELF+K+EEV  N    T K ++ RYYEII+NF  LWR 
Sbjct: 7   AIPE---PHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRK 63

Query: 63  TVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSV 122
           TVG++IYPALILALPYRDRR+YN+KDY LI+ +C+YLKLPKNS TE+RL +WKQR  +  
Sbjct: 64  TVGNNIYPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGR 123

Query: 123 KLSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIE 182
            LS   V E+ KR++EP  KS IT+D +N  LD LS++ N  GRG+KNL +S  F +C+E
Sbjct: 124 SLSSLLVEEISKRRTEPTRKS-ITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLE 182

Query: 183 KMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLR 242
            M+F+EL++FFDI+LK RVIG  EHKLLN WHPDA+DYLSVVSDL+ V ++L++P+IRL+
Sbjct: 183 NMTFVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLK 242

Query: 243 HDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFL 302
           +D+LSI +G+AFAP LAKK+++SY+KIC  L+NDFF+EEKMDGERIQ+HYM+YG  IKF 
Sbjct: 243 NDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFF 302

Query: 303 SRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAM 362
           SRRG+DYTYLYG NL +GTI+ YLK +  VKECVLDGEMVT+D  + ++LPFG+VK +A 
Sbjct: 303 SRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAK 362

Query: 363 NALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTR 422
            AL+  +I+  D+HPL MVFDL++LNG+SL   PLYQRK+YL+S+L P ++ V+IV ++R
Sbjct: 363 EALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSR 422

Query: 423 CSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482
           C +   ++KSLE AIS+GSEG+VLK+Y+S Y + SRN++WIK+KPEYLE+FGEN+DLI+I
Sbjct: 423 CYDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIII 482

Query: 483 GRDSAKKDSFYCGLTXXXXXXXXXXXXXXXG-VVNLVSDESDYENPENNRHIKKVVSFCM 541
           GRDS KKDSF  GL                  ++N  S E    NP+  + ++KV+SFC 
Sbjct: 483 GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPK--KRVRKVLSFCS 540

Query: 542 IANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSL 601
           IANGISQ E+KEI RKTRG WKKT  + PPP ++EFG+++P EWIEP  S+VLEIK+RSL
Sbjct: 541 IANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSL 600

Query: 602 DNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTXXXX 661
           DNTE++ +++   CTLYGGYCRRIR D DW   ++L EL  +RR K  P + + +     
Sbjct: 601 DNTETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNP-SHQVENLQLQ 659

Query: 662 XXXXXXXXXXXXXXXXXXRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLEN 721
                             R+ +  S +F GLFFY+LSDY ++   VRI++ +L  +++++
Sbjct: 660 LVPKKRKRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKH 719

Query: 722 GGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPS 781
           GGK+ HN++ KR    ++R++  K T EC  LI RGYDIL P+W++DC    K++ IEPS
Sbjct: 720 GGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPS 779

Query: 782 HCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSP--ANMSLDFE 839
           +CFSVS  L A+A RRVD +GDS+E+ +S S+LS + +S     PDLLS   A+ S + +
Sbjct: 780 YCFSVSGKLRAVARRRVDCFGDSFENDISESKLSSLQKS----QPDLLSTRQADKSFELQ 835

Query: 840 KVPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRE 899
            +P FLF  R  ++              +KI+L+GGK+    S  N++I P A+     +
Sbjct: 836 IIPLFLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGD 895

Query: 900 SMKFIRNTLAKTV--STSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945
            ++ + + + + V  S S  +P +PRIV+ EW+D SI +N QVPEED+
Sbjct: 896 CLEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDF 943

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/945 (50%), Positives = 657/945 (69%), Gaps = 15/945 (1%)

Query: 4   TVPEVEVPRNFAPSPQFKWLCEELFSKLEEVP-NQRHLTTKRITLRYYEIITNFVNLWRT 62
           ++PE   P+NFAPSP FKWLCEELF K+ EV  N    T K  + +YYEII+NFV +WR 
Sbjct: 7   SIPE---PQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRK 63

Query: 63  TVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSV 122
           TVG++IYPAL+LALPYRDRR+YN+KDY LI+ IC+YLKLPKNS TE+RL +WKQR  +  
Sbjct: 64  TVGNNIYPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGG 123

Query: 123 KLSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIE 182
            LS   V E+ KR++EP  K+ IT+D +N  LD LS DR   GRG+K+L +S  F +C+E
Sbjct: 124 NLSSLLVEEIAKRRAEPSSKA-ITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVE 182

Query: 183 KMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLR 242
            MSF+EL+YFFDI+LK RVIG  EHKLLN WHPDA+DYLSV+SDLK V ++L++P +RL+
Sbjct: 183 NMSFVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLK 242

Query: 243 HDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFL 302
            D+LSI +G+AFAP LAKK+++SY+KIC+ L +DF +EEKMDGERIQ+HYM+YG  IKF 
Sbjct: 243 DDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFF 302

Query: 303 SRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAM 362
           SRRG+DYTYLYG +LS+GTI+ +L+    VKECVLDGEMVT+D  + ++LPFG+VK +A 
Sbjct: 303 SRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAK 362

Query: 363 NALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTR 422
            AL+   I+  D+HPL MVFDL++LNG+SL   PL+QRK YL S+L P +  V+IV  +R
Sbjct: 363 EALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSR 422

Query: 423 CSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482
           C     I+KSLE AIS+GSEG+VLK YNS Y + SRN++WIK+KPEYLE+FGEN+DLIVI
Sbjct: 423 CYGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVI 482

Query: 483 GRDSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFCMI 542
           GRDS KKDSF  GL                 +V+  S E   +N  + R +KK++SFC I
Sbjct: 483 GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQN--SRRRVKKILSFCSI 540

Query: 543 ANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLD 602
           ANGISQ E+KEI RKTRG WK+T EV PP  ++EFG+++P EWI+P  S+VLEIK+RSLD
Sbjct: 541 ANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLD 600

Query: 603 NTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTXXXXX 662
           NTE++ +++   CTLYGGYC+RIR D +W   ++L +L   R +K  P + + +      
Sbjct: 601 NTETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNP-SYQAERSQLGL 659

Query: 663 XXXXXXXXXXXXXXXXXRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENG 722
                            R     S IF GL FY+LSDY   +  +RI++ +L+K ++E+G
Sbjct: 660 IRKKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHG 719

Query: 723 GKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSH 782
           GK+ +N++ KR S  ++R++  K T EC  LI RGYDIL P WV+DC+  K+++ IEP++
Sbjct: 720 GKLIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNY 779

Query: 783 CFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFEKVP 842
           CF+VS  + A+A +RVD  GDS+E+ +S ++LS + +S   + P  +    +  +  + P
Sbjct: 780 CFNVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPP--MGELEIDSEVRRFP 837

Query: 843 YFLFWRRKAFVMEHNFDKSSIRETI--LKIQLYGGKVVKNISECNIVIFPKAEITVIRES 900
            FLF  R A+V      K S  + I  +KI+L+GGK+    S CN++I P  +  + ++ 
Sbjct: 838 LFLFSNRIAYVPRR---KISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDC 894

Query: 901 MKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945
           M  +   + + +  S  +P + R+V+ EW+D SI +N QVPEED+
Sbjct: 895 MNEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDF 939

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/946 (50%), Positives = 657/946 (69%), Gaps = 16/946 (1%)

Query: 4   TVPEVEVPRNFAPSPQFKWLCEELFSKLEEVPNQRHLTT-KRITLRYYEIITNFVNLWRT 62
           +VPE   P+NFAPSP FKWLCEELFSK++EV  +  + T K  + +YYE+++NFV +WR 
Sbjct: 7   SVPE---PQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRK 63

Query: 63  TVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSV 122
           TVG++IYPALILALPYRDRR+YN+KDY LI+ IC+YLKLPKNS TE RL +WKQR  +  
Sbjct: 64  TVGNNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGK 123

Query: 123 KLSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIE 182
            LS   V E+ KR+SEP  K+ IT+D +N+ LD LS+DR+  GRG+KNL +SS F +C+E
Sbjct: 124 NLSSLLVEEIAKRRSEPNGKA-ITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLE 182

Query: 183 KMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLR 242
            MSF+EL+YFFDI+LK+RVIG  EHK L+ WHPDA+DYLSVVSDLK V ++L++P +RL+
Sbjct: 183 SMSFVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLK 242

Query: 243 HDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFL 302
           +D+L+I +G+AFAP LAKK+++ Y+KIC+ L NDF +EEKMDGERIQ+HYM+YG  ++F 
Sbjct: 243 NDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFY 302

Query: 303 SRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAM 362
           SRRG+DYTYLYG +LS+GTI+ +L    +V+ECVLDGEMVT+D  + ++LPFG+VK +A 
Sbjct: 303 SRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAK 362

Query: 363 NALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTR 422
           +AL+   I+  D+HPL +VFDL++LNG+SL   PL+QRK+YL S+L P +  V++V  +R
Sbjct: 363 DALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSR 422

Query: 423 CSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482
           C N   I+KSLE AIS+GSEG+VLK YNS Y + SRN++WIK+KPEYLE+FGEN+DL++I
Sbjct: 423 CYNVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVII 482

Query: 483 GRDSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENP-ENNRHIKKVVSFCM 541
           GRD  KKDSF  GL                 V + +++ S  EN   + + +KK++SFC 
Sbjct: 483 GRDPGKKDSFMLGLLLLNEKEMDKRDQE---VSSGIANNSKNENILYSQKKVKKILSFCS 539

Query: 542 IANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSL 601
           +ANGISQ E+KEI RKTRG WKKT EV PP  + EFG+++P EWIEP  S+VLEIK+RSL
Sbjct: 540 VANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSL 599

Query: 602 DNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTXXXX 661
           DNTE++ +++   CTLYGGYC+RIR D DW   F+L EL   R  +  P    + +    
Sbjct: 600 DNTETNMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKL 659

Query: 662 XXXXXXXXXXXXXXXXXXRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLEN 721
                               I  TS IF GL+FY+LSDY      VRI++ +L+  ++ +
Sbjct: 660 VRKKRREVLTSNTFDQKTEQI-PTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRH 718

Query: 722 GGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPS 781
           GG++ +NI+ KR    ++R++  K T EC  LI RGYDIL P WVIDCV  KK++ IEP 
Sbjct: 719 GGRLIYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPC 778

Query: 782 HCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFE-- 839
           +CF+VS  + A+A +RVD  GDS+E+ +S ++LS + +S  ++ P    P  +  D E  
Sbjct: 779 YCFNVSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPP----PEEVERDAEVQ 834

Query: 840 KVPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRE 899
             P FLF  R  ++          +   +KI+L+GGK+    S CN+VI P  + T  ++
Sbjct: 835 VFPLFLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKD 894

Query: 900 SMKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945
            +K +   + + V     +P +PRIV+ EW+D SI  N QVPEED+
Sbjct: 895 CIKEVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDF 940

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/949 (50%), Positives = 655/949 (69%), Gaps = 23/949 (2%)

Query: 5   VPEVEVPRNFAPSPQFKWLCEELFSKLEEVP-NQRHLTTKRITLRYYEIITNFVNLWRTT 63
           +PE   P+NFAPSP FKWLCEELF +++ V  N    T K  + +YYEII+NFV  WR  
Sbjct: 8   IPE---PQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKG 64

Query: 64  VGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVK 123
           VG++IYPAL+LALPYRDRR+YN+KDY LI+ IC+YLKLP+NS TE+RL +WKQR  R+  
Sbjct: 65  VGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARN 124

Query: 124 LSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEK 183
           LS   V E+ KR+ EP  KS IT+D +N  LD LS++R+I GRG+K+L  S  F  C+E 
Sbjct: 125 LSSLLVEEIAKRRPEPNGKS-ITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLES 183

Query: 184 MSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRH 243
           MSF+EL+YFFDI+LK RVIG  EH+ LN WHPDA+DYLSVVSDLK V ++L++P +RL++
Sbjct: 184 MSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKN 243

Query: 244 DELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLS 303
           D+LSI +G+AFAP LAKK+S+ Y+KIC+ L NDF IEEKMDGERIQ+HYM+YG  IKF S
Sbjct: 244 DDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFS 303

Query: 304 RRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMN 363
           RRG+DYTYLYG +LS+GTI+ YLKL   VKECVLDGEMVT+D  + ++LPFG+VK +A  
Sbjct: 304 RRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKG 363

Query: 364 ALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRC 423
            L+  +I+  D+ PL MVFDL++LN  SL   PL+QRK YL+S+L P++  V+IV  TRC
Sbjct: 364 VLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRC 423

Query: 424 SNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIG 483
            +   ++ SLE AIS+GSEG+VLK YNS Y I SRN +WIK+KPEYLE+FGEN+DLI+IG
Sbjct: 424 YDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIG 483

Query: 484 RDSAKKDSFYCGLTXXXXXXXXXXXXXXXG--VVNLVSDESDYENPENNRHIKKVVSFCM 541
           RDS KKDSF  GL                   VVN    E D  N  + + +KKV+SFC 
Sbjct: 484 RDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVIN--SKKKVKKVLSFCS 541

Query: 542 IANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSL 601
           +ANGIS  E+KEI R+TRG WK+T +   PP +++FG+++P EWIEP  S+VLEIK+RSL
Sbjct: 542 VANGISHEEFKEINRRTRGHWKRTSDF-SPPSILQFGSRIPAEWIEPSDSIVLEIKSRSL 600

Query: 602 DNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTXXXX 661
           DNTE+S +R+   CTLYGGYCRRIR D DW   ++LA+L  DR IK  P   +++     
Sbjct: 601 DNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDEN-FQLQ 659

Query: 662 XXXXXXXXXXXXXXXXXXRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLEN 721
                             R+ +  S IF GLFFY+LSDY   +  VRI++  L+  ++++
Sbjct: 660 LAHKKRKRALISDPFHQIREQKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLEDAIVKH 719

Query: 722 GGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPS 781
           GGK+ HN++ KR    ++R++  K T EC +LI RGYDI+ P WV+DC+  K+++ IEPS
Sbjct: 720 GGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLIFIEPS 779

Query: 782 HCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFEK- 840
           +CFSVS  L  +A +RVD  GDS+E+ +S  +LS + +S +D+S    S   + +D E  
Sbjct: 780 YCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLS----SIGEIGIDSEAQ 835

Query: 841 -VPYFLFWRRKAFVMEHNFDKSSIRETIL---KIQLYGGKVVKNISECNIVIFPKAEITV 896
            +P FLF  R  ++      K+ +RE  L   KI+L+GG++    S CN++I P  + + 
Sbjct: 836 VIPLFLFSNRIVYIPR---TKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSR 892

Query: 897 IRESMKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945
            ++ ++ +   + + +  S  +P + RIVS  W+D SI +N QVPEED+
Sbjct: 893 RKDCIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDF 941

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  943 bits (2438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/940 (50%), Positives = 651/940 (69%), Gaps = 27/940 (2%)

Query: 13  NFAPSPQFKWLCEELFSKLEEVPNQR--HLTTKRITLRYYEIITNFVNLWRTTVGDDIYP 70
           NFAPSP F WLCE+LF+K++ V  +R  +L TK +T RYYE+I+NF  LWRTTVG++IYP
Sbjct: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83

Query: 71  ALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSCVN 130
           AL L LPYRDRR++N+KDYTLIKAIC +LKLPK+S TEK+L+NWKQ A RSV+LS  CV 
Sbjct: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143

Query: 131 EMRKRKSEPV--EKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSFME 188
           E++KR+SEP       IT+D+LN  LD L+ +R  +GR +KNL+ S I   C+  M+F+E
Sbjct: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203

Query: 189 LRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSI 248
           ++YFFDI+LK R +G HEHKLLN WHPDA+DYLSVVSDL+TV  RLW+P+ RL + +L I
Sbjct: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263

Query: 249 NIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVD 308
           NIG AFAP LA KL +SY KI +KL  DFFIEEKMDGERIQ+HY ++G+DIKF SRR  D
Sbjct: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323

Query: 309 YTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKE 368
           YTYLYG NL TGT+A ++ LN++VK+CVLD E+VT+D +  I+LPFGMVKS+A N L+++
Sbjct: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383

Query: 369 EISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENI 428
            I  Q +HPLLMVFD+++LNG++LV+ P Y+R++YL  +L P   R++I+   R ++E +
Sbjct: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443

Query: 429 IRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSAK 488
           I+KSLE A+SVGSEGI+LK Y+SRY+I SR+D WIKIKPEYLEQFGENMDL+++GRD +K
Sbjct: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503

Query: 489 KDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFCMIANGISQ 548
           KDS   GL                 +VN  S E      EN++  +  VS C+IANGIS 
Sbjct: 504 KDSLMLGLLDYEEVIQDSPI-----MVNSQSSE------ENSQRFRGFVSLCIIANGISN 552

Query: 549 NEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNTESSC 608
            EYKEI RKT+G W  +E++ PP E ++FG++VP +WI+P+ S++LEIKARSLDNT SS 
Sbjct: 553 EEYKEIDRKTKGLWNDSEKI-PPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSE 611

Query: 609 KRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHY-PGTSEKDTXXXXXXXXXX 667
           ++F AGCTL+GGYCR+IR+D +WK+ ++L E  R +   ++    S K            
Sbjct: 612 RKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKPQKVISKKRRYN 671

Query: 668 XXXXXXXXXXXXRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKISH 727
                        +++  S IFDG++FY+LSDYFD  +  RI K ++QK+++ NGG++  
Sbjct: 672 IISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQ 731

Query: 728 NIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHCFSVS 787
           N++++  + ++LRI+  + T ECN LI RGYDI+SP+WV DC+ + KI+K+EPSHCF+ S
Sbjct: 732 NVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFS 791

Query: 788 DDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLD--FEKVPYFL 845
             LM  A +R+D+YGD YE    +++  +   +S+ I        ++  D     VP+FL
Sbjct: 792 KQLMDYAYKRIDQYGDPYER--DINKYEWSSLTSEKICTTAKQQPDVQFDNSLMDVPHFL 849

Query: 846 FWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRESMKFIR 905
           F  R  F++    D ++I++    +  YGGKV   +S  N+VI   A   V +  +  IR
Sbjct: 850 FHGRIVFLLS---DNNNIQKESFMVDAYGGKVTNELSSANLVIVVGA---VTQRRINDIR 903

Query: 906 NTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945
             ++  V      P +P +VS  W+   I++N QV E++Y
Sbjct: 904 KQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  942 bits (2436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/947 (50%), Positives = 637/947 (67%), Gaps = 19/947 (2%)

Query: 7   EVEVPRNFAPSPQFKWLCEELFSKLEEV---PNQRHLTTKRITLRYYEIITNFVNLWRTT 63
           ++E P NF+PSP FKWLC+ELF KL+++   P + +  +K   + YY+II NF+++WR T
Sbjct: 27  DIEEPHNFSPSPDFKWLCDELFVKLDQIQFRPKELN-GSKPKYIEYYDIINNFIDIWRRT 85

Query: 64  VGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVK 123
           VG+DIYPALIL +PYRDRRMYN+K+  LI+ +C YLKLPKNS TE+RL+ WK RADR+V+
Sbjct: 86  VGNDIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVR 145

Query: 124 LSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEK 183
           LS  CV E++KRK EP EK  IT+D+LN  LD L  +R  KG   + +SES  F +C E 
Sbjct: 146 LSTFCVEEIKKRKGEPREKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFEN 205

Query: 184 MSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRH 243
           M+++EL+YFFDI+LK +++G  EHK LN WHPDA+DYLSVVSDLK V ++LWNP  RL++
Sbjct: 206 MTYVELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKY 265

Query: 244 DELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLS 303
           D+L+INI +AF P  AK+L+ SYD I ++LKNDFFIEEKMDGERIQ+HYM+YG  +KFLS
Sbjct: 266 DDLTINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLS 325

Query: 304 RRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMN 363
           RRG+DY+YLYG+N + G I  YL  ++DVKEC+LDGEMVTYD  ++ +LPFG+VKS+AM 
Sbjct: 326 RRGLDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQ 385

Query: 364 ALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRC 423
           +L+  +I    YHPL M FDLV+LNGSSL   PL+QRK+YL  +L P    V+I+    C
Sbjct: 386 SLSVSDIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHC 445

Query: 424 SNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIG 483
           ++ ++I+ SLE AI +GSEGI+LK ++S+Y++  R+D WIKIKPEYLEQFGENMDLIVIG
Sbjct: 446 NDSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIG 505

Query: 484 RDSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFCMIA 543
           RD  KKDS  CGL                 + +L S+ +D          +K++SFC IA
Sbjct: 506 RDPGKKDSLMCGLILTGDNEPEE-------ITSLDSNPTDTAESFLKPDKRKIISFCNIA 558

Query: 544 NGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDN 603
           NGISQ E+++I R T G W K ++  PP +L EFGT+ P+EWI PEHSVVLEIKARSL+ 
Sbjct: 559 NGISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLET 618

Query: 604 TESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIK----HYPGTSEKDTXX 659
            ES+  ++  G TL+GGYCR+IR D DW S F+  E    R +K    +YP    K+   
Sbjct: 619 NESARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYP--DNKNLIG 676

Query: 660 XXXXXXXXXXXXXXXXXXXXRDIQTTSK-IFDGLFFYILSDYFDTNENVRISKDDLQKLL 718
                               +D    S  IF GL FY++SDY D  +  R+SK DL  L+
Sbjct: 677 RKKRPKKRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLV 736

Query: 719 LENGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKI 778
           LE+ GK+ HN +S+ +  + LRI+  KYT E   LI+RGYDI+ PQW++DC+ N+K+V++
Sbjct: 737 LEHNGKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRL 796

Query: 779 EPSHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDF 838
            PSHCF+VS  LM +   RVD+YGDSYE+ L+      ++      S           + 
Sbjct: 797 LPSHCFNVSSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKSESADKRITEGENH 856

Query: 839 EKVPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIR 898
            K+P  LF  R+ F+ E     + I E   K++LYGGK+V  IS+CN+++F        +
Sbjct: 857 LKIPILLFCNRRFFIPE-TLPSTPIYELKSKVELYGGKLVNKISDCNVIVFTNTHTENRK 915

Query: 899 ESMKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945
           E MK IR  L      S+++P+LPRIV   WIDA I + VQVPEEDY
Sbjct: 916 EVMKKIRRALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDY 962

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/959 (48%), Positives = 632/959 (65%), Gaps = 17/959 (1%)

Query: 1   MDLTVPEVEVPRNFAPSPQFKWLCEELFSKLEEVP-NQRHLTTKRITLRYYEIITNFVNL 59
           M++   E E PRNF+PSP FKWLC ELF KL+EV    + + T+   ++Y  +I NF++L
Sbjct: 7   MNIDTSERE-PRNFSPSPDFKWLCNELFVKLDEVRLKPKSVDTRPKNIQYDIVINNFIHL 65

Query: 60  WRTTVGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRAD 119
           WR TVG+DIYPAL L LPYRDRR Y ++++TLI+ +C YLKL KNS TE+RL  WKQ+A 
Sbjct: 66  WRVTVGNDIYPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKAR 125

Query: 120 RSVKLSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRN----IKGRGYKNLSESS 175
           RS+ LS  C+ E++KR SEPV K  IT+D+LN++LD LS +R+      G   K LS+  
Sbjct: 126 RSINLSSFCIQEIKKRLSEPVSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLE 185

Query: 176 IFTYCIEKMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLW 235
              YC E MSF+EL YFFDI++KAR+IG  EHK LNAWHPDA DYLSVVS+L  V  +LW
Sbjct: 186 SIKYCFENMSFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLW 245

Query: 236 NPNIRLRHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDY 295
           NPN RL   +L+I +  AF P LAKK+++SY+ + +++ N F IEEKMDGERIQIHYMDY
Sbjct: 246 NPNFRLNSKDLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDY 305

Query: 296 GNDIKFLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFG 355
           G+ IK+ SRRG DYTYLYG++ ST TI+ YL+LN DVKEC+LDGEMV+YD+ ++ +LPFG
Sbjct: 306 GHQIKYFSRRGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFG 365

Query: 356 MVKSAAMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARV 415
           MVKS A N+L  + +      PL +VFD++FLNGS L   PLYQRK+YL+++L P ++ +
Sbjct: 366 MVKSGAANSLKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHI 425

Query: 416 QIVNFTRCSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGE 475
           +I+ F+   +   IR +L+ AISVGSEGIVLK Y+S Y +G RN+ WIK+KPEYLEQFGE
Sbjct: 426 EILKFSIAHDSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGE 485

Query: 476 NMDLIVIGRDSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYEN------PEN 529
           N+DLIVIGRD  KKDS  CG+                 V+ L SD+ D +N      P  
Sbjct: 486 NLDLIVIGRDPGKKDSLMCGVAVLENEESYEKILQEE-VITLTSDDDDSQNNIPEDKPIR 544

Query: 530 NRHIKKVVSFCMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPE 589
            + I K +SFC+IANGIS  E+KEI RKT G WKK  +  PP + +EFGT++P+EWI P 
Sbjct: 545 TKRITKFISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPH 604

Query: 590 HSVVLEIKARSLDNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHY 649
            SVVLE+KARSL+N E+   +FK G TLYG YCRRIR D D+   ++ ++L      K  
Sbjct: 605 DSVVLEVKARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKKRS 664

Query: 650 PGTSEKDTXXXXXXXXXXXXXXXXXXXXXXRDIQT--TSKIFDGLFFYILSDYFDTNENV 707
                 +                       +D  T  TSKIFDGL F+++SDY D+N + 
Sbjct: 665 SSELYGNHSHIKKKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSF 724

Query: 708 RISKDDLQKLLLENGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVI 767
           R+  D+L  ++  NGG++  N+VS+  ++  +RI+  K T ECN LIKRGYDI+ P+W++
Sbjct: 725 RLRIDELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWIL 784

Query: 768 DCVENKKIVKIEPSHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPD 827
           DC+ N K++  EPSHCF+VS  L  ++ +RVD  GDSY+  ++   L  +L SSK     
Sbjct: 785 DCIANDKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELE-LLISSKTPKEQ 843

Query: 828 LLS-PANMSLDFEKVPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNI 886
           L S P       EK+P FLF  +KA+  +  F +  ++ET L I+LYGG  V NI++CN+
Sbjct: 844 LYSNPLQFDQQIEKIPIFLFSNKKAYTPKQCFSEKLLKETNLYIKLYGGTSVNNINDCNV 903

Query: 887 VIFPKAEITVIRESMKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945
           +I          E +  IR  L+    +S  +  +PRIVS++WI+ SI +  QV EED+
Sbjct: 904 IIIGDEHSKSSNEKISSIRKELSIHAVSSNNVIPIPRIVSYKWIEKSIAQGTQVVEEDF 962

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/952 (46%), Positives = 643/952 (67%), Gaps = 20/952 (2%)

Query: 10  VPRNFAPSPQFKWLCEELFSKLEEVPNQ------RHLTTKRITLRYYEIITNFVNLWRTT 63
            P+NFAPSP FKWLC+ELF K++++  Q        ++ K I+ RY++ IT+F+ LWRTT
Sbjct: 22  TPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTT 81

Query: 64  VGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVK 123
           +GDDI+PAL L LPYRDRR+YN+KD TLI+AIC+YLKLPKNS  E+RL+ WK +ADR   
Sbjct: 82  IGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYET 141

Query: 124 LSVSCVNEMRKRKSEP--VEKSPITLDELNTLLDFLSQDR-NIKGRGYKNLSESSIFTYC 180
           L+  C++E+ KRK+EP   +   I++D+LN +LD L  +R N   +   NL +   F +C
Sbjct: 142 LATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFC 201

Query: 181 IEKMSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIR 240
           +E M+F+EL+YFFDII+K +++G  E+  L  WHPD+++YLSVVSDL+T+  +LWNP+I+
Sbjct: 202 LENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIK 261

Query: 241 LRHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIK 300
           + + +LSI +GY FAP LAK+L +SYD I  +L NDFFIEEKMDGERIQ+HYM+YG  +K
Sbjct: 262 INNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVK 321

Query: 301 FLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSA 360
           F SR G DYTYLYG + S GTIA +L+L+++VKECVLDGEMVT+D     +LPFG+VKS+
Sbjct: 322 FFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSS 381

Query: 361 AMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNF 420
           A + L K++I    +HPL MVFD+++LNGSSL++ PL++RK++L +VL PY+  V+I++ 
Sbjct: 382 ASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSS 441

Query: 421 TRCSNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLI 480
            RC++   I+K L+ AISVGSEGIVLK Y S+Y+  +R+++WIK+KPEYLE+FGENMDLI
Sbjct: 442 IRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLI 501

Query: 481 VIGRDSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYE-NPENNRHIKKVVSF 539
           VIGRDS KKD   CG+                  + ++SD  D + + + ++ IKKV+SF
Sbjct: 502 VIGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIISDSGDDDLDTKPSQGIKKVISF 561

Query: 540 CMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKAR 599
           C IANG+SQNE KEI R TRG WK      PP +++EFGT+ P+EWI P+ SVVLEIKAR
Sbjct: 562 CTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIKAR 621

Query: 600 SLDNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTXX 659
           SLD T+ +  ++  GCTLYGGYCR+IR D DW S ++L +L  +   +H      K T  
Sbjct: 622 SLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEIKRHEKKNKNKQTLI 681

Query: 660 XXXXXXXXXXXXXXXXXXXXRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLL 719
                                D++  S +F GL+FYI+SDY   ++  RI ++D+  L++
Sbjct: 682 RSYSRKKSKIISPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDICSLII 741

Query: 720 ENGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIE 779
           +NGG++ +N+++K  + S LRIL  K T EC  L++RGYD+++  W+ DC++   I+ +E
Sbjct: 742 KNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVILPLE 801

Query: 780 PSHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSL--- 836
           P+HC  VS++L+A+A  R+DK+GDSYE+ L  S+L  +L S  +I+    S +N+ L   
Sbjct: 802 PAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDS--NINKVNRSNSNLLLINK 859

Query: 837 --DFEKVPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEI 894
               + +P FLF  RK F+++ +         I +I+LYGG +V  + +CNI++      
Sbjct: 860 DEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLVTKLEDCNIIVGVCGS- 918

Query: 895 TVIRESMKFIRNTLAKT-VSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945
            ++ + +  +R  L K  V  +   P +PR V+  WI  SI+   Q+  EDY
Sbjct: 919 QLVNKKLGDLRCKLVKQYVDANFPQP-IPRAVNVSWITESIKAGYQLSPEDY 969

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/944 (47%), Positives = 593/944 (62%), Gaps = 22/944 (2%)

Query: 11  PRNFAPSPQFKWLCEELFSKLEEVPNQRHLTTKRITLRYYEIITNFVNLWRTTVGDDIYP 70
           P+NFAPSP F+WLC+ELFSKLEE+   R    K +T++  E+I  F+ LWRTTVGD+IYP
Sbjct: 36  PQNFAPSPDFRWLCDELFSKLEEITEDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNIYP 95

Query: 71  ALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSCVN 130
            L L LPYRD R YN+KDYTL+KA+C  L LPK+S TEKRLLNWKQ A R   LS  CV 
Sbjct: 96  VLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFCVE 155

Query: 131 EMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSFMELR 190
           E+ KR+ EP     +T+D LN  LD LS++ + K  G+  LS+S  F  C++ MSF E R
Sbjct: 156 EIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSEQR 215

Query: 191 YFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSINI 250
           YFFDIILK RVIG  EHK LN WHPDA+DYL VVSDLK +   LWNP +RL  +ELSINI
Sbjct: 216 YFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELSINI 275

Query: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDYT 310
           G AFAPHLAK+L +SY+++C KLK DF IEEKMDGERIQ+HY++ G  I+FLSRRG D+T
Sbjct: 276 GRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFT 335

Query: 311 YLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNAL--TKE 368
           +LYG++L  G I+ +LK   DV++CVLDGEMV++D++++++LPFG+VKS AM  L  +  
Sbjct: 336 HLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDT 395

Query: 369 EISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENI 428
           ++    Y PL M+FDLV+LNG SL   PL+ RK YL S+L P    V+I++  R S  N 
Sbjct: 396 KVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRASEPNA 455

Query: 429 IRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSAK 488
           I+ SLE AI +GSEGI+LK ++S Y IG+RNDSWIKIKPEY E+ GE MDL+VIGRD  K
Sbjct: 456 IKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGRDPGK 515

Query: 489 KDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFCMIANGISQ 548
           KDS  CGL                  VNL S +      + N    KV+SFC IANG+S 
Sbjct: 516 KDSLMCGLILADETDGSS--------VNLASQDDPLRPKQRN---PKVISFCNIANGVSD 564

Query: 549 NEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNTESSC 608
            E+KEI RKTRG W  T   PPP  L+EFGT++P EWI+P  S+VLE+KARS+D  E S 
Sbjct: 565 AEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELSS 624

Query: 609 KRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTXXXXXXXXXXX 668
           K++K G TL G YCR +R + DW +  ++ +  + +R  +Y     K             
Sbjct: 625 KKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSHQISPRKQRKLA 684

Query: 669 XXXXX--XXXXXXRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKIS 726
                        R+    S IF GL FYILSDY D+ +  R  KD +  L+ +N G + 
Sbjct: 685 NVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQKK-RYEKDQIGTLVRKNSGHVL 743

Query: 727 HNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHCFSV 786
           HN   +RE  S LRI+ GK T EC  L ++GYDI+ P W+ DC+    +VK+EP HCF  
Sbjct: 744 HNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCFRT 803

Query: 787 SDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFEKVPYFLF 846
           S  L+  + +RVD++GDS+   LS +    ++     +SP L +P     + + +P FLF
Sbjct: 804 SRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLSAPE----ELDGIPLFLF 859

Query: 847 WRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKA--EITVIRESMKFI 904
              K +      D          ++L+GG+    +  CN+V+   +  E   + + ++ +
Sbjct: 860 QNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEGL 919

Query: 905 RNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDYVPM 948
           R  +A T  +S     +P +VS  W++A I +   VPEED+ P+
Sbjct: 920 RKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/945 (44%), Positives = 598/945 (63%), Gaps = 27/945 (2%)

Query: 11  PRNFAPSPQFKWLCEELFSKLEEVPNQRHLTTKRITLRYYEIITNFVNLWRTTVGDDIYP 70
           P NFAPSP F+WLCEELF +L+ +   R    K +T++  EIIT F+ LWRTTVGDD +P
Sbjct: 21  PHNFAPSPDFRWLCEELFHRLDAINEHRQELGKAVTVKRVEIITCFIKLWRTTVGDDFFP 80

Query: 71  ALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSCVN 130
           AL L  PYRD R Y++KD+TLIKA+C  L L ++S TE+RLLNWKQ A R   LS  CV 
Sbjct: 81  ALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFCVQ 140

Query: 131 EMRKRKSEPVEKSPITLDELNTLLDFLSQD-RNIKGRGYKNLSESSIFTYCIEKMSFMEL 189
           E+ KR+ EP+ +  +T+D LN  LD L+++    K  G   LSES  F +C++ +SF+EL
Sbjct: 141 EISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKNLSFLEL 200

Query: 190 RYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSIN 249
           RYFFDI+LK RVIG  EHK L  WHPDA+ YL VV+DLK +  +LWNP++RL   +LSIN
Sbjct: 201 RYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLSIN 260

Query: 250 IGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDY 309
           IG+AFAPHLAK+L +SY++IC KLK+DF +EEKMDGERIQ+HY++ G+ +KFLSRRG+D+
Sbjct: 261 IGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDF 320

Query: 310 TYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEE 369
           ++LYG+ ++ G I+ YLKL  DV++CVLDGEMV+YD+ + I+LPFG+VKSAA++ L   E
Sbjct: 321 SHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSE 380

Query: 370 ISGQD--YHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNEN 427
           +  ++  Y PL MVFDLV+LNG SL + PL+ RK+YL  +L P    V+I+   R  +  
Sbjct: 381 VGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAK 440

Query: 428 IIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSA 487
            I+  ++ AI +GSEG+++K  +S Y +G+RND W+KIKPEY E  GE MDL+VIGRD  
Sbjct: 441 AIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGRDPG 500

Query: 488 KKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFCMIANGIS 547
           KKDS  CGL                   +++ +    E+ +    I K VSFC +ANG+S
Sbjct: 501 KKDSLMCGLLVSDSE-------------HILENFGPIEHGKEGDPIIKCVSFCNVANGVS 547

Query: 548 QNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNTESS 607
             E+KEI RKTRG W   +E PPP  L+EFG+++P+EWI+P++SVV+E+KARS++N+E S
Sbjct: 548 DEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSEYS 607

Query: 608 CKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTXXXXXXXXXX 667
            KR++AG TL+  YCRRIR+D DW +  S+A+ ++ +   +Y     K            
Sbjct: 608 SKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVSPRRKRNV 667

Query: 668 XXXXXXXXXXXXRDIQT-TSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKIS 726
                        ++ T  S IF+GL FYILSDY  T++  R  +  +   ++++GG I 
Sbjct: 668 HEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYV-TSQRRRYERGMVAAKVVKHGGLIV 726

Query: 727 HNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHCFSV 786
            NI  + E  S LRI+ GK T EC  L+ RGYDI+ P W+ DC+     + IEP HCF  
Sbjct: 727 KNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCFQT 786

Query: 787 SDDLMALAMRRVDKYGDSYESLLSVSRLSYILR----SSKDISPDLLSPANMSLDFEKVP 842
           S  L+  + +RVD+YGDS+   L  +    + +    S  D S  + S   +  D ++ P
Sbjct: 787 SRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSPSDFSSRISS--MLQDDLDEAP 844

Query: 843 YFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRES-- 900
            FL  R K +V+  +           KI+LYGG V + +   N+V+ P A ++  R +  
Sbjct: 845 LFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSA-LSTARTAYY 903

Query: 901 MKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945
           ++ +R  +A           +P IV  EW+D    +   VPEED+
Sbjct: 904 VQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDF 948

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/944 (45%), Positives = 585/944 (61%), Gaps = 56/944 (5%)

Query: 13  NFAPSPQFKWLCEELFSKLEEVPNQRHLTTKRITLRYYEIITNFVNLWRTTVGDDIYPAL 72
           NF+PSP+FKWLC+EL  K+ E  +++HL  K +T+RY EIITNF+ LWR+TVG+ IYPAL
Sbjct: 6   NFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYPAL 65

Query: 73  ILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSCVNEM 132
            L +P+RDRR+YNVK+ TLIKA+C YL+LPK+S TE RLL WKQRA R VKLS  CV E+
Sbjct: 66  RLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEEI 125

Query: 133 RKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSFMELRYF 192
           RKR+ +    + IT+DELN  LD +SQ+ N K  GY  L++S  F YC+  M+FME+++F
Sbjct: 126 RKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMKFF 185

Query: 193 FDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSINIGY 252
           FDIILK RV+   E+  L AWHPDA DYLSVVSDL  +  RL+NPN RLR  +LSI I +
Sbjct: 186 FDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITISH 245

Query: 253 AFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDYTYL 312
           AF P LAK+  +SY+++  KL++DF IEEKMDGER+QIHY++YG  IK+LSRRGVD++YL
Sbjct: 246 AFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYL 305

Query: 313 YGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEEISG 372
           YGEN S+G I+  LKL+ +VK+C+LDGEM+TYD ++DI+LPFG+VKS+AMN + + E++G
Sbjct: 306 YGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQI-QSELAG 364

Query: 373 ----QDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENI 428
               + Y PL + FDLV+LNG SL    L +RKDYL  +L P    V+I+ + +  N   
Sbjct: 365 IAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEA 424

Query: 429 IRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSAK 488
           I+ SLE AIS+GSEGIVLK+ +S+Y +GSRN  WIKIKPEYLEQFGENMDL++IGR+  K
Sbjct: 425 IKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQGK 484

Query: 489 KDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDY-ENPENNRHIKKVVSFCMIANGIS 547
           KDSF+CGL+                    +SD ++  E P       + +SFC IANG+S
Sbjct: 485 KDSFFCGLS--------------------ISDPNEVAEKP-------RFISFCTIANGLS 517

Query: 548 QNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNTESS 607
             E+K+I RKT G W    E PP P L+ FGT+VP EWI PE SVVLE+KAR++D  ES 
Sbjct: 518 NEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESE 577

Query: 608 CKRFKAGCTLYGGYCRRIRDDVDWK--SSFSLAELRRDRRIKHYPGTSEKDTXXXXXXXX 665
            +++++GCTL+ GYC++IR D DWK  +SFS  E  +D R   Y                
Sbjct: 578 KRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDAR-NFYNKRKSHQVTDGKKRAS 636

Query: 666 XXXXXXXXXXXXXXRDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKI 725
                           +   S  F    F ++SDYFD+ +  RIS++DL  ++LE+GG+I
Sbjct: 637 KRAKIGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEI 696

Query: 726 SHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHCFS 785
            +        + NL I+  K T EC +L+     I+ P W+  C+E         S  F 
Sbjct: 697 VYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIFR 756

Query: 786 VS-DDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFEKVPYF 844
              +  M  +    D    S   LL  +      R  K+   DLL P        +VP F
Sbjct: 757 GELESSMDCSQFYTDFNTASLNHLLETAN-----RGIKNPDSDLLLP--------EVPLF 803

Query: 845 LFWRRKAFVM-EHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRESMKF 903
           LF   K  V+   N   +SI E    I+ +GG++V +I   +I+I     I+  RE +  
Sbjct: 804 LFSNLKLAVLNSENVLDTSILEVEFAIKCHGGELV-HIENASIIIVFNDFIS--REDLFS 860

Query: 904 IRNTLA-KTVSTSVE-LPMLPRIVSFEWIDASIEKNVQVPEEDY 945
           +R  +A K V  S E  P +PR+V   W   SI+ N     E Y
Sbjct: 861 LRQKIASKAVKESTESTPRIPRMVDISWALDSIKDNYIAETEHY 904

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/962 (42%), Positives = 588/962 (61%), Gaps = 55/962 (5%)

Query: 11  PRNFAPSPQFKWLCEELFSKLEEVPNQRHLTTKRITLRYYEIITNFVNLWRTTVGDDIYP 70
           P NF+PSP F WLC+ELF KLEEV  ++    K   +R  EI +NFV+LWR TVG+DIYP
Sbjct: 51  PINFSPSPDFCWLCDELFIKLEEVALKKKDLGKPRKVRNLEITSNFVSLWRKTVGNDIYP 110

Query: 71  ALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSCVN 130
           AL+L+LPY DRR Y VKD TL+KA+C ++KLP+NS TE+RLL+WKQ A R VKLS  CV 
Sbjct: 111 ALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCVE 170

Query: 131 EMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSFMELR 190
           E++KR+ EPV    +++DE+N +LD L  + N+    Y +L+ES  F YC+E MS++ELR
Sbjct: 171 ELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVELR 230

Query: 191 YFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSINI 250
           +FFDI+LK  ++   E  LL+ WHPDAE Y  VVSDL+ V   L++PN RL  ++LS+ I
Sbjct: 231 FFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVRI 290

Query: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDYT 310
           GYAFAPH+A+++ I Y+K+  KL NDF++EEKMDG+RIQ+HYMDYGN I + SR G++YT
Sbjct: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350

Query: 311 YLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEEI 370
           YLYGEN S G+I+ +LK    VKEC+LDGEMV+YD++   +LPFG+ KS A + +  E  
Sbjct: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410

Query: 371 SGQD--YHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENI 428
              +  Y PL  VFDL++LNG  L    + +RK+YL  +L P +  V +++  RCS+   
Sbjct: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470

Query: 429 IRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSAK 488
           I  +L  A++ GSEGIVLK   S+Y +G R+DSWIKIKPEYLE FGENMDL+VIGRD  +
Sbjct: 471 ITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKGR 530

Query: 489 KDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNR----------------H 532
           KDSF C L                     V+D+S+  NP +                   
Sbjct: 531 KDSFICALA--------------------VTDDSEKNNPSSYESGSDSDSDSEPIIVQPK 570

Query: 533 IKKVVSFCMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSV 592
           I+K +SFC IANGIS  E+KEI R TRG W   +E  PP + +EFGT+ P EWI+P++SV
Sbjct: 571 IEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSV 630

Query: 593 VLEIKARSLDNTESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGT 652
           VLE+KARS+DN ES    +K G TLY  YC+RIR D +W ++ ++AE    R  + Y   
Sbjct: 631 VLEVKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNV 690

Query: 653 SEKDTXXXXXXXXXXXXXXXXXXXXXXRDIQTTSK--IFDGLFFYILSDYFDTNENVRIS 710
           S+                          D+   SK     G +FY+ S YFD      I 
Sbjct: 691 SQNAKFGKDRSSPRKRRTFHLVGDI---DVTKPSKADFLKGYYFYVTSGYFDLQSKKNID 747

Query: 711 KDDLQKLLLENGGKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCV 770
             ++ + ++  GG   HN+   R S   L IL  K T E  +LI+RGYDI+ P+W++DCV
Sbjct: 748 ASEIGEAVVSCGGTYIHNL-RIRASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCV 806

Query: 771 ENKKIVKIEPSHCFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLS 830
           +   +++IEP + +S S++LM  A  + DKYG+SY+  L V+  +    ++K +     S
Sbjct: 807 KYGTMLQIEPKYVYSASEELMKQARNQEDKYGESYQ--LPVTEDTLKALANKQVEEGYAS 864

Query: 831 PANMSL--DFEKVPYFLFWRRKAFVMEHNFDKSSIRETILK--IQLYGGKVVKNISECNI 886
                   ++E++  F  W    F +  ++   S    I+K  I+  GG+V  ++    I
Sbjct: 865 EMGTDAVSEYERLLIFKGW---LFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATI 921

Query: 887 VIFPKAEITVIRESMKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDYV 946
           V+  K   + +  S++ +RN +   ++ S ++  +P+IV+ EW++A +E    V E++Y 
Sbjct: 922 VVAVKDCFSQL--SLQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYA 979

Query: 947 PM 948
            +
Sbjct: 980 AI 981

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 111/418 (26%), Positives = 173/418 (41%), Gaps = 66/418 (15%)

Query: 238 NIRLRHDELSIN------IGYAFAPHLAKKLSISYDKICKKLKND-FFIEEKMDGERIQI 290
           N  L H  + +N       G    P LAK  S S  ++  +   + F  E K DGER Q+
Sbjct: 307 NTCLEHGIMEVNKHCVLKPGIPLKPMLAKP-SKSITEVLDRFHGEKFTCEYKYDGERAQV 365

Query: 291 HYMDYGNDIKFLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDI 350
           H +  G+ +   SR G + T  Y E      I  YL         +LD E V +D +Q  
Sbjct: 366 HLLPDGS-MNIYSRNGENMTERYPEL----HIRDYLADPETTHSLILDCEAVAWDTEQGK 420

Query: 351 LLPFGMVKSAAMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEP 410
           +LPF ++ +     +  +++        L  FD++  NG SL+   L +R++YL  VL+P
Sbjct: 421 ILPFQILSTRKRKGVEAKDVK---VRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKP 477

Query: 411 YRARVQIVNFTRCSNENIIRKSLEHAISVGSEGI---VLKNYNSRYMIGSRNDSWIKIKP 467
              + Q  N    SN   ++K LE ++    EG+   VL+   S Y    R+ +W+K+K 
Sbjct: 478 VTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKK 537

Query: 468 EYLEQFGENMDLIVIGR--DSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYE 525
           +YL+  G+++DL V+G      K+   Y G                 G  N   D  ++E
Sbjct: 538 DYLQGVGDSLDLCVLGAYYGRGKRTGTYGGF--------------LLGCYN--QDTGEFE 581

Query: 526 NPENNRHIKKVVSFCMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEW 585
                       + C I  G S      +Y K     K +    P    +   +  P  W
Sbjct: 582 ------------TCCKIGTGFSDEMLVSLYEK----LKPSSLEQPKAFYVYDSSAEPDVW 625

Query: 586 IEPEHSVVLEIKARSLDNTESSCKRFKAGCTLYGGYCR-------RIRDDVDWKSSFS 636
            EP  +++ E+    L    S    +KAG + YG           RIRDD D + + S
Sbjct: 626 FEP--TMLFEVLTADL----SLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATS 677

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 108/455 (23%), Positives = 186/455 (40%), Gaps = 69/455 (15%)

Query: 195 IILKARVIGPHEHK-------LLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELS 247
           ++  ++ I  HEH        L++A      D    V + + V        I        
Sbjct: 286 LVALSKAILTHEHGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCV 345

Query: 248 INIGYAFAPHLAKKLSISYDKICKKLKND-FFIEEKMDGERIQIHYMDYGNDIKFLSRRG 306
           +  G    P LAK  S S  ++  + +   F  E K DGER Q+H +  G+ ++  SR G
Sbjct: 346 LTPGIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNG 403

Query: 307 VDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALT 366
            + T  Y E      I+ ++    +    +LD E V +D+D++++LPF ++ +     + 
Sbjct: 404 ENMTERYPEI----NISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVV 459

Query: 367 KEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNE 426
            E++        L  FD++  N   L+   L +R+ YL  +L+P    +Q+ +     + 
Sbjct: 460 AEDVK---VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSL 516

Query: 427 NIIRKSLEHAISVGSEGI---VLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIG 483
           + ++  L+ ++    EG+   VL    S Y    R+ +W+K+K +YL+  G+++DL V+G
Sbjct: 517 DEMQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLG 576

Query: 484 R--DSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFCM 541
                 K+   Y G                 G  N   D  ++E            + C 
Sbjct: 577 AYYGRGKRTGTYGGF--------------LLGCYN--QDTGEFE------------TCCK 608

Query: 542 IANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQV-PMEWIEPEHSVVLEIKARS 600
           I  G S    + +Y K         E+P P     +     P  W+EP  S++ E+    
Sbjct: 609 IGTGFSDEMLQNLYEKL-----SPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTAD 661

Query: 601 LDNTESSCKRFKAGCTLYGGYCR-------RIRDD 628
           L    S    +KAG + YG           RIRDD
Sbjct: 662 L----SLSPVYKAGGSSYGKGISLRFPRFIRIRDD 692

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 109/453 (24%), Positives = 188/453 (41%), Gaps = 65/453 (14%)

Query: 195 IILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWN----PNIRLRHDELSIN- 249
           +I  ++ I  HEH   N   P  E      S ++    ++ N     N+ L++  +++N 
Sbjct: 271 LISVSKAILTHEH---NGQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327

Query: 250 -----IGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSR 304
                 G    P LAK      + + +     F  E K DGER Q+H    G+ +K  SR
Sbjct: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIYSR 386

Query: 305 RGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNA 364
            G D T  Y E      +  Y+K     K  ++D E V +D++Q  +LPF ++ +     
Sbjct: 387 NGEDMTERYPEI----DVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKG 442

Query: 365 LTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCS 424
           +   E+        L  FD++ LN   L+    ++R+  L       + +    N    +
Sbjct: 443 V---ELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTT 499

Query: 425 NENIIRKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIV 481
           N + ++K L+ ++    EG+++K      S Y    R+ +W+K+K +YLE  G+++DL+V
Sbjct: 500 NFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVV 559

Query: 482 IGR--DSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSF 539
           +G      K+   Y G                 G  NL S+E +              + 
Sbjct: 560 LGAYYGRGKRTGTYGGF--------------LLGCYNLDSEEFE--------------TC 591

Query: 540 CMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPME-WIEPEHSVVLEIKA 598
           C I  G S    +++Y K      K   V  P   + + +  P + W EP  S++ E+  
Sbjct: 592 CKIGTGFSDEMLQDLYTKL-----KDTTVEHPSTNVIYDSSAPADVWFEP--SMLFEVLT 644

Query: 599 RSLDNT---ESSCKRFKAGCTLYGGYCRRIRDD 628
             L  +   ++  + F  G +L      RIRDD
Sbjct: 645 ADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDD 677

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 138/295 (46%), Gaps = 15/295 (5%)

Query: 208 KLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSINIGYAFAPHLAKKLSISYD 267
           +LL        D    V + + V        I   ++  S+  G    P LAK  + + +
Sbjct: 355 ELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKP-TKAIN 413

Query: 268 KICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRRGVDYTYLYGENLSTGTIACYL 326
           +I  + + + F  E K DGER Q+H ++ G  ++  SR G + T  Y E      I  ++
Sbjct: 414 EILDRFQGETFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEI----HIGDFV 468

Query: 327 KLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEEISGQDYHPLLMVFDLVF 386
           K   + K  +LD E V +D++Q  +LPF ++ +     +  +++        L  FD++ 
Sbjct: 469 KDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVK---VRVCLFAFDILC 525

Query: 387 LNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENIIRKSLEHAISVGSEGIVL 446
            N + L+ + L +R++ L  V  P     Q       SN + ++K L+ +++   EG+++
Sbjct: 526 HNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMV 585

Query: 447 K---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGR--DSAKKDSFYCGL 496
           K      S Y    R+ +W+K+K +YLE  G+++DL V+G      K+   Y G 
Sbjct: 586 KMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGGF 640

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 95/380 (25%), Positives = 161/380 (42%), Gaps = 53/380 (13%)

Query: 246 LSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSR 304
           + +  G    P LAK  + S  ++    +N  F  E K DGER Q+H +  G+ ++  SR
Sbjct: 348 IKLTPGIPLKPMLAKP-TKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGS-MRIYSR 405

Query: 305 RGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNA 364
            G D T  Y E      I  YL  +    + +LD E V +D +   +LPF ++ +    +
Sbjct: 406 NGEDMTQRYPEL----NIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKS 461

Query: 365 LTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCS 424
           +  ++I        L  FD++  N  SL+   L +R+D L S+ +P   + Q       S
Sbjct: 462 VDLKDIK---VRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTS 518

Query: 425 NENIIRKSLEHAISVGSEGIVLKNY---NSRYMIGSRNDSWIKIKPEYLEQFGENMDLIV 481
           N + ++  L+ AI    EG+++K+    +S Y    R+ +W+K+K +YL+  G+++DL V
Sbjct: 519 NLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCV 578

Query: 482 IGR--DSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSF 539
           +G      K+   Y G                                  N+  ++  + 
Sbjct: 579 LGAYYGRGKRTGTYGGFLLACY----------------------------NQDTEEFETC 610

Query: 540 CMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKAR 599
           C I  G S    + +Y       K+T    P    +   +  P  W  P  ++V E+   
Sbjct: 611 CKIGTGFSDEMLQTLYNG----LKETAIESPRANFVFDSSAEPDVWFNP--TMVFEVLTA 664

Query: 600 SLDNTESSCKRFKAGCTLYG 619
            L    S    +KAG T+YG
Sbjct: 665 DL----SLSPIYKAGSTVYG 680

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 90/380 (23%), Positives = 159/380 (41%), Gaps = 39/380 (10%)

Query: 144 PITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSFMELRYFFD--------- 194
           P+T+ ++ + L  ++Q      +G K      + T C      ME +Y            
Sbjct: 205 PLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTAC----QGMEAKYLIRSLESKLRIG 260

Query: 195 ------IILKARVIGPHEH-------KLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRL 241
                 ++  ++ I  HEH       + ++A      D    V + + +        I  
Sbjct: 261 LAEKTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMN 320

Query: 242 RHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKF 301
                 +  G    P LAK      + + +     F  E K DGER Q+H M+ G  I+ 
Sbjct: 321 LPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGT-IRI 379

Query: 302 LSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAA 361
            SR   + T  Y E         +L   +  +  ++D E V +D ++  +LPF ++ +  
Sbjct: 380 YSRNSENMTERYPEI----QFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRK 435

Query: 362 MNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFT 421
              +   E+        L  FDL++LNG SL++  L  R+ +L SVL+     +Q  N  
Sbjct: 436 RKGV---ELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEI 492

Query: 422 RCSNENIIRKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMD 478
                + ++  LE ++S   EG+++K      S+Y    R+ +W+K+K +YLE  G+++D
Sbjct: 493 TTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLD 552

Query: 479 LIVIGR--DSAKKDSFYCGL 496
           L V+G      K+   Y G 
Sbjct: 553 LAVLGAYYGRGKRTGTYGGF 572

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 105/414 (25%), Positives = 176/414 (42%), Gaps = 63/414 (15%)

Query: 247 SINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRR 305
           +I  G    P LAK  + + +++  + +   F  E K DGER Q+H +  G  ++  SR 
Sbjct: 353 TIQPGIPLKPMLAKP-TKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGT-MRIYSRN 410

Query: 306 GVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNAL 365
           G + T  Y E      I  +L         +LD E V +D++Q+ +LPF ++ +     +
Sbjct: 411 GENMTERYPEI----QIKDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDV 466

Query: 366 TKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSN 425
              E+        L  FD++  N   L+  PL +R++ L  V +P     Q       SN
Sbjct: 467 NINEVK---VRVCLFAFDILLHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSN 523

Query: 426 ENIIRKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482
            + ++K L+ ++    EG+++K      S Y    R+ +W+K+K +YLE  G+++DL V+
Sbjct: 524 LDELQKFLDESVKNSCEGLMVKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 583

Query: 483 GR--DSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFC 540
           G      K+   Y G                 G  N  +D  D+E            + C
Sbjct: 584 GAYFGRGKRTGTYGGF--------------LLGCYN--ADSEDFE------------TCC 615

Query: 541 MIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARS 600
            I  G S+   + +Y K       T    P    +   +  P  W EP  +++ E+    
Sbjct: 616 KIGTGFSEEMLQTLYEK----LSPTVIDGPKGTYVFDSSAEPDVWFEP--TMLFEVLTAD 669

Query: 601 LDNTESSCKRFKAGCTLY--GGYCR-----RIRDDV---DWKSSFSLAELRRDR 644
           L    S    +KAG ++Y  G   R     RIRDD    D  SS  + E+ +++
Sbjct: 670 L----SLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQ 719

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 100/419 (23%), Positives = 174/419 (41%), Gaps = 53/419 (12%)

Query: 219 DYLSVVSDLKTVCTRLWNPNIRLRHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFF 278
           D    V + + V        I   H    +  G    P LAK  + +  ++  + +   F
Sbjct: 334 DAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKP-TKAITEVLDRFQGQLF 392

Query: 279 IEE-KMDGERIQIHYMDYGNDIKFLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVL 337
           + E K DGER Q+H +  G  ++  SR G + T  Y E      I  +L  +   +  +L
Sbjct: 393 VSEYKYDGERAQLHLLPDGT-MRIYSRNGENMTERYPEI----DIRDFLS-DPSTESLIL 446

Query: 338 DGEMVTYDEDQDILLPFGMVKSAAMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPL 397
           D E V +D++Q  +LPF ++ +     +  +++        L  FDL+  NG  L+   L
Sbjct: 447 DCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVK---VRVCLFAFDLLCHNGEPLINKSL 503

Query: 398 YQRKDYLASVLEPYRARVQIVNFTRCSNENIIRKSLEHAISVGSEGIVLKNYN---SRYM 454
            +R+D L  V +P     +  N    +N   ++  L+ ++    EG+++K  +   S Y 
Sbjct: 504 RERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYE 563

Query: 455 IGSRNDSWIKIKPEYLEQFGENMDLIVIGR--DSAKKDSFYCGLTXXXXXXXXXXXXXXX 512
              R+ +W+K+K +YL   G+++DL V+G      K+   Y G                 
Sbjct: 564 PSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGGF--------------LL 609

Query: 513 GVVNLVSDESDYENPENNRHIKKVVSFCMIANGISQNEYKEIYRKTRGFWKKTEEVPPPP 572
           G  N   D  +YE            + C I  G S+   +++Y +     K T    P  
Sbjct: 610 GCYN--QDTGEYE------------TCCKIGTGFSEELLQQLYDR----LKPTAMEAPAA 651

Query: 573 ELIEFGTQVPMEWIEPEHSVVLEIKARSLDNT---ESSCKRFKAGCTLYGGYCRRIRDD 628
             +    Q P  W EP  +++ E+ A  L  +   ++   ++  G +L      RIRDD
Sbjct: 652 FYVYDSAQQPDVWFEP--TLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDD 708

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 106/411 (25%), Positives = 178/411 (43%), Gaps = 65/411 (15%)

Query: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRRGVDY 309
           G    P LAK  + S  ++  + +   F  E K DGER Q+H ++ G  ++  SR G + 
Sbjct: 339 GIPLKPMLAKP-TKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENM 396

Query: 310 TYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEE 369
           T  Y E     +I  ++      K  +LD E V +D+ Q  +LPF ++ +     +  ++
Sbjct: 397 TERYPEI----SIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKD 452

Query: 370 ISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQ-IVNFTRCSNENI 428
           +        L  FD++  NG   +   L +R++ LA V +P     Q  V  T  S E +
Sbjct: 453 VK---VRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEEL 509

Query: 429 IRKSLEHAISVGSEGIVLKNYN---SRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGR- 484
            +K L+ ++    EG+++K  +   S Y    R+ +W+K+K +YL+  G+++DL V+G  
Sbjct: 510 -QKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAY 568

Query: 485 -DSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFCMIA 543
               K+   Y G                 G  N   D  ++E            + C I 
Sbjct: 569 YGRGKRTGTYGGF--------------LLGCYN--QDSGEFE------------TCCKIG 600

Query: 544 NGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDN 603
            G S    +++Y +   F K T + P    + +   + P  W EP  + + E+    L  
Sbjct: 601 TGFSDEMLQQLYER---FSKTTLDGPKATYVFDSSAE-PDVWFEP--TTLFEVLTADL-- 652

Query: 604 TESSCKRFKAGCTLY--GGYCR-----RIRDDV---DWKSSFSLAELRRDR 644
             S    +KAG + Y  G   R     R+RDD    D  SS  + EL +D+
Sbjct: 653 --SLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQ 701

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 109/435 (25%), Positives = 172/435 (39%), Gaps = 58/435 (13%)

Query: 208 KLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSINIGYAFAPHLAKKLSISYD 267
           +L+        D    V + + +     N  I    +   +  G    P LAK      +
Sbjct: 312 ELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINE 371

Query: 268 KICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDYTYLYGENLSTGTIACYLK 327
            +      +F  E K DGER Q+H +  G +++  SR G + T  Y E L         +
Sbjct: 372 VLDAFQGEEFTCEYKYDGERGQVHLLSNG-EMRIYSRNGENMTERYPE-LHIEDFLVKDE 429

Query: 328 LNRDVK-ECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEEISGQDYHPLLMVFDLVF 386
            N D +   +LD E+V +D +Q+ +LPF ++ +     +   E+        L  FD+++
Sbjct: 430 SNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGV---ELKDVKVRVCLFAFDILY 486

Query: 387 LNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENIIRKSLEHAISVGSEGIVL 446
            NG  L+   L +R+  L  V +      Q       +  + I+K L+ AI    EG+++
Sbjct: 487 YNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMV 546

Query: 447 K---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGR--DSAKKDSFYCGLTXXXX 501
           K      SRY    R+ +W+K+K +YL   G+++DL V+G      K+   Y G      
Sbjct: 547 KILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGF----- 601

Query: 502 XXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFCMIANGISQNEYKEIYRKTRGF 561
                      G  N   D  +YE            + C I  G S     ++Y   R  
Sbjct: 602 ---------LLGCYN--QDSGEYE------------TCCKIGTGFSDEMLTKLYELFR-- 636

Query: 562 WKKTEEVPPPPELIEFGTQV-PMEWIEPEHSVVLEIKARSLDNTESSCKRFKAGCTLY-- 618
               EE+  P     F +   P  W EP+  V+ E+    L    S    +KAG   Y  
Sbjct: 637 ---EEEIEVPKSFYNFDSSAEPDIWFEPK--VLFEVLTADL----SLSPIYKAGSATYDK 687

Query: 619 GGYCR-----RIRDD 628
           G   R     RIRDD
Sbjct: 688 GISLRFPRFLRIRDD 702

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 94/402 (23%), Positives = 166/402 (41%), Gaps = 76/402 (18%)

Query: 248 INIGYAFAPHLAKKLSISYDKICKKLKND-FFIEEKMDGERIQIHYMDYGNDIKFLSRRG 306
           +  G    P LAK  S S  ++  + +   F  E K DGER Q+H +  G+ ++  SR G
Sbjct: 354 LTPGIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNG 411

Query: 307 VDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALT 366
            + T  Y E      I+ ++         +LD E V +D++++ +LPF ++ +     + 
Sbjct: 412 ENMTERYPEI----RISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVA 467

Query: 367 KEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNE 426
            E++        L  FD++  N   L+  PL +R+  L   L P    +Q+ +     + 
Sbjct: 468 VEDVK---VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSL 524

Query: 427 NIIRKSLEHAISVGSEGI---VLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIG 483
           + ++  L+ A+    EG+   +L+   S Y    R+ +W+K+K +YL+  G+++DL V+G
Sbjct: 525 DELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLG 584

Query: 484 R--DSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVVSFCM 541
                 K+   Y G                 G  N   D  +YE            + C 
Sbjct: 585 AYYGRGKRTGTYGGF--------------LLGCYN--QDSGEYE------------TCCK 616

Query: 542 IANGISQNEYKEIYRK--------TRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVV 593
           I  G S+   + ++ +         + F+  +E  PP              W EP  +++
Sbjct: 617 IGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPD------------VWFEP--TLL 662

Query: 594 LEIKARSLDNTESSCKRFKAGCTLYGGYCR-------RIRDD 628
            E+    L    S    +KAG + YG           R+RDD
Sbjct: 663 FEVLTADL----SLSPVYKAGTSSYGKGISLRFPRFIRLRDD 700

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 123/252 (48%), Gaps = 15/252 (5%)

Query: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRRGVDY 309
           G    P LAK  + + +++  + + + F  E K DGER Q+H ++ G  ++  SR G + 
Sbjct: 388 GIPLKPMLAKP-TKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENM 445

Query: 310 TYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEE 369
           T  Y E      I  +++     K  +LD E V +D+DQ  +LPF ++ +     +   E
Sbjct: 446 TERYPEI----NITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDV---E 498

Query: 370 ISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENII 429
           ++       L  FD++  N   L+   L +R++YL  V +      Q       +N + +
Sbjct: 499 LNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDEL 558

Query: 430 RKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGR-- 484
           +K L+ +++   EG+++K      S Y    R+ +W+K+K +YLE  G+++DL V+G   
Sbjct: 559 QKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYY 618

Query: 485 DSAKKDSFYCGL 496
              K+   Y G 
Sbjct: 619 GRGKRTGTYGGF 630

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 124/256 (48%), Gaps = 15/256 (5%)

Query: 247 SINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRR 305
           ++  G    P LAK  + + +++  + + + F  E K DGER Q+H +D G  ++  SR 
Sbjct: 384 TLKPGIPLKPMLAKP-TKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGT-MRIYSRN 441

Query: 306 GVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNAL 365
           G + T  Y E      I  +++     K  +LD E V +D++Q  +LPF ++ +     +
Sbjct: 442 GENMTERYPEI----KITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDV 497

Query: 366 TKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSN 425
              E+S       L  FD++  NG  L+   L +R++ L  V +      Q        N
Sbjct: 498 ---ELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDN 554

Query: 426 ENIIRKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482
            + ++K L+ +++   EG+++K      S Y    R+ +W+K+K +YLE  G+++DL V+
Sbjct: 555 LDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614

Query: 483 GR--DSAKKDSFYCGL 496
           G      K+   Y G 
Sbjct: 615 GAYYGRGKRTGTYGGF 630

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 96/398 (24%), Positives = 166/398 (41%), Gaps = 57/398 (14%)

Query: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDYT 310
           G    P LAK      + +      +F  E K DGER Q+H ++ G +++  SR G + T
Sbjct: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNGENMT 414

Query: 311 YLYGENLSTGTIACYLK-LNRD---------VKECVLDGEMVTYDEDQDILLPFGMVKSA 360
             Y E L      C +K +  D         VK+ +LD E+V +D +Q  +LPF ++ + 
Sbjct: 415 ERYPE-LDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTR 473

Query: 361 AMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNF 420
               +  +++        L  FDL++LN   ++   L +R++ L  V        Q    
Sbjct: 474 KRKNVDLKDVK---VRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYATS 530

Query: 421 TRCSNENIIRKSLEHAISVGSEGIVLKNYN---SRYMIGSRNDSWIKIKPEYLEQFGENM 477
              S+ + ++  L+ A+    EG+++K  +   S Y    R+ +W+K+K +YL+  G+++
Sbjct: 531 LITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSL 590

Query: 478 DLIVIGR--DSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKK 535
           DL+V+G      K+   Y G                 G  N   D  ++E          
Sbjct: 591 DLVVMGAYFGKGKRTGSYGGF--------------LLGCYN--EDTQEFE---------- 624

Query: 536 VVSFCMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLE 595
             + C I  G S     E+        + TE   PP   I   +  P  W + +  V+ E
Sbjct: 625 --TCCKIGTGFSD----EMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAK--VLFE 676

Query: 596 IKARSLDNT---ESSCKRFKAGCTLYGGYCRRIRDDVD 630
           +    L  +   ++   R+  G +L      RIR+D D
Sbjct: 677 VLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKD 714

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 124/253 (49%), Gaps = 17/253 (6%)

Query: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRRGVDY 309
           G    P LAK  + + +++  + + + F  E K DGER Q+H ++ G  ++  SR G + 
Sbjct: 478 GIPLKPMLAKP-TKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENM 535

Query: 310 TYLYGENLSTGTIACYLKLNRDV-KECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKE 368
           T  Y E   T  I      + D+ K  +LD E V +D+DQ  +LPF ++ +     +   
Sbjct: 536 TERYPEIKITDFIQ-----DLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDV--- 587

Query: 369 EISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENI 428
           E++       L  FD++  N   L+   L +R++YL  V +      Q       +N + 
Sbjct: 588 ELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDE 647

Query: 429 IRKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGR- 484
           ++K L+ +++   EG+++K      S Y    R+ +W+K+K +YLE  G+++DL V+G  
Sbjct: 648 LQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAY 707

Query: 485 -DSAKKDSFYCGL 496
               K+   Y G 
Sbjct: 708 YGRGKRTGTYGGF 720

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 124/252 (49%), Gaps = 15/252 (5%)

Query: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRRGVDY 309
           G    P LAK  + + +++  + + + F  E K DGER Q+H ++ G  ++  SR G + 
Sbjct: 388 GIPLKPMLAKP-TKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENM 445

Query: 310 TYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEE 369
           T  Y E      I  +++     K  +LD E V +D++Q  +LPF ++ +     +   E
Sbjct: 446 TERYPEI----KITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDV---E 498

Query: 370 ISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENII 429
           +        L  FD++  N   L+   L +R+++LA V +      Q       +N + +
Sbjct: 499 LHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDEL 558

Query: 430 RKSLEHAISVGSEGIVLKNYN---SRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGR-- 484
           +K L+ +++   EG+++K  +   S Y    R+ +W+K+K +YLE  G+++DL V+G   
Sbjct: 559 QKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYY 618

Query: 485 DSAKKDSFYCGL 496
              K+   Y G 
Sbjct: 619 GRGKRTGTYGGF 630

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 120/256 (46%), Gaps = 15/256 (5%)

Query: 247 SINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRR 305
           S+  G    P LAK  + + ++I  + + + F  E K DGER Q+H +  G  ++  SR 
Sbjct: 383 SLRPGIPLKPMLAKP-TKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRN 440

Query: 306 GVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNAL 365
           G + T  Y E      IA  L  +      +LD E V +D +Q+ +LPF ++ +     +
Sbjct: 441 GENMTERYPEIHIRDFIADPLVTST----LILDCEAVAWDNEQNKILPFQVLSTRKRKDV 496

Query: 366 TKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSN 425
             +++        L  FD++  N   L+   L +R+  L  V +      Q       SN
Sbjct: 497 DLKDVK---VKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSN 553

Query: 426 ENIIRKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482
            + ++K L+ ++    EG+++K      S Y    R+ +W+K+K +YLE  G+++DL VI
Sbjct: 554 LDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVI 613

Query: 483 GR--DSAKKDSFYCGL 496
           G      K+   Y G 
Sbjct: 614 GAYYGRGKRTGMYGGF 629

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 114/241 (47%), Gaps = 13/241 (5%)

Query: 247 SINIGYAFAPHLAKKLSISYDKICKKLKND-FFIEEKMDGERIQIHYMDYGNDIKFLSRR 305
           S+       P LAK  + S  +I  + ++  F  E K DGER Q+H ++ G  ++  SR 
Sbjct: 356 SLRPAIPLKPMLAKP-TKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGT-MRIYSRN 413

Query: 306 GVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNAL 365
           G + T  Y E      I  ++      K  +LD E V +D++Q+ +LPF ++ +     +
Sbjct: 414 GENMTERYPEI----HIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDV 469

Query: 366 TKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSN 425
              EI        L  FD++  N   L+   L +R+D L S+ +      Q       +N
Sbjct: 470 DINEIK---VRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTN 526

Query: 426 ENIIRKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482
              ++  L+ ++    EG+++K      S Y    R+ +W+K+K +YL   G+++DL V+
Sbjct: 527 LEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVL 586

Query: 483 G 483
           G
Sbjct: 587 G 587

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 90/381 (23%), Positives = 158/381 (41%), Gaps = 53/381 (13%)

Query: 244 DELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFL 302
           +  S+  G    P LAK  + +  ++  + +N  F  E K DGER Q+H M+ G+ ++  
Sbjct: 336 EHCSLRPGIPLKPMLAKP-TKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGS-MRIY 393

Query: 303 SRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAM 362
           SR G + T  Y E      +  ++K     K  ++D E V +D ++  +LPF ++ +   
Sbjct: 394 SRNGENMTERYPEI----NVTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKR 449

Query: 363 NALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTR 422
             +  ++I        L  FD++  N   L+   L +R++ L SV               
Sbjct: 450 KDVDIKDIK---VRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELS 506

Query: 423 CSNENIIRKSLEHAISVGSEGI---VLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDL 479
            +N + ++  L+ ++    EG+   VL   +S Y    R+ +W+K+K +YL+  G+++DL
Sbjct: 507 TNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDL 566

Query: 480 IVIGR--DSAKKDSFYCGLTXXXXXXXXXXXXXXXGVVNLVSDESDYENPENNRHIKKVV 537
            V+G      K+   Y G                 G  N   D  ++E            
Sbjct: 567 CVLGAFYGRGKRTGTYGGF--------------LLGCYN--QDTGEFE------------ 598

Query: 538 SFCMIANGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIK 597
           + C I  G S    + +Y +     K T    P    I   +  P  W EP  +++ E+ 
Sbjct: 599 TACKIGTGFSDEVLQSLYDR----LKSTTIDGPKATYIYDSSAQPDVWFEP--TLLFEVL 652

Query: 598 ARSLDNTESSCKRFKAGCTLY 618
              L    S    +KAG + Y
Sbjct: 653 TADL----SMSPIYKAGASTY 669

>TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.469
           YDR243C
          Length = 607

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 54/109 (49%), Gaps = 15/109 (13%)

Query: 737 SNLRILCGKYTAECNVLIKRGYDIL--SPQWVIDCVENKKIVKIEPSHCFSVSDDLMALA 794
           +++ I+ G    E    I +G DIL  +P  +IDC+E+K I          V +D+  L 
Sbjct: 293 TSVSIVGGYSIEELTFKISKGMDILVATPGRLIDCLESKLI----------VLNDIETLV 342

Query: 795 MRRVDKYGD-SYESLLSVSRLSYILR-SSKDISPDLLSPANMSLDFEKV 841
           +   DK  D  +E  LS + LSY+    SKD    ++  A MS D EK+
Sbjct: 343 LDEADKMIDLGFEEQLS-TILSYVASYKSKDTVQTIMFSATMSPDIEKL 390

>KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7.46
           YOR346W
          Length = 896

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 48/94 (51%), Gaps = 11/94 (11%)

Query: 683 QTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKISHNIVSKRESKSNLRIL 742
           + TS +F  L  YI       N   R S+  L ++++ NGGK  H++ +KR   S   I+
Sbjct: 104 KATSNLFKDLTVYI-------NGYTRPSRFQLHEMIVLNGGKFLHHLSAKR---SVTHII 153

Query: 743 CGKYTAECNVLIKRGYDILSPQWVIDCVENKKIV 776
               T +  +     Y ++ P+W++D ++ KK++
Sbjct: 154 ASTLTLKKKIEFA-NYKVVKPEWLVDSIKVKKLL 186

>CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346w REV1
           DNA repair protein
          Length = 887

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 44/90 (48%), Gaps = 11/90 (12%)

Query: 687 KIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKISHNIVSKRESKSNLRILCGKY 746
           +IF GL  YI       N      + +L ++++ +GGK  H++ +KR   S   I+    
Sbjct: 83  QIFQGLVLYI-------NGFTTPGRFELHQMIVVHGGKFLHHMSAKR---SVTHIIASNL 132

Query: 747 TAECNVLIKRGYDILSPQWVIDCVENKKIV 776
             +  +     Y ++ P W++D ++ KK++
Sbjct: 133 PLKKRIEFA-NYKVVKPNWIVDSIQQKKLL 161

>AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL090C
           (DPB11)
          Length = 670

 Score = 35.0 bits (79), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 20/100 (20%)

Query: 689 FDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGK---ISHNIVSKRESKSNLRILCGK 745
           F G + +I           R+S  +LQ+L    G +    SH +   R++ S+ R +   
Sbjct: 111 FGGFYVFI-----GRVAGGRVSAAELQQLCESGGARRVVTSHFV---RDTASSARSV--- 159

Query: 746 YTAECNVLIK------RGYDILSPQWVIDCVENKKIVKIE 779
           +  +C    +      +G  ++ P+WV DCV    +V++E
Sbjct: 160 FVTDCAEGARAAAAREQGVAVVHPKWVTDCVRRGAVVEME 199

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12749 Saccharomyces cerevisiae
           YLR383W RHC18 Protein involved in structural maintenance
           of chromosomes required for interchromosomal and sister
           chromatid recombination
          Length = 1111

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 55/124 (44%), Gaps = 7/124 (5%)

Query: 265 SYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKF---LSRRGVDYTYLYGENLSTGT 321
           S D   K LK D   EE+ + ER ++HY    N+++    L +  +D +    + L+  +
Sbjct: 689 SSDDGTKYLK-DLINEERHELERTKVHYDQLFNELRTEMRLLKADIDRSRSESQRLTKAS 747

Query: 322 IACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEEISGQDYHPLLMV 381
               LK++++V    L+   V     ++ ++ +   + A      K E  GQD  P    
Sbjct: 748 NHLSLKIDKEVDTGKLEQSKVEKKNQENAVISY---QGALQEIEAKLEQIGQDAQPYKNK 804

Query: 382 FDLV 385
           FDL 
Sbjct: 805 FDLT 808

>NDAI0C00910 Chr3 complement(175497..176585) [1089 bp, 362 aa] {ON}
           Anc_5.555 YML021C
          Length = 362

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 848 RRKAFVMEHNFDKSSIRETILKIQLYGGK-VVKNISECNIVIFPKAEITVIRESMK 902
           +RK   +   F+KS++++  +  ++ GGK  VKNI E N  + P  E  +  + +K
Sbjct: 9   KRKQTTITDFFNKSTLKKAKVSNEITGGKSAVKNIEEQNDNVLPNGETAIKEDEVK 64

>TPHA0C04050 Chr3 (867505..871926) [4422 bp, 1473 aa] {ON} Anc_2.497
            YKL010C
          Length = 1473

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 52/120 (43%), Gaps = 18/120 (15%)

Query: 788  DDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSLDFEKVPYFLFW 847
            D+L A  ++ +DKYG +  +L     + YI      + P L   A+MSL+F K P    W
Sbjct: 1102 DNLFASGLKTIDKYGSNRNTL----EIEYIDEEGTGLGPTLEFYASMSLEFAK-PLLDIW 1156

Query: 848  --------RRKAFVMEHNFDK-----SSIRETILKIQLYGGKVVKNISECNIVIFPKAEI 894
                        F+ +  F K     S   +TI   ++ G  + K++ +  IV F   E+
Sbjct: 1157 LCDEEVGNTDTKFIEQELFPKPLSTCSDANKTIELFRILGKFIAKSMLDGRIVDFRFKEV 1216

>KNAG0E00410 Chr5 complement(65732..68185) [2454 bp, 817 aa] {ON}
           Anc_7.46 YOR346W
          Length = 817

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 53/117 (45%), Gaps = 10/117 (8%)

Query: 680 RDIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKISHNIVSKRESKSNL 739
           R   +   IF GL  Y+ + Y    + +++  +     ++++GG+  H +  KR+     
Sbjct: 33  RGFASRGGIFAGLVVYV-NGYTRPWDRLKLHAE-----IVKHGGEFCHYMSGKRQVT--- 83

Query: 740 RILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHCFSVSDDLMALAMR 796
            I+    T +  V   R Y ++S QWV+D ++  +++  +        DD   L ++
Sbjct: 84  HIIASNLTLKKFVEF-RNYKVVSAQWVVDSIQRGRLLPWQDYRVEGQGDDQQKLDLK 139

>ZYRO0D04664g Chr4 (387336..389789) [2454 bp, 817 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346W REV1
           Deoxycytidyl transferase forms a complex with the
           subunits of DNA polymerase zeta Rev3p and Rev7p involved
           in repair of abasic sites in damaged DNA
          Length = 817

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 23/108 (21%), Positives = 48/108 (44%), Gaps = 21/108 (19%)

Query: 688 IFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKISHNIVSKRESKSNLRILCGKYT 747
           IF G+  Y+       N   +  +  L ++++ NGGK +H + SK +           + 
Sbjct: 76  IFSGVSIYV-------NGFTKPGRMQLHEMVIANGGKFAHFLSSKGQVS---------HI 119

Query: 748 AECNVLIKR-----GYDILSPQWVIDCVENKKIVKIEPSHCFSVSDDL 790
              N+ +K+      Y I  P+W++D ++  K++  +     S  D++
Sbjct: 120 IASNLPLKKRVELANYKICRPEWIVDSLQRGKLLPWQDYALLSDQDEI 167

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
           YJL095W (REAL)
          Length = 1484

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 32/76 (42%), Gaps = 4/76 (5%)

Query: 235 WNPNIRLRHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMD 294
           WN    L H+E++  + Y  +P    KL +S      KLK    I E       Q+   D
Sbjct: 729 WNIKEVLSHEEIAPKMVYKTSP----KLELSLPDKANKLKIPTPITENESKSSFQVLRKD 784

Query: 295 YGNDIKFLSRRGVDYT 310
            G +I F  RR   YT
Sbjct: 785 EGTEIDFNHRRESPYT 800

>Kwal_23.4491 s23 (743016..745247) [2232 bp, 743 aa] {ON} YNL216W
           (RAP1) - repressor activator protein [contig 3] FULL
          Length = 743

 Score = 32.0 bits (71), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 41/92 (44%), Gaps = 19/92 (20%)

Query: 688 IFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKISHNIVSKRESKSNLRILCGKYT 747
           +F  L FY+  +           + DL++L+  NGG +   + S    KSN  ++  ++ 
Sbjct: 52  VFKDLHFYLAQE---------DGRQDLEELVKNNGGSVMPELPS---GKSNQELVVSRFN 99

Query: 748 AECNVLIKRGYDILSPQWVIDCVENKKIVKIE 779
                        ++P ++  C ENK ++K++
Sbjct: 100 T-------TNLPTVTPNYIKSCCENKVLMKVQ 124

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 101,338,451
Number of extensions: 4482485
Number of successful extensions: 12684
Number of sequences better than 10.0: 57
Number of HSP's gapped: 12820
Number of HSP's successfully gapped: 60
Length of query: 948
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 829
Effective length of database: 39,836,145
Effective search space: 33024164205
Effective search space used: 33024164205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)