Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A028508.844ON1042104247120.0
KNAG0G034408.844ON1053111017910.0
NCAS0B002808.844ON108192916170.0
TDEL0B005408.844ON111585515800.0
ZYRO0G14256g8.844ON125977015230.0
CAGL0B02365g8.844ON105093414960.0
SAKL0D01364g8.844ON108270213281e-165
KLTH0C03784g8.844ON99774412371e-153
Ecym_46158.844ON106780812201e-149
TPHA0I002708.844ON103959510851e-130
YML117W (NAB6)8.844ON113452510631e-126
Suva_13.268.844ON112245410621e-126
Smik_13.178.844ON113147210611e-126
Skud_13.248.844ON112846410591e-125
NDAI0E002708.844ON119839210221e-120
Kpol_1068.58.844ON10323299551e-111
TBLA0B032808.844ON13623099391e-107
Kwal_27.102398.844ON9144239171e-107
ABL122C8.844ON10435149011e-104
KLLA0D01485g8.844ON11512537977e-89
AFL061C6.183ON5232034136e-42
TBLA0B052106.183ON7102244191e-41
KNAG0M004306.183ON4431994042e-41
KLTH0H04906g6.183ON5691994103e-41
Kwal_27.111586.183ON5671994103e-41
Ecym_22336.183ON5761994103e-41
KLLA0E19031g6.183ON6521994115e-41
NDAI0F022606.183ON6801994101e-40
NCAS0H010406.183ON6292004071e-40
Kpol_1002.696.183ON5902034042e-40
SAKL0A05280g6.183ON5821994032e-40
CAGL0C01419g6.183ON6391994053e-40
KAFR0B066906.183ON5331993932e-39
TDEL0G016206.183ON5841993944e-39
Suva_16.1236.183ON5961993865e-38
Smik_6.3906.183ON6251993866e-38
ZYRO0G08140g6.183ON6321993868e-38
YPL184C (MRN1)6.183ON6121993858e-38
TPHA0J022106.183ON5932033812e-37
Skud_16.946.183ON6141993813e-37
ACR135C8.670ON37668830.36
KAFR0A038308.670ON37470800.64
Smik_9.2007.145ON24965790.69
KLLA0F24398g2.136ON1055101781.6
Skud_15.4098.670ON37170762.3
KAFR0H016208.466ON33043743.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A02850
         (1042 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...  1819   0.0  
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   694   0.0  
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     627   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   613   0.0  
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   591   0.0  
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   580   0.0  
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   516   e-165
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   481   e-153
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   474   e-149
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   422   e-130
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   414   e-126
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   413   e-126
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   413   e-126
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   412   e-125
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     398   e-120
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   372   e-111
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   366   e-107
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   357   e-107
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   351   e-104
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   311   7e-89
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   163   6e-42
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   166   1e-41
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   160   2e-41
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   162   3e-41
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   162   3e-41
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   162   3e-41
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   162   5e-41
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    162   1e-40
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   161   1e-40
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   160   2e-40
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   159   2e-40
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   160   3e-40
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   155   2e-39
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   156   4e-39
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   153   5e-38
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   153   6e-38
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   153   8e-38
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   152   8e-38
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   151   2e-37
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   151   3e-37
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    37   0.36 
KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {O...    35   0.64 
Smik_9.200 Chr9 complement(332149..332898) [750 bp, 249 aa] {ON}...    35   0.69 
KLLA0F24398g Chr6 complement(2271709..2274876) [3168 bp, 1055 aa...    35   1.6  
Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {...    34   2.3  
KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON...    33   3.3  

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
            Anc_8.844 YML117W
          Length = 1042

 Score = 1819 bits (4712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 909/1042 (87%), Positives = 909/1042 (87%)

Query: 1    MMRPSYSRKNSGFHIYQSQQPAQDQYYSAFDTTNPLMSYPQFEQPYGATFPPPLSSSTHF 60
            MMRPSYSRKNSGFHIYQSQQPAQDQYYSAFDTTNPLMSYPQFEQPYGATFPPPLSSSTHF
Sbjct: 1    MMRPSYSRKNSGFHIYQSQQPAQDQYYSAFDTTNPLMSYPQFEQPYGATFPPPLSSSTHF 60

Query: 61   QQTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTPXXXXXXXXXXXXXX 120
            QQTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTP              
Sbjct: 61   QQTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTPQQQYFLQQQFNTNN 120

Query: 121  XXGSSTPRKSFFXXXXXXXXXXXXXXXXXXXXFIIXXXXXXXXXXXXXXKEILEKLFTEP 180
              GSSTPRKSFF                    FII              KEILEKLFTEP
Sbjct: 121  NNGSSTPRKSFFKVSNRPISSRSSRFSEKRKSFIINNPTTNNSNNNNNNKEILEKLFTEP 180

Query: 181  INISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKNDSNTCD 240
            INISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKNDSNTCD
Sbjct: 181  INISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKNDSNTCD 240

Query: 241  IILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSLEFNIV 300
            IILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSLEFNIV
Sbjct: 241  IILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSLEFNIV 300

Query: 301  TRDATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKE 360
            TRDATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKE
Sbjct: 301  TRDATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKE 360

Query: 361  FGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATN 420
            FGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATN
Sbjct: 361  FGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATN 420

Query: 421  IXXXXXXXXXXXXXXXXXTFFHKXXXXXXXXXXXXXXXXXXXXXXADKLKGIKLKDISLD 480
            I                 TFFHK                      ADKLKGIKLKDISLD
Sbjct: 421  IQSSVSSEGNNNQNNNGSTFFHKNSINSLLSSESSVSIDEEVISIADKLKGIKLKDISLD 480

Query: 481  ILPRDYPEPEFNFSTDHLPNVTISVPTQLDQIPGTPRTQEIYINDMSPSFEGIDMMNSSS 540
            ILPRDYPEPEFNFSTDHLPNVTISVPTQLDQIPGTPRTQEIYINDMSPSFEGIDMMNSSS
Sbjct: 481  ILPRDYPEPEFNFSTDHLPNVTISVPTQLDQIPGTPRTQEIYINDMSPSFEGIDMMNSSS 540

Query: 541  TMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVAS 600
            TMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVAS
Sbjct: 541  TMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVAS 600

Query: 601  AMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXX 660
            AMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIE        
Sbjct: 601  AMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEAAAAVQFY 660

Query: 661  XXXFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPE 720
               FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPE
Sbjct: 661  ANAFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPE 720

Query: 721  FKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFD 780
            FKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFD
Sbjct: 721  FKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFD 780

Query: 781  RFNEKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFYKIRQNHNFKLSKLEEKRRDHDR 840
            RFNEKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFYKIRQNHNFKLSKLEEKRRDHDR
Sbjct: 781  RFNEKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFYKIRQNHNFKLSKLEEKRRDHDR 840

Query: 841  RENGFKHVYNDEETIYNESMETDNQHNEESKENDGKFLQLDSLGISLESKNEIADDINDA 900
            RENGFKHVYNDEETIYNESMETDNQHNEESKENDGKFLQLDSLGISLESKNEIADDINDA
Sbjct: 841  RENGFKHVYNDEETIYNESMETDNQHNEESKENDGKFLQLDSLGISLESKNEIADDINDA 900

Query: 901  LTVDQFENEKSITKNNGFENTSFHSDSSSDIELIINSPNSLRTKDNDVLDSEKIIXXXXX 960
            LTVDQFENEKSITKNNGFENTSFHSDSSSDIELIINSPNSLRTKDNDVLDSEKII     
Sbjct: 901  LTVDQFENEKSITKNNGFENTSFHSDSSSDIELIINSPNSLRTKDNDVLDSEKIINSANT 960

Query: 961  XXXXXXXXXYKNDYTKXXXXXXXXXXXXXXXXXXXTIPGSDVMAQYLAQLQHSTFMYAAN 1020
                     YKNDYTK                   TIPGSDVMAQYLAQLQHSTFMYAAN
Sbjct: 961  TNRTGNANGYKNDYTKNRNDGMRNNRSRNRSRYSRTIPGSDVMAQYLAQLQHSTFMYAAN 1020

Query: 1021 ILGASGEEEYYDEAELPTVNED 1042
            ILGASGEEEYYDEAELPTVNED
Sbjct: 1021 ILGASGEEEYYDEAELPTVNED 1042

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/1110 (42%), Positives = 595/1110 (53%), Gaps = 146/1110 (13%)

Query: 8    RKNSGFHIYQSQQPA--QDQYYSA-FDTTNPLMSYPQ----FEQ-----PYG-ATFPPPL 54
            ++N+  H Y    P   QD   +   + + P  +YPQ    F Q     P G  +   PL
Sbjct: 6    KRNNAQHGYNQNHPGFTQDSVNNRDAENSGPRPTYPQVMYQFNQNTHGYPQGTVSKQAPL 65

Query: 55   SSSTH-----FQQTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTPXXX 109
            S  +H     F Q +   SP+ N  PTPFDTAYGATLLPSHLLMGSPF     V TP   
Sbjct: 66   SQQSHPFPQNFAQNFPPNSPMTNGMPTPFDTAYGATLLPSHLLMGSPF-----VSTPNLP 120

Query: 110  XXXXXXXXXXXXXGSSTPRKSFFXXXXXXXXXXXXXXXXXXXXFIIXXXXXXXXXXXXXX 169
                         G +    S                                       
Sbjct: 121  QTNYTAQRKGSHTGMANGTGSM--------------------------------NYYRTD 148

Query: 170  KEILEKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYL 229
             +I+  LF  P  ISY ILPKGDD YRTRSLL  N+D+ ++LH+F++ FV+NNS+ES+Y+
Sbjct: 149  PQIINGLFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYI 208

Query: 230  VPNKNDSNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKT--- 286
                        +LSFLS  ICL+FYNNVLQRLKEFK+ L + SL L+FVS++   T   
Sbjct: 209  TKEGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVE 268

Query: 287  --------TRDNQG-PSLEFNIVTR-DATRSLAIELCSNENDSLILEKEQLFEKILNEIL 336
                      D  G  +L F++  +  ATRS+AIE    +   +IL +++L  K L  + 
Sbjct: 269  GKIYRRFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKD---VILTRDELLNKKLKFL- 324

Query: 337  RTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCS 396
             ++ N RY+LE I +  T    K FGKNYAI++FL+I MA+EIMDY+++   +L++ K  
Sbjct: 325  -SEGNNRYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFF 383

Query: 397  FVTI-QPLIENNVMNNSSALSSATNIXXXXXXXXXXXXXXXXXTFFHKXXXXXXXXXXXX 455
            +V +  P  ++   +     ++ T                    FF              
Sbjct: 384  YVQVTHPPQQSPAASQKKPHANDTE----SNRDTSPPNSKKDQEFFPNNSMLSLVSSESS 439

Query: 456  XXXXXXXXXXADKLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPT-QLDQIPG 514
                       +KLK I+L++ +L +   DYPEP F   ++H   +  S+P  Q   I G
Sbjct: 440  TSLADDVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGG 499

Query: 515  ------TPRTQEIYINDM-SP--SFEGIDMMNSSSTMLSGNGTFISNTP---MLIPSQSF 562
                  TPR    + ND+ SP  SF  +D+ +S+S      G FI  TP   M    Q  
Sbjct: 500  PQSSISTPRAFGAFPNDIGSPPASFLPLDLNHSNSVPNLPPG-FIPATPSGPMSPQQQQL 558

Query: 563  YMDQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKA 622
            ++  N+Q Q+       F HPITDSLE+Q+ TS +VA+AMGSD  NRTIYIGNINPRS+A
Sbjct: 559  FL--NSQRQQRDHAGGKFAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRA 616

Query: 623  EDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNY 682
            EDICNVVRGGILQ+IKFIE+KHICF+TFIE           FIDPIVLHGNTLKLGWG Y
Sbjct: 617  EDICNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTY 676

Query: 683  SGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSS 742
            +GPLPK IALAVTIGASRNVY+SLPE AFKDKYI DP+FK YHE FKLP  E LR DF  
Sbjct: 677  TGPLPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLH 736

Query: 743  YGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKFDERYNGLVINYGKDRC 802
            YG  EQIN L+DSHCCWVNFMNISSAI+LVE+A+   D FN+ FD RY GLVINYGKDRC
Sbjct: 737  YGSIEQINMLNDSHCCWVNFMNISSAIRLVEDASTKQDHFNQLFDHRYEGLVINYGKDRC 796

Query: 803  GNINKNLIAGKNSRFYKIRQNH--NFKLSKLEEKRRDHD--RRE--NGFKHVYNDEETIY 856
            GNIN+NL+AGK S+++K  + H  + +LS+LEEKRR+ D  RRE  NG         TI 
Sbjct: 797  GNINRNLVAGKTSKYHKKVKKHTRDVRLSQLEEKRRNQDAERREMVNG---------TIP 847

Query: 857  NESMETDNQHNEESKENDGKFLQLDSLGISL---ESKNEIADDINDALTVDQFENEKSIT 913
             E+       N  S E   + L LDSLGIS+   ES + I+  + D   ++   N     
Sbjct: 848  EENPFDAFAINTGSAEKKDE-LSLDSLGISIMEVESASPISPVMGD---LEDHTNGSYTD 903

Query: 914  KNNGFENTSFHSDSSSDIELIINSPN------SLRTKDNDVL----DSEKIIXXXXXX-- 961
                  N + +S SSSDIELIIN PN       +   D   L    D  K++        
Sbjct: 904  AGIAPLNYTNNSGSSSDIELIINPPNDPNRSVGVLEGDPSTLSPPSDKRKLVALHEVSSP 963

Query: 962  ---------XXXXXXXXYKNDYTKXXXXXXXXXXXXXXXXXXXTIP-------GSDVMAQ 1005
                             Y N+                       +P       GSDVMAQ
Sbjct: 964  PPPLAPDTISRQYAEASYHNELVTGNDHPDTGYGKAENGRHRQQLPRNARTIPGSDVMAQ 1023

Query: 1006 YLAQLQHSTFMYAANILGAS--GEEEYYDE 1033
            YLAQLQHSTFMYAAN+LGAS  G E+Y D+
Sbjct: 1024 YLAQLQHSTFMYAANVLGASNEGTEQYDDQ 1053

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/929 (40%), Positives = 533/929 (57%), Gaps = 91/929 (9%)

Query: 176  LFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKND 235
            LF +P  +SY ILP GDDAYRTRSLLFENV N+I LH+F+T FV+ + IES+YL+ N +D
Sbjct: 172  LFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLI-NHHD 230

Query: 236  SNTCD-------IILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTR 288
            S+  D       I+LSFL+R +CL FYNNVLQRLKEFK  L SE+L L+FVS+KY     
Sbjct: 231  SDKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDENE 290

Query: 289  DNQ-----------GPSLEFNIVTRDATRSLAIEL---CSNENDSLILEKEQLFEKILNE 334
            + +             S+ F +    ATRS+ I+    CS         +++LF+K L +
Sbjct: 291  EEETNIVDEPSFYTKESVYFELSNPQATRSILIQFKNPCS---------EQELFDKKL-K 340

Query: 335  ILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGK 394
             L  + N RY+LESIDLV+  ++  EF K+YAIL+F+NI MA+EI DY+++   +  I  
Sbjct: 341  FLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQD 400

Query: 395  CSFVTIQPLIENNVMNNSSALSSATNIXXXXXXXXXXXXXXXXXTFFHKXXXXXXXXXXX 454
            C FV + P   + V +  +++ S  N                     +            
Sbjct: 401  CMFVQVIPKAVSCVSSKRASIISKDN---DNNDETLSSQQKKNDILKNSSIISLPSAEND 457

Query: 455  XXXXXXXXXXXADKLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPTQLD---- 510
                       ++KLK   ++++ L +    YP P F    +HLPN T+S+ +  +    
Sbjct: 458  QVSDEEKLDKLSEKLKSTNIEELILIVDTATYPRPSFLSHDEHLPNATLSLSSSSNPFEQ 517

Query: 511  QIPGT----------PRTQEIYINDMSPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQ 560
            Q+P +           R+  +  N   P     +M N     +S N     NTP++ P+ 
Sbjct: 518  QLPYSYEEDDDQRTNVRSGSLPANPQFP-----NMPNLPKGYISPNPNMNYNTPLMYPNG 572

Query: 561  SFYMDQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRS 620
             F  D    +      + ++ +PI+ +LE   +T+++V +++G+DAGNRTIYIGNIN RS
Sbjct: 573  YFVNDPAFSMNNNYNNNTNYRNPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRS 632

Query: 621  KAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWG 680
            K EDICNVVRGGILQ++K+IE KHICF+TFIE           FIDPIVLH +TLK+GWG
Sbjct: 633  KVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWG 692

Query: 681  NYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDF 740
            NY  PLPK++ALAVT+GASRNVYVSLPEFAFKDK+INDPE++EYH+K+KLP  +QLRIDF
Sbjct: 693  NYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDF 752

Query: 741  SSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFD-RFNEKFDERYNGLVINYGK 799
            S YG  EQINYL DSHCCWVNF+NIS+AI+LVE+A N  + +F+EKF+ RY+GL+INYGK
Sbjct: 753  SKYGGIEQINYLKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGK 812

Query: 800  DRCGNINKNLIAGKNSRFYKIRQN--HNFKLSKLEEKRRDHDRRENGFKHVYNDEETI-- 855
            DRCGN+NK+L++ KNSRFYK  ++  +N KL +LEEKR+    R N  +   + +  +  
Sbjct: 813  DRCGNVNKSLMSNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSK 872

Query: 856  ---YNESMETDNQHNEESKENDGKFLQ--------LDSLGISLESKNEIADDINDA---- 900
               +   ++T + + E+     G  L          ++LG  +E K+++ ++  D     
Sbjct: 873  LDAFGIGIDTVSNNEEDGNIEKGNTLSKIDTDVNGFNALGFKIEPKHDMMNETMDNNTEG 932

Query: 901  ------LTVDQFEN--------EKSITKNNGFENTSFHSDSSSDIELIINSPNSLRTKDN 946
                  ++ D+  N        ++S+ K +   N   HS++  + +   +S N  R K+ 
Sbjct: 933  NNTLENISSDESSNIELMISSPKESVQKGDVITNQKPHSNNHHNFKRN-SSSNRQRYKET 991

Query: 947  DVLDSEKIIXXXXXXXXXXXXXXYKNDYTKXXXXXXXXXXXXXXXXXXXTIPGSDVMAQY 1006
            D  ++ +                +                          IPGSDVMAQY
Sbjct: 992  DTQNTHRNNNNSNATFAPNKEFGFGIS-PNVDEHQKNNKKHNTNDKEARVIPGSDVMAQY 1050

Query: 1007 LAQLQHSTFMYAANILGASGEE-EYYDEA 1034
            LAQLQHSTFMYAANILGAS E+  YYDE+
Sbjct: 1051 LAQLQHSTFMYAANILGASAEDGSYYDES 1079

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/69 (60%), Positives = 48/69 (69%), Gaps = 9/69 (13%)

Query: 33  TNPLMSYPQFEQPYGATFPPPLSSSTHFQQTYYKGSPLPNAPPTPFDTAYGATLLPSHLL 92
           TN ++ Y Q EQ     FP         QQ YY+ SPLPN PPTPFDTAYGATLLPSHLL
Sbjct: 47  TNSMLFY-QGEQARSQYFPT--------QQPYYQTSPLPNVPPTPFDTAYGATLLPSHLL 97

Query: 93  MGSPFISSP 101
           MGSPF+++P
Sbjct: 98  MGSPFVATP 106

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
           YML117W
          Length = 1115

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/855 (43%), Positives = 487/855 (56%), Gaps = 152/855 (17%)

Query: 175 KLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKN 234
           K F +P  ++Y +LPKG+D +RTRSLLFENVD +I+LHSF+TNF     +ES+YL   K+
Sbjct: 160 KRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLF--KS 217

Query: 235 DSNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKT-------- 286
           + +   I+LSF S+ ICLDFYN+VLQRL E+K  L+S++L L+FVSL+Y  +        
Sbjct: 218 EGDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVSDTSEEDID 277

Query: 287 TRDNQGP---------SLEFNIVTRDATRSLAIEL---CSNENDSLILEKEQLFEKILNE 334
             D+  P         SL ++++ R ATRS+ I     CS         K++L +K L E
Sbjct: 278 KEDDSKPDAFNITAAGSLRYDVINRGATRSIMITFKTPCS---------KDELIDKKL-E 327

Query: 335 ILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGK 394
            L+ + N RYVLESIDLV+ D+ +K F +NYA+L+FLNI MA+EI+DYI++ S KL+I K
Sbjct: 328 FLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISK 387

Query: 395 CSFVTIQPLIENNVMNNSSALSSATNIXXXXXXXXXXXXXXXXXTFFHKXXXXXXXXXXX 454
           C F++IQP I +       ++SSA+N                  T               
Sbjct: 388 CFFISIQPQIPDG---KRLSVSSASNGRSMESISGNYRSKNASVTSLESSGSIISLDQEI 444

Query: 455 XXXXXXXXXXXADKLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPTQLDQIPG 514
                        KL+ +  K   L++   +Y +P F   TDHL NVT+S    LD    
Sbjct: 445 DEMTY--------KLQSVNSKKNILEVTTNNYKDPSFEGHTDHLTNVTVSEAASLDSQLT 496

Query: 515 TPRTQEIYIN-------------DM--SPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPS 559
            P  QE+ +N             DM  +PS + +D +  S   +S     + NTP     
Sbjct: 497 MPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDVDAVPPSMVPMST----MPNTPY---- 548

Query: 560 QSFYMDQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPR 619
              YM      Q       +   PIT SL+ Q +TSA+VAS+MG   GNRT+YIGNI+PR
Sbjct: 549 -GCYMPPPNVRQNG-----NMTKPITQSLQRQYATSAEVASSMGGGIGNRTVYIGNIHPR 602

Query: 620 SKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGW 679
           S+ EDICNVVRGGILQ++KF+  K ICFVTF+E           FIDPIVLHGN LK+GW
Sbjct: 603 SRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAFIDPIVLHGNMLKVGW 662

Query: 680 GNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRID 739
           G++SGPLPKSIALAVT+GASRNVYVSLPEFAFKDKYI DP+++EY++KF+LPD EQLR D
Sbjct: 663 GHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEYNKKFRLPDEEQLRDD 722

Query: 740 FSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFD-RFNEKFDERYNGLVINYG 798
           FS YG  EQINYL+D HCCWVNF NIS+AIKLVEE   +    F +    RY+GLVI YG
Sbjct: 723 FSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGNFYKMLGGRYDGLVIGYG 782

Query: 799 KDRCGNINKNLIAGKNSRFYKI--RQNHNFKLSKLEEKRRDHDRRENGFKHVYNDEETIY 856
           KDRCGN+NKN IAGKNSRFYK   + + N +LSK+EE+RR H+                 
Sbjct: 783 KDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSKMEEERRQHE----------------- 825

Query: 857 NESMETDNQHNEESKENDGKFLQLDSLGISLESKN----EIADDIN--DALTVDQFENEK 910
            E++    ++N E      KFLQ  SLGI+++S      E  DD++  D +  D    +K
Sbjct: 826 -ETLRRQQENNSE------KFLQFGSLGITIDSNGKEDPEKVDDVDFEDEVKFDSNSPKK 878

Query: 911 SITKNNGFEN-----------------------------------------------TSF 923
           ++ + +G E+                                               TS 
Sbjct: 879 TVEQASGKESDQEEQELLKLSNKSQGAQGLNIVESQGQSTREKEATKLTRNHSENDETSA 938

Query: 924 HSDSSSDIELIINSP 938
            SD+SSD+ELIINSP
Sbjct: 939 KSDASSDVELIINSP 953

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/43 (76%), Positives = 36/43 (83%)

Query: 61  QQTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103
           Q  YY   P+ NAPPTPFDTAYG TLLPSHLLMGSPF+SSPN+
Sbjct: 44  QPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNL 86

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (87%), Gaps = 2/40 (5%)

Query: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGAS--GEEEYYDE 1033
            +IPGSDVMAQYLAQLQHSTF+YAANILGAS  G+  Y DE
Sbjct: 1072 SIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDE 1111

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/770 (42%), Positives = 465/770 (60%), Gaps = 97/770 (12%)

Query: 171 EILEKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLV 230
           E  +K+F EP  ++Y +LPKGDD YRTRSLLFENV+ +++L+SF++ + +   +ESIY+ 
Sbjct: 205 EQADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMF 264

Query: 231 PNKNDSNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDN 290
            ++ND     ++LSFLSR ICLD YN+VLQRL EFK  L S+SL ++FVSLKY K   +N
Sbjct: 265 KDRNDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDEN 324

Query: 291 QG---------------------------------------PSLEFNIVTRDATRSLAIE 311
           +                                         SL+++IV R ATRS+A+E
Sbjct: 325 EVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALE 384

Query: 312 LCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFL 371
           L    + + +L++E  F       L    N+RYVLESI L++  +  K F KNYAIL+FL
Sbjct: 385 LDGEYDKTKLLDQELDF-------LSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFL 437

Query: 372 NITMAIEIMDYIQV-ISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATNIXXXXXXXXX 430
           NI+MA+E++DY++   +++    KC FV++    + +  ++   ++++ +I         
Sbjct: 438 NISMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTS--SDGGIVTTSNSITPVASGGSA 495

Query: 431 XXXXXXXXTFFHKXXXXXXXXXXXXXXXXXXXXXX--ADKLKGIKLKDISLDILPRDYPE 488
                     +                          +  LKG     +++D    +YP+
Sbjct: 496 GIATNGDLGGYTSKNASLSSLNSVGSYISLDQEIDFLSSSLKGSHTITVAVD----EYPK 551

Query: 489 PEFNFSTDHLPNVTISVPTQLDQIPGTPRTQEIYINDM-SPSFEG---IDMMNSSSTMLS 544
           P F   +DHL N ++   + LD    +P  QE+ +    SP   G   +D ++ ++T   
Sbjct: 552 PFFAEFSDHLSNASVLEASALDTQISSPHPQEVIVPSQDSPLVGGAPPLDAVHPAATP-- 609

Query: 545 GNGTFISNTPMLIPSQSFYMDQNTQIQEAPF--RSNSFIHPITDSLENQLSTSAKVASAM 602
                 + +  ++P Q  +M  N+ I   PF  R+ + I PIT SL+ Q +TSA+VA++M
Sbjct: 610 ------ALSSQVLPLQP-HMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSM 662

Query: 603 GSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXX 662
           G   GNRT+YIGNI+PRSK EDICNVVRGGILQSI+F++ KHICFVTFIE          
Sbjct: 663 GGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTN 722

Query: 663 XFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFK 722
            FIDPIVLHGN LK+GWG++SGPLPKS++LAVT+GASRNVYVSLP+FAFKDKYINDP+++
Sbjct: 723 AFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQ 782

Query: 723 EYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEAT-NDFDR 781
            Y +++KLP  EQLR DF+ +G  EQIN+LSD HCCWVNFMNISSAIKLVEE   ND + 
Sbjct: 783 RYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEA 842

Query: 782 FNEKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFYK--IRQNHNFKLSKLEEKRRDHD 839
           F++ FD RY GL+I YGKDRCGN+NKNLI+GKNSRFYK   + ++N +LS++EE+R+ H+
Sbjct: 843 FHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEEERKKHE 902

Query: 840 RRENGFKHVYNDEETIYNESMETDNQHNEESKENDGKFLQLDSLGISLES 889
                             E++ + NQ+N+E      K LQ  SLGI LE 
Sbjct: 903 ------------------ETLRSQNQNNDE------KMLQFGSLGIHLEG 928

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/40 (77%), Positives = 36/40 (90%), Gaps = 2/40 (5%)

Query: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGAS--GEEEYYDE 1033
             IPGSDVMAQYLAQLQHSTFMYAANILGA+  G+ +YY++
Sbjct: 1216 AIPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYED 1255

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 41/60 (68%), Gaps = 5/60 (8%)

Query: 49  TFPPPLSSSTHF---QQTYYK--GSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103
            FPP  S    +   Q  YY   G PL N PPTPFDTAYG TLLPSHLL+GSPF+SSP++
Sbjct: 53  AFPPVGSLQAQYAPPQPAYYAAAGPPLMNPPPTPFDTAYGITLLPSHLLIGSPFVSSPDL 112

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] {ON}
            some similarities with uniprot|Q03735 Saccharomyces
            cerevisiae YML117w
          Length = 1050

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/934 (40%), Positives = 518/934 (55%), Gaps = 125/934 (13%)

Query: 171  EILEKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNS-IESIYL 229
            ++ +KL + PI+I+Y +LP GDD Y+TRSLLFENV     + S     + N S +ES+Y+
Sbjct: 161  DVTKKLIS-PISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYV 219

Query: 230  -----VPNKN---DSNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSL 281
                  P+K+   D +TC + LSFLSR   LDFYNN LQRL +FKK L+S  L+++FVS 
Sbjct: 220  FQQTDTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVSF 279

Query: 282  KY-------------------NKTTRDNQG----PSLEFNIVTRDATRSLAIELCSNEND 318
             Y                    +  + +Q     P+L   I + DATRS+AIE  S    
Sbjct: 280  SYVTDEDKDKDKDKDKDINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQ--- 336

Query: 319  SLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIE 378
               +E++ LFEK+    L   +NKRY+LE++D++S + +  +F  NY IL+F+NI MAIE
Sbjct: 337  ---VEQDALFEKL--PFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIE 391

Query: 379  IMDYIQVISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATNIXXXXXXXXXXXXXXXXX 438
            ++DY++      ++ +C FV++ P  ++   ++++ +    +                  
Sbjct: 392  VLDYLKANLMTYSVNECFFVSL-PGCKSQRESSTTPVLGHISTEGSKSVSEVNLANGGNT 450

Query: 439  TFFHKXXXXXXXXXXXXXXXXXXXXXXADKLKGIKLKDISLDILPRDYPEPEFNFSTDHL 498
                +                      +D+L  +KL++  L I+  DYP+PE     DH+
Sbjct: 451  VMIDRELESL-----------------SDELASLKLEEKCLKIIRSDYPKPEIRSHDDHI 493

Query: 499  PNVTISVPTQLDQIPGTPRTQEIYIND---------MSPSFEGIDMMNSSSTMLSGNGTF 549
            P  T       D          +Y++D          SP    ID  + S  ML  NG  
Sbjct: 494  PGSTNFSMYIFDDGMNPEGNSGMYLHDNLTDHSSIIGSPFSNYIDP-SISHVMLPNNGLP 552

Query: 550  IS--NTPMLIPSQSFYMDQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVASAMGSDAG 607
            +   + P   P +         I   PF   + +  IT S+E++L+TSA++A+AMG DA 
Sbjct: 553  VGGFDAPGKFPIEP--------ISGPPFNHTNKV--ITQSIEDRLNTSARIAAAMGGDAD 602

Query: 608  NRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFIDP 667
            NRT+YIGNINPRSK EDICNVVRGGILQ++KFIE K ICFVTFIE           FIDP
Sbjct: 603  NRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEASAAAQFCANSFIDP 662

Query: 668  IVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEK 727
            IVLHGNTL++GWGN SGPLPKSIALAVT+GA+RNVYVSLPE+AFKDK+INDP++KEYHE+
Sbjct: 663  IVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDKFINDPKYKEYHER 722

Query: 728  FKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEAT-NDFDRFNEKF 786
            +KLP  EQLR DF++YG  EQINYL DSHCCWVNF+NI+SAI+LVE+   N+ + F++KF
Sbjct: 723  YKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVEDINHNNGEEFHKKF 782

Query: 787  DERYNGLVINYGKDRCGNINKNLIAGKNSRFYKI--RQNHNFKLSKLEEKRRDHD----- 839
            + RY GL+INYGKDRCGNINKNLIAGK S+FYK   + +++ ++ K+EEKR+  +     
Sbjct: 783  NNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVKKPSYDIRIKKMEEKRKMQEDNLLS 842

Query: 840  RRENGFKH---VYNDEETIYNESMETDNQHNEESKENDGKFLQLDS-------------- 882
            +++N  +      + + T  NES  +      E  EN G    L+S              
Sbjct: 843  QKKNSIQLDSLGISVDRTFSNESKLSGGHTTTE--ENGGVKQDLESNDYKSDHPQISSNG 900

Query: 883  -LGISLESKNE-IADDIN--DALTVDQFENEKS---ITKNNGFENTSFHSDSSSDIELII 935
             +GI L SK   I DDI+  D   +  FEN  S    + +  ++ T+   D+      + 
Sbjct: 901  PIGIGLSSKKSPIFDDISGSDESVISDFENSASKETSSSDRKYQTTNSRGDTFVPKTNLS 960

Query: 936  NSPNSLRTKDNDVLDSEKIIXXXXXXXXXXXXXXYKNDYTKXXXXXXXXXXXXXXXXXXX 995
            ++P    +  N      K I              Y   Y +                   
Sbjct: 961  HAPPRAPSTINMTY---KKISYVPPLNGQAPKMDYPKKYKRTHNNFPNQQPTR------- 1010

Query: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGASGEEE 1029
             IPGSDVMAQYLAQLQHSTFMYAANILGAS E E
Sbjct: 1011 PIPGSDVMAQYLAQLQHSTFMYAANILGASVETE 1044

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%)

Query: 68  SPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVP 104
           SP  N PPTPFDTAYGA+LLPSHLLMGSP IS+ N+P
Sbjct: 44  SPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLP 80

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  516 bits (1328), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 310/702 (44%), Positives = 406/702 (57%), Gaps = 115/702 (16%)

Query: 178 TEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKNDSN 237
           +EP  I++ ILPKGDD Y TRSLL  NV+ +I LH FIT FVK   IES+Y+VP + +  
Sbjct: 180 SEPYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPEEEEEE 239

Query: 238 TC---------------------DIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNL 276
                                   I+LSFL+++ CLDFYNNVLQ+L +FK  LNS+SL L
Sbjct: 240 EEEEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTL 299

Query: 277 NFVSLKYNKTTRDNQGPSLEFNIVTRDATRSLAIELCSNENDSLILEKEQLFEKILNEIL 336
           NFVSL    T+ D     +  +++ + ATRS+A+E  ++         +QL E I  EIL
Sbjct: 300 NFVSL----TSED-----IRDDVLRKGATRSIALEFKNS------FTTKQL-ESI--EIL 341

Query: 337 RTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCS 396
               N R+V+E ID+V+T+  NK F  +YAI+ F++I+MA+E   Y+     KL I +  
Sbjct: 342 SNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYLLNWDEKLGISRLF 401

Query: 397 FVTIQPLIENNVMNNSSALSSATNIXXXXXXXXXXXXXXXXXTFFHKXXXXXXXXXXXXX 456
           FVT      ++++N S    SA                    T                 
Sbjct: 402 FVT------DSIINKSDYFRSAPASQDASRSSVSIDQTLEFAT----------------- 438

Query: 457 XXXXXXXXXADKLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPT--------- 507
                      KL+G+ LK+ +L I P+ YP+ E      HL +++IS P          
Sbjct: 439 ----------KKLQGLVLKERTLSIKPKTYPQAEIEEHQHHLTSISISKPLLSSNNNSSS 488

Query: 508 ---QLDQ-IPGTPRTQEIYINDMSPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFY 563
              Q +Q +  +P TQE+Y++D S S     M+ SS  M SG   F+       P   +Y
Sbjct: 489 VSLQGNQNLTSSPVTQEMYLHDTSNSTREDVMIQSS--MASGTSNFVP------PPPHYY 540

Query: 564 MDQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAE 623
           MD                 PI  +L+ QL+T+A+VAS MG   GNRT+Y+GNINPRSK E
Sbjct: 541 MD--------------VTKPIRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNINPRSKPE 586

Query: 624 DICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYS 683
           DICNVVRGGILQ IKF E KH+CFVTFIE            I+PIVLHGN LK+GWG++ 
Sbjct: 587 DICNVVRGGILQHIKFFEHKHVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKVGWGHHP 646

Query: 684 GPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSY 743
           G L +SIALAVTIGASRNVYVSLPE+AFKDK+I DPEF+E+ EK++LP  EQLR DFS++
Sbjct: 647 GDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNF 706

Query: 744 GPTEQINYLSDSHCCWVNFMNISSAIKLVEEATN-DFDRFNEKFDERYNGLVINYGKDRC 802
           G  EQINYL D HCCWVNFMNI+SAIKLVE+A   D  +F+  + +RY GL+I YGKDRC
Sbjct: 707 GEIEQINYLDDGHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRC 766

Query: 803 GNINKNLIAGKNSRFYKIRQNHNFKLSKLEEKRRDHDRRENG 844
           GN+NKNL+A K SRF+K       K+ K   K R H + + G
Sbjct: 767 GNVNKNLVANKKSRFFK-------KVKKASYKIRMHKQNKAG 801

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 56/100 (56%), Gaps = 9/100 (9%)

Query: 4   PSYSRKNSGFHIYQSQQPAQ--DQYYSAFDTTNPLMSYPQFEQPYGATFPPPLSSSTHFQ 61
           P+Y  KN   H Y +  P      +Y      +P+        P      P +  S   Q
Sbjct: 2   PNYQNKNYSSHQYATMAPPNGIQPHYPQTMAYHPM-------GPMNGGVQPTMQMSLPSQ 54

Query: 62  QTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSP 101
           Q YY GSP+P+AP TPFDT+YGATLLPSHLLMGSPFIS+P
Sbjct: 55  QGYYAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTP 94

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/42 (73%), Positives = 33/42 (78%), Gaps = 4/42 (9%)

Query: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGAS-GEEE---YYDE 1033
             IPGS VMAQYLAQLQHSTFMYAANILG + G+ E    YDE
Sbjct: 1033 AIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDE 1074

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  481 bits (1237), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 302/744 (40%), Positives = 420/744 (56%), Gaps = 107/744 (14%)

Query: 183 ISYVILPK----GDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKNDSNT 238
           + + ILP+    G D Y TRSLLF N++   +LH F+T F K + +ES+YLV    DS  
Sbjct: 138 VVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLV----DSQQ 193

Query: 239 CDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSLE-- 296
             +++SFL++  CLDFYN VLQ+L EFKK L S+ L LNF SL+  KT     GP+L+  
Sbjct: 194 QSVLVSFLTKETCLDFYNGVLQKLSEFKKELKSKELTLNFASLRDVKT-----GPTLQEI 248

Query: 297 -FNIVTRDATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTD 355
              ++   ATRSL +E   ++ D  +L K   F  I+NE        RYV+E+I++V+  
Sbjct: 249 KIEVLRAGATRSLILEF-QDKVDLALLSKSLGF--IVNE------GPRYVVEAIEIVNAG 299

Query: 356 KSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCSFVTIQPLIENNVMNNSSAL 415
           +S+K FG +YAI+ F++I MA+E ++Y++  S+KL            LI+   +N +SA 
Sbjct: 300 RSSKHFGPHYAIIHFISIAMALETVEYLKSQSNKL----------AGLIKFRYVNTTSAS 349

Query: 416 SSATNIXXXXXXXXXXXXXXXXXTFFHKXXXXXXXXXXXXXXXXXXXXXXADKLKGIKLK 475
             +                    +                            KL+   L 
Sbjct: 350 GKSEFQTLSSSQLNERALSNTSDS---------------DISGGESVASLGSKLQQTSLG 394

Query: 476 DISLDILPRDYPEPEFNFSTDHLPNVTISVP----TQLDQIPG---TPRTQEIYINDMSP 528
           + +L + P  Y  P     ++HLP+VTIS      + L+ +     +P+ QE+ +ND   
Sbjct: 395 EQTLVVDPTQYGRPLVEERSEHLPHVTISKALNSKSSLNDLTSNTTSPQPQEVLVNDHED 454

Query: 529 SFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNSFIHPITDSL 588
           S     M+    ++   N    +  P  IP   FYM+ +               P+  +L
Sbjct: 455 SSSRGSMV----SLKQANSHGPAYPP--IPGYPFYMNMSK--------------PLGQTL 494

Query: 589 ENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFV 648
           + Q +T+A+VA+AMG   GNRT+YIGNI+PRSK EDICNVVRGGILQS+K+IE+KHICFV
Sbjct: 495 QQQYTTTAQVATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFV 554

Query: 649 TFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPE 708
           TFIE            I+PIVLHGN LK+GWG++SG LP+SI+LAVTIGASRNVYVSLPE
Sbjct: 555 TFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPE 614

Query: 709 FAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSA 768
            AFKDK+I DPE++E+ EKF+LP  EQL  DFS +G  E +N+L D HCCW+NFMNIS+A
Sbjct: 615 HAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNA 674

Query: 769 IKLVEEATN-DFDRFNEKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFYK--IRQNHN 825
           IKLVE+A N + D F+EKF  RY GL I YGKDRCGN+NKNL+A KNS+++K   + ++N
Sbjct: 675 IKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYFKKVKKASYN 734

Query: 826 FKLSKL-------------EEKRRDHDRRENGFKHVYNDEETIYNESMETDNQHNEESKE 872
            +L K              E K  D   + + F     D + +  +S       +EE K 
Sbjct: 735 IRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISVGDTQNLVRDS-------DEEQKL 787

Query: 873 NDGKFLQLD-------SLGISLES 889
            + + L+L         LGISL S
Sbjct: 788 EEDELLRLSDLNNTGGGLGISLAS 811

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 33/39 (84%), Gaps = 1/39 (2%)

Query: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGA-SGEEEYYDE 1033
             IPGSDVMAQYLAQLQHSTFMYAANILG   GE  +YDE
Sbjct: 950  AIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDE 988

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/40 (62%), Positives = 33/40 (82%)

Query: 64  YYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103
           YY G+ +P AP TPFDT+YG +LLPSHLLM SPF+++P +
Sbjct: 39  YYHGNRVPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGM 78

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  474 bits (1220), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 311/808 (38%), Positives = 435/808 (53%), Gaps = 111/808 (13%)

Query: 178 TEPINISYVILPKGDDAYRTRSLLFENVDNAIN--LHSFITNFVKNNSIESIYLVPNKND 235
           +EP  +++ ILPKG D Y TRSLLF N++   N  +H+F+TNF+K   IESIYL+   +D
Sbjct: 156 SEPYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL---DD 212

Query: 236 SNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSL 295
           S++  I+LSFL++  CLDFYNN+LQR  EFK  L+S  L+++FV        R      L
Sbjct: 213 SHS--ILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVCQDETNWFR-----LL 265

Query: 296 EFNIVTRDATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLV-ST 354
           + N+VTR  TRSL IE    E+ S+ L  + + EKI         + R+V+E IDLV + 
Sbjct: 266 QMNVVTRGVTRSLCIEF---EDQSMELTSDLIHEKIPWLFF----SHRFVIERIDLVNAA 318

Query: 355 DKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSK--LNIGKCSFVTIQP----LIENNV 408
              N+ F   Y ++ F+ I+MA+E+ +Y+Q  S K  L I K  FV +      L + + 
Sbjct: 319 APKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGISKIQFVNVNGHSSDLSDEDA 378

Query: 409 MNNSSALSSATNIXXXXXXXXXXXXXXXXXTFFHKXXXXXXXXXXXXXXXXXXXXXXADK 468
           +  ++ L   +                     FH                          
Sbjct: 379 VAAANGLQRESRTSSVSSISLPISNSSDLVELFHSLD----------------------- 415

Query: 469 LKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPTQLDQIPGTPRTQEIYINDMSP 528
              + L  ISL ++P +YP P      DHL +VTIS P++      T  T  + ++    
Sbjct: 416 ---LALGIISLQVIPSEYPVPLIESHDDHLHSVTISRPSKTL----TSSTSLVEMDGGPN 468

Query: 529 SFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNS--------- 579
                        +L  + +   NTP ++P++   ++ NT +   P              
Sbjct: 469 GGTPNGSNAMQGVLLLSDPSSDGNTPSMLPNE---LNINTSLMPGPMGGQVLGTSQSLSL 525

Query: 580 -------------FIHPITDSLENQ-LSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDI 625
                        F+ P++ +  NQ L       +     + NRT+YIGNI+PRSK EDI
Sbjct: 526 HNPNDNGGAGPSYFMDPMSGAPINQALQRQYLTGTGQVGGSNNRTVYIGNIHPRSKPEDI 585

Query: 626 CNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGP 685
           CNVVRGGILQ+IK+I SK ICFVTFIE            ++PIVLHGN L++GWG  SG 
Sbjct: 586 CNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGE 645

Query: 686 LPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGP 745
           LPK+IALAVTIGASRNVYVSLPE++FK+KYIN+PEFKEYH K+KLP  EQLR DF+ YG 
Sbjct: 646 LPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQ 705

Query: 746 TEQINYLSDSHCCWVNFMNISSAIKLVEEATN----DFDRFNEKFDERYNGLVINYGKDR 801
            EQINYL D HCCWVNFMNI+ AI+LVE+  +    + ++F+ +FD RY  L+I YGKDR
Sbjct: 706 VEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDR 765

Query: 802 CGNINKNLIAGKNSRFYKIRQNHNFKLSKLEEKRRDHDRREN--GFKHVYNDEETIYNES 859
           CGN+NKNL A KNSRF+K       K+ KL    + + R+++  G     +D+    + S
Sbjct: 766 CGNVNKNLTANKNSRFFK-------KIKKLNCTTKPNKRQQSKRGTSSASSDDARKDDAS 818

Query: 860 METDNQHNEES------KENDGKFLQLDSLGISLESK--NEIADDINDALTVDQFENEKS 911
            E     ++E         ND   L  + LGISL S   NE  DDI+      +  N+K+
Sbjct: 819 TEKVPVSSKEPVCDEILGLNDDNALA-EGLGISLSSAYVNEYGDDIS------KRTNKKN 871

Query: 912 ITKNNGF-ENTSFHSDSSSDIELIINSP 938
            +K     E+T + +  SSDI++I+  P
Sbjct: 872 RSKTETVEEDTGYTTSGSSDIDIIVAPP 899

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/35 (65%), Positives = 28/35 (80%)

Query: 70  LPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVP 104
           +P  P TPFD  YGA+LLPSH+LMGSPF+S+P  P
Sbjct: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRP 113

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/29 (68%), Positives = 24/29 (82%)

Query: 997  IPGSDVMAQYLAQLQHSTFMYAANILGAS 1025
            I G DVM+QYL QL HSTF+Y+ NILGA+
Sbjct: 1023 IAGQDVMSQYLEQLHHSTFLYSTNILGAT 1051

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  422 bits (1085), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 247/595 (41%), Positives = 341/595 (57%), Gaps = 82/595 (13%)

Query: 466  ADKLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPTQLDQIPGTPRTQEIYIND 525
            A+KL  ++++  + ++   +Y  P      +HLPNV+IS            R   IY N 
Sbjct: 498  ANKLSELEIQTHTFNLDISNYSNPHIEIRAEHLPNVSIS------------RDPMIYANP 545

Query: 526  M--SPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNSFIHP 583
            +  SP    ++ M +++  LS +                Y +         + +  +  P
Sbjct: 546  IYQSPPSGYMENMWTTTPFLSSHIV-----------HEEYANDRVDYNMKHYNNQLYNVP 594

Query: 584  ITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESK 643
            +  +L++Q +TSA++AS MG   GNRTI+IGNINPRSK EDICNV RGGI+Q +K+I  K
Sbjct: 595  LPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREK 654

Query: 644  HICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVY 703
            +ICFV FI+           FIDPI+LH NTLK+GWG++ GPLPK+I LAVT GASRNVY
Sbjct: 655  NICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVY 714

Query: 704  VSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFM 763
            VSLPEFAFKDKYINDP +KEYH K+ LP  +QLR DFS +G  EQIN+L D HCCW+NF 
Sbjct: 715  VSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFT 774

Query: 764  NISSAIKLVEEATN-DFDRFNEKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFY-KIR 821
            NI SAIKLVE   N D + F+E++  RY GL+I YGKDRCGN+NK+L++ KNSR++ K++
Sbjct: 775  NIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVK 834

Query: 822  Q-NHNFKLSKLEEKRRDHDRRENGFKHVYNDEETIYNESMETDNQHNEESKENDGKFLQL 880
            + ++N +L +LEE+R+                              N+E K+ D K + L
Sbjct: 835  KPSYNIRLQQLEEERK-----------------------------RNDEIKQIDNKRINL 865

Query: 881  DSLGISLESKNEIADDINDALTVDQFENEKSITKNNGFENTSFHSD-------SSSDIEL 933
            DSLGI+      I +D  + L++ + +    +T + GF+N+   SD       SS+D+EL
Sbjct: 866  DSLGITTSPNQNIQED--ETLSLAKLK----LTSDTGFKNSENESDIDDSASNSSTDVEL 919

Query: 934  IINSP-NSLRTKDN--------DVLDSEKIIXXXXXXXXXXXXXXYKNDY--TKXXXXXX 982
            IINSP N  ++  N        D+ +  K+                 +DY  T       
Sbjct: 920  IINSPGNGFKSHRNRKPKPNNLDLGERPKVDAIVFKADGPMAPNKLSHDYHRTHNTRVDN 979

Query: 983  XXXXXXXXXXXXXTIPGSDVMAQYLAQLQHSTFMYAANILGASGEE-EYYDEAEL 1036
                          IPGSDVM+QYLAQ+QHSTFMYAAN+L AS EE E+YDE ++
Sbjct: 980  PRSERTRKRTHKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEEPEFYDENDI 1034

 Score =  171 bits (434), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 104/249 (41%), Positives = 148/249 (59%), Gaps = 25/249 (10%)

Query: 170 KEILEKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYL 229
           +E+ E+       ISY ILPKGDD Y TRSLLFEN++ +I+LH+FI  FV    IES+Y+
Sbjct: 199 REVFEEESAIAYKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYV 258

Query: 230 VPN--KNDSNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKY--NK 285
           VP+   + ++   I+LSF SR ICLDFYN+VLQ+L E+K  LNSE+L L+FVSL Y  N 
Sbjct: 259 VPSYETHQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNN 318

Query: 286 TTRDNQGPSLE---------------FNIVTRDATRSLAIELCSNENDSLILEKEQLFEK 330
             + N   S+E               + +    ATRSL IE      D  + + +   E 
Sbjct: 319 INKGNGKISVESQKNETDFELTSLIQYQVANFGATRSLCIEF-----DKRVDKIDDFIET 373

Query: 331 ILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKL 390
            L   L ++ NKRY++ES+ +V+ +  + EF  +Y ILSFLNI+M IE++ YI+  +   
Sbjct: 374 YL-PFLSSNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSK 432

Query: 391 NIGKCSFVT 399
            I  C +V+
Sbjct: 433 TIKNCLYVS 441

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 50/104 (48%), Gaps = 19/104 (18%)

Query: 1   MMRPSYSRKNSGFHIYQSQQPAQDQYYSAFDTTNPL-MSYPQFE-QPYGATFPPPLSSST 58
           M  P Y+ +N G+    S+      +       +P+  SY Q+E  PY            
Sbjct: 50  MNPPPYNFQNRGYKHGTSENHMYSNHQGLSQLDSPINSSYSQYESHPY------------ 97

Query: 59  HFQQTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPN 102
           H QQT     P      TPFD AYG TLLPSH+LM SPF+S+PN
Sbjct: 98  HSQQTPLPNPPP-----TPFDYAYGTTLLPSHILMNSPFVSTPN 136

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score =  414 bits (1063), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 254/525 (48%), Positives = 314/525 (59%), Gaps = 59/525 (11%)

Query: 466  ADKLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPT----QLDQ-IPG-TPRTQ 519
            A KL+G++L    L+I  RDY  P     + HL NV IS  T    Q  Q IP   P  +
Sbjct: 528  ATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNE 587

Query: 520  EIYINDMSPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNS 579
             +++ND + S                NG  I    +  PS    +  N Q+ +       
Sbjct: 588  HMFMNDSNQS----------------NGAIIPQQLIATPSP---VSPNLQMNQ-----RV 623

Query: 580  FIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKF 639
              +PIT SLE   + SAKVAS+MGSD GNRTIYIGNINPRSKAEDICNVVRGGILQSIK+
Sbjct: 624  LPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKY 683

Query: 640  IESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGAS 699
            I  K ICFVTFIE           FIDPIVLHGN L++GWG+YSGPLPK I+LAVTIGAS
Sbjct: 684  IPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGAS 743

Query: 700  RNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCW 759
            RNVYVSLPEFAFK+K+I+DP++K+ HE   LPD EQLR DFS+YG  EQINYLSDSHCCW
Sbjct: 744  RNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCW 803

Query: 760  VNFMNISSAIKLVEEATNDFDRFN------------EKFDERYNGLVINYGKDRCGNINK 807
            +NFMNISSAI LVEE   +    N            EKF  RY GL+INYGKDRCGNINK
Sbjct: 804  INFMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINK 863

Query: 808  NLIAGKNSRFYK--IRQNHNFKLSKLEEKRRDH--DRRENGFKHVYNDEETIYNESMETD 863
            NLIAGKNSRFYK   R ++N +LSKLEEKRR +  D +E  F    N E    +     D
Sbjct: 864  NLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDEKEKAFDKPLNLESLGISLDAHKD 923

Query: 864  NQHNEESKENDGKFLQLDSLGISLESKNEIADDINDALTVDQFENEKSITKNNGFEN--- 920
            N   E    N+        L    E+ NE        L V   + +++ +    +E+   
Sbjct: 924  NGGGETGTANNTGHENESELEAENENGNETGSFGGLGLAVASSDVKRATSDETDYEDIFN 983

Query: 921  -TSFHSDSSSDIELIINSPN---------SLRTKDNDVLDSEKII 955
             +S  SDSSSD+E+I++SP+         +LR+    V++S++ +
Sbjct: 984  KSSGSSDSSSDVEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPV 1028

 Score =  214 bits (545), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 170/277 (61%), Gaps = 42/277 (15%)

Query: 174 EKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNK 233
           E L   P  I+Y +LP GDDAYRTRSLL ENVD++I+LHS + NFVK+N++ES YL+   
Sbjct: 190 EMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEGG 249

Query: 234 NDSNTCD-------IILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYN-- 284
              ++ D       I++SFL++  CL+FYNN+LQRL EFK  L SE+LNL FV L Y+  
Sbjct: 250 KSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPK 309

Query: 285 --------KTTRDNQ------------GPSLEFNIVTRDATRSLAIELCSNENDSLILEK 324
                   +   +N               SL  NI  +DATRS+ IE  S       +EK
Sbjct: 310 CLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKS------PVEK 363

Query: 325 EQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQ 384
             LF+K L + L   +NKRY+LESIDLV+TD  + +F +NYA+L+FLNI+MAIE++DY++
Sbjct: 364 SDLFKKKL-QFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDYLK 422

Query: 385 VISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATNI 421
             S  L I KC +V++ PL+       SSA SS  NI
Sbjct: 423 KYSKNLGISKCFYVSLAPLVV------SSARSSVANI 453

 Score = 81.6 bits (200), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 52/84 (61%), Gaps = 10/84 (11%)

Query: 23  QDQYYSAFDTT--NPLMSYP-QFEQPYGATFPPPLSSSTHFQQTYYKGSPLPNAPPTPFD 79
           Q Q Y+  +    NP+M +P  F    G   P     S H    YY  SPLPN PPTPFD
Sbjct: 17  QQQDYNGMNAMVGNPMMYHPVDFVNGAGQYGP-----SQH--PAYYTNSPLPNIPPTPFD 69

Query: 80  TAYGATLLPSHLLMGSPFISSPNV 103
           TAYGA+L PSHLLMGSPF+SSPN+
Sbjct: 70  TAYGASLFPSHLLMGSPFVSSPNM 93

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/33 (90%), Positives = 32/33 (96%)

Query: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGASGEE 1028
            TIPGSDVMAQYLAQ+QHSTFMYAANILGAS E+
Sbjct: 1096 TIPGSDVMAQYLAQVQHSTFMYAANILGASAED 1128

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score =  413 bits (1062), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 234/454 (51%), Positives = 281/454 (61%), Gaps = 76/454 (16%)

Query: 468 KLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPT----QLDQ-IPG-TPRTQEI 521
           KL+GI L    L++   DYP P  N  + HL N+ IS       Q  Q IP   P  + +
Sbjct: 521 KLQGIDLDGTILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHM 580

Query: 522 YINDMSPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPS-QSFYMDQNTQIQEAPFRSNSF 580
           ++ D + S                NGT +S   +  PS QS     N ++          
Sbjct: 581 FMTDSNQS----------------NGTIVSQQLITAPSPQSPNPQMNQRV---------L 615

Query: 581 IHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFI 640
            +PIT SLE   + SAKVAS+MGSD GNRTIYIGNINPRS+AEDICNVVRGGILQ+IK+I
Sbjct: 616 PNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYI 675

Query: 641 ESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASR 700
             K ICFVTFIE           FIDPIVLHGN L++GWG+YSGPLPKSI+LAVTIGASR
Sbjct: 676 AEKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASR 735

Query: 701 NVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWV 760
           NVYVSLPEFAFK+K+I+DP++K+ HE   LPD EQLR DFS+YG  EQINYLSDSHCCW+
Sbjct: 736 NVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWI 795

Query: 761 NFMNISSAIKLVEEATNDFDRFN------------EKFDERYNGLVINYGKDRCGNINKN 808
           NFMNISSAI LVEE   +    +            EKFD RY GL+INYGKDRCGNINKN
Sbjct: 796 NFMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKN 855

Query: 809 LIAGKNSRFYK--IRQNHNFKLSKLEEKRRDHDRRENGFKHVYNDEETIYNESMETDNQH 866
           L+AGKNSRFYK   R ++N +LSKLEE+RR                            Q+
Sbjct: 856 LVAGKNSRFYKKVKRPSYNIRLSKLEERRR----------------------------QN 887

Query: 867 NEESKENDGKFLQLDSLGISLESKNEIADDINDA 900
             + KE+  K L L+SLGISL+       DI++A
Sbjct: 888 ENDKKESFDKVLNLESLGISLDPHK--GTDIDEA 919

 Score =  208 bits (530), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 118/260 (45%), Positives = 163/260 (62%), Gaps = 36/260 (13%)

Query: 174 EKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNK 233
           E L  +P  I+Y ILP GDDAYRTRSLL ENVD++ +LHS + NFVK+N++ES Y+V +K
Sbjct: 192 ETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYIVGSK 251

Query: 234 NDSN-------TCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYN-- 284
              N          I++SFL+R  CL+FYNN+LQRL EFK  L S+SLNL FV L Y+  
Sbjct: 252 ETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFVCLNYDSK 311

Query: 285 ---------KTTRDNQ-----------GPSLEFNIVTRDATRSLAIELCSNENDSLILEK 324
                    + +R  +             SL  ++  +DATRS+ IE  S       LEK
Sbjct: 312 SLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFKSP------LEK 365

Query: 325 EQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQ 384
            +LF++ L + L   +NKRY+LESID+V TD  + +F +NY +L+FLNI MAIE++DY++
Sbjct: 366 AELFKEKL-QFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVLDYLK 424

Query: 385 VISSKLNIGKCSFVTIQPLI 404
             S KL I KC +V++ PL+
Sbjct: 425 KYSKKLGISKCFYVSLTPLM 444

 Score = 86.3 bits (212), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 59/103 (57%), Gaps = 11/103 (10%)

Query: 2   MRPSYSRKNSGFHIYQSQQPAQDQYYSAFDTTNPLMSYP-QFEQPYGATFPPPLSSSTHF 60
           M  S SRK S  H Y+ Q    D         NP++ +P  F    G   P     S H 
Sbjct: 1   MSNSNSRKPSANHAYRKQH---DHNGMNAMVGNPMLYHPVDFMNGAGQYGP-----SQH- 51

Query: 61  QQTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103
              YY  SPLPN PPTPFDTAYGA+LLPSHLLMGSPF+SSPN+
Sbjct: 52  -PAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/38 (81%), Positives = 34/38 (89%)

Query: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGASGEEEYYDE 1033
            TIPGSDVMAQYLAQ+QHSTFMYAANILGAS E+  Y +
Sbjct: 1084 TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSD 1121

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  413 bits (1061), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 233/472 (49%), Positives = 285/472 (60%), Gaps = 89/472 (18%)

Query: 468 KLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPTQLDQ-----IPG-TPRTQEI 521
           KL+GI+L    L+I   DY  P  +  + HL NV IS   +  +     IP   P  + +
Sbjct: 528 KLQGIQLDGTDLEINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERM 587

Query: 522 YINDMSPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPS---QSFYMDQNTQIQEAPFRSN 578
           ++ND + S                NG+ +    M  PS    +  M+Q            
Sbjct: 588 FMNDSNHS----------------NGSIVPQQLMATPSPVSSTIQMNQRV---------- 621

Query: 579 SFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIK 638
              +PIT SLE   + SAKVAS+MGSD GNRTIYIGNINPRS+AEDICNVVRGGILQSIK
Sbjct: 622 -LPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIK 680

Query: 639 FIESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGA 698
           ++  K ICFVTFIE           FIDPIVLHGN L++GWG+YSGPLPKSI+LAVTIGA
Sbjct: 681 YMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGA 740

Query: 699 SRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCC 758
           SRNVYVSLPEFAFK+K+I+DP++K+ HE   LPD EQLR DFS+YG  EQINYLSDSHCC
Sbjct: 741 SRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCC 800

Query: 759 WVNFMNISSAIKLVEEATNDFDRFNE------------KFDERYNGLVINYGKDRCGNIN 806
           W+NFMNISSAI LVEE   +    NE            KF  RY GL+INYGKDRCGNIN
Sbjct: 801 WINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNIN 860

Query: 807 KNLIAGKNSRFYK--IRQNHNFKLSKLEEKRR--DHDRRENGFKHVYNDEETIYNESMET 862
           KNL+AGKNSRFYK   R ++N +LSKLEE+RR  ++D++E  F                 
Sbjct: 861 KNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKERAFD---------------- 904

Query: 863 DNQHNEESKENDGKFLQLDSLGISLESKNEIADDINDALTVDQFENEKSITK 914
                        K L L+SLGISL+S  +I         + + EN+  I +
Sbjct: 905 -------------KALNLESLGISLDSHKDIG--------IGEIENKNCIGR 935

 Score =  206 bits (525), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 168/277 (60%), Gaps = 42/277 (15%)

Query: 174 EKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNK 233
           E L   P  I+Y ILP GDDAYRTRSLL ENVD + +LHS + NFVK+N++ES Y++ N+
Sbjct: 189 ELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNE 248

Query: 234 NDSNTCD-------IILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYN-- 284
              +  D       I++SFL+R  CL+FYNN+LQRL EFK  L SESLNL FV L Y+  
Sbjct: 249 KSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFK 308

Query: 285 ------------------KTTRDNQ--GPSLEFNIVTRDATRSLAIELCSNENDSLILEK 324
                               T D+     SL  ++  +DATRS+ +E  S       L+ 
Sbjct: 309 CLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKS------PLKS 362

Query: 325 EQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQ 384
            +LF K L  + R++ NKRY+LESID+V+TD  + +F +NYA+L+FLNI MAIE++DY++
Sbjct: 363 TELFNKKLQFLDRSN-NKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLK 421

Query: 385 VISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATNI 421
             S KL I KC +V++ PL+       SS  SS  NI
Sbjct: 422 KYSKKLGISKCFYVSLAPLVI------SSTRSSVANI 452

 Score = 81.3 bits (199), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 34/41 (82%), Positives = 37/41 (90%)

Query: 63  TYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103
            YY  SPLPN PPTPFDTAYGA+LLPSHLLMGSPF+SSPN+
Sbjct: 53  AYYSNSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/38 (81%), Positives = 34/38 (89%)

Query: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGASGEEEYYDE 1033
            TIPGSDVMAQYLAQ+QHSTFMYAANILGAS E+  + E
Sbjct: 1093 TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHTE 1130

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
           (REAL)
          Length = 1128

 Score =  412 bits (1059), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 235/464 (50%), Positives = 286/464 (61%), Gaps = 74/464 (15%)

Query: 468 KLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPTQLDQ-----IPG-TPRTQEI 521
           KL+GI+L   SL+I   DY  P  N  + HL N+ IS   +  +     IP   P  +++
Sbjct: 527 KLQGIELDGTSLEITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQM 586

Query: 522 YINDMSPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNSFI 581
           ++ND + S                NG  I    +  PS    +  N QI +         
Sbjct: 587 FMNDSNQS----------------NGAVIPQQLIAAPSP---LSSNLQINQ-----RVLP 622

Query: 582 HPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIE 641
           + IT SLE   + SAKVAS+MGSD GNRTIYIGNINPRS+AEDICNVVRGGILQSIK+I 
Sbjct: 623 NAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIP 682

Query: 642 SKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRN 701
            K I FVTFIE           FIDPIVLHGN L++GWG+YSGPLPKSI+LAVTIGASRN
Sbjct: 683 EKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRN 742

Query: 702 VYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVN 761
           VYVSLPEFAFK+K+I+DP++K+ HE   LPD EQLR DFS+YG  EQINYLSDSHCCW+N
Sbjct: 743 VYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 802

Query: 762 FMNISSAIKLVEE------ATNDFDRF------NEKFDERYNGLVINYGKDRCGNINKNL 809
           FMNISSAI LVEE      A +D           EKFD RY GL+INYGKDRCGNINKNL
Sbjct: 803 FMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNL 862

Query: 810 IAGKNSRFYK--IRQNHNFKLSKLEEKRRDHDRRENGFKHVYNDEETIYNESMETDNQHN 867
           +AGKNSRFYK   R ++N +LSKLEE+RR                            Q+ 
Sbjct: 863 VAGKNSRFYKKVKRPSYNIRLSKLEERRR----------------------------QNE 894

Query: 868 EESKENDGKFLQLDSLGISLESKNEIADDI--NDALTVDQFENE 909
            + KE+  K L L+SLGISL+   +    +   + +T D+ E+E
Sbjct: 895 NDKKESFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESE 938

 Score =  207 bits (528), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 127/277 (45%), Positives = 166/277 (59%), Gaps = 42/277 (15%)

Query: 174 EKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPN- 232
           E L   P  I+Y ILP GDDAYRTRSLL ENVD + +LHS + NFVK N++ES Y V N 
Sbjct: 189 EILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDND 248

Query: 233 KND------SNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNK- 285
           KND      +    +++SFL+R  CL+FYNN+LQRL EFK  L S+SLNL FV L Y   
Sbjct: 249 KNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESE 308

Query: 286 ---TTRDNQGP------------------SLEFNIVTRDATRSLAIELCSNENDSLILEK 324
              T  + + P                  SL  ++  +DATRS+ IE  S       LEK
Sbjct: 309 CLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKS------ALEK 362

Query: 325 EQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITMAIEIMDYIQ 384
            +LF K L + L   +NKRY+LESIDLV+TD  + +F +NYA+L+FLNI MA+E++DY++
Sbjct: 363 TELFRKRL-QFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLK 421

Query: 385 VISSKLNIGKCSFVTIQPLIENNVMNNSSALSSATNI 421
             S  L I KC +V++ PL+       SS  SS  NI
Sbjct: 422 KFSKSLEISKCFYVSLTPLMV------SSTRSSVANI 452

 Score = 81.6 bits (200), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 34/41 (82%), Positives = 37/41 (90%)

Query: 63  TYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103
            YY  SPLPN PPTPFDTAYGA+LLPSHLLMGSPF+SSPN+
Sbjct: 53  AYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%)

Query: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGASGEEEYYDE 1033
            TIPGSDVMAQYLAQ+QHSTFMYAANILGAS E+  Y E
Sbjct: 1090 TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSE 1127

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  398 bits (1022), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 206/392 (52%), Positives = 268/392 (68%), Gaps = 30/392 (7%)

Query: 570  IQEAPFRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVV 629
            +++  F ++  ++PI  +LE++ +TSA+VAS+MG + GNRTIYIGN+NPRSKAED+CNVV
Sbjct: 689  VEQPTFNTDPTMYPIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVV 748

Query: 630  RGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKS 689
            RGGILQSIK I SK ICFVTFIE           FIDP++LHGNTLK+GWGNY  PL KS
Sbjct: 749  RGGILQSIKLIASKRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKS 808

Query: 690  IALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQI 749
            IALAVTIGASRNVYVSLPEFAFKDK++NDPE+KE+HEK+KLP  +QLR DF+ YGP EQI
Sbjct: 809  IALAVTIGASRNVYVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQI 868

Query: 750  NYLSDSHCCWVNFMNISSAIKLVEEATND--FDRFNEKFDERYNGLVINYGKDRCGNINK 807
            NYLSDSHCCWVNFMNI+SAIKLVE+  N+   + F++KF+ RY+GL+INYGKDRCGN+N+
Sbjct: 869  NYLSDSHCCWVNFMNITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNR 928

Query: 808  NLIAGKNSRFY-KIRQ-NHNFKLSKLEEKRRDHDRRENGFKHVYND-------------- 851
            NLI+ KNSR Y K+++ + N+KL +L+EKRR    +        ND              
Sbjct: 929  NLISNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKELNGGVNDNKLPSLDALGIGLQ 988

Query: 852  -----EETIYNESMETDNQHNEESKENDGKFLQLDSLGISLESKNEIADDINDALTVDQF 906
                 EE    ES E D  ++    E+D      ++LG  ++S  +  DD  +    ++ 
Sbjct: 989  RTAPPEEQKVPESNEDDANYDSAVTESDTN--TFNALGFRIQSNTDSHDDEQNDEKGEEQ 1046

Query: 907  ENEKSITKNNGFENTSFHSDSSSDIELIINSP 938
            E    I   +        S +SSD+E+II+ P
Sbjct: 1047 EEVDVIAHADDIS-----SVNSSDVEIIIDCP 1073

 Score =  241 bits (615), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 179/483 (37%), Positives = 233/483 (48%), Gaps = 110/483 (22%)

Query: 5   SYSRKNSGFH--IYQSQQPAQDQYYSA-FDTTNPLMSY---PQFEQPYGATFPPPLSSST 58
           S+SR+ S ++  + Q Q+  +  Y S      NP M Y   P   Q +  T         
Sbjct: 19  SFSRRGSSYYMNVQQDQRSRKPSYISLNHSVHNPNMVYQHDPNGSQYFATT--------- 69

Query: 59  HFQQTYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTPXXXXXXXXXXXX 118
             QQ YY  SPLPNAPPTPFDTAYGATLLPSHLLMGSP++S+PN   P            
Sbjct: 70  --QQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYS 127

Query: 119 XXXXGSSTP-RKSFFXXXXXXXXXXXXXXXXXXXXFIIXXXXXXXXXXXXXXKEI-LEKL 176
               G  TP RKSF                     F                 E+   +L
Sbjct: 128 QSPAG--TPNRKSF-----SQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPNEL 180

Query: 177 FTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVP----- 231
           F +P  ISY +LP GDDAYRTRSLLF NV ++I+LHSFI +FV+ +SIESIYL+      
Sbjct: 181 FQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISNTDDE 240

Query: 232 ----NKNDSNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTT 287
               N+ND N   I+LSFLSR ICL FYNNVLQRL EFK +L S+SL LNFV L Y + T
Sbjct: 241 KDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYLEKT 300

Query: 288 RD--------------------------------NQGPSLEFNIVTRDATRSLAIELCSN 315
            D                                N   +L+F+++  DATR + IEL + 
Sbjct: 301 DDGSTANISNNQLNQIQENENDVNTNEFDYRNSMNTVNALKFDLINPDATRFIMIELKTK 360

Query: 316 ENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVS---------------------- 353
                  +KE L  K L+ ++   +N RY+LESIDL +                      
Sbjct: 361 ------CDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSSENKSIIEAKNENEN 414

Query: 354 ---------------TDKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCSFV 398
                           ++S + F  +YA+LSF+NI MA+E+ DY+++   K  I   S+V
Sbjct: 415 SPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYV 474

Query: 399 TIQ 401
            I+
Sbjct: 475 QIK 477

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/41 (75%), Positives = 34/41 (82%), Gaps = 1/41 (2%)

Query: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGASGEEE-YYDEAE 1035
             IPG+DVMAQYL QLQHSTFMYAANILG S E+  YYDE +
Sbjct: 1156 VIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDEED 1196

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,
           1032 aa] {ON} (7832..9475,9855..9863,10320..11765) [3099
           nt, 1033 aa]
          Length = 1032

 Score =  372 bits (955), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 178/329 (54%), Positives = 236/329 (71%), Gaps = 10/329 (3%)

Query: 575 FRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGIL 634
            R    +H +  + ++Q +TSA++A+ MG  AGNRT+YIGNINPRSKAEDICNVVRGG L
Sbjct: 547 LRXXXMLHQLLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTL 606

Query: 635 QSIKFIESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKSIALAV 694
           Q IKF + K ICFVTFIE           FIDPI+LH NTL++GWG++SGPLPKSI+LAV
Sbjct: 607 QQIKFFKEKGICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAV 666

Query: 695 TIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSD 754
           T+GASRNVYVSLPE+AFKDK+INDPE+KEYH K+ LP  E+LR DFS +G  EQ+N+L+D
Sbjct: 667 TVGASRNVYVSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLND 726

Query: 755 SHCCWVNFMNISSAIKLVEE--ATNDFDRFNEKFDERYNGLVINYGKDRCGNINKNLIAG 812
            HCCW+NFMNI SAIKLVE   ++N    F+E++  RY GL+I YGKDRCGN+NK+LI+G
Sbjct: 727 GHCCWINFMNIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISG 786

Query: 813 KNSRFY-KIRQ-NHNFKLSKLEEKRRDHDRRENGFKHVYNDEETIYNESMETDNQHNEES 870
           KNS+FY K+++ ++N +L +LEE+R+  ++ +   K +  +   I  E+   +    EE 
Sbjct: 787 KNSKFYRKVKKPSYNIRLQQLEEERKQEEKNKISNKSINLNSFGIQVETPSQNESEQEEP 846

Query: 871 KENDGKFLQLDSLGISLESKNEIADDIND 899
           K      + LD LG+SL   N    D+ +
Sbjct: 847 K------ISLDGLGMSLSKPNSENHDLKE 869

 Score =  179 bits (454), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 112/269 (41%), Positives = 153/269 (56%), Gaps = 46/269 (17%)

Query: 170 KEILEKLFTEPIN---ISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIES 226
           K I+++     +N   ISY +LPKG+D Y+TRSLLFENVD +++LH FI  FV    IES
Sbjct: 237 KNIIKRFQENSLNRFTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIES 296

Query: 227 IYLVPNKND---------------------------SNTCDIILSFLSRHICLDFYNNVL 259
           +YL+ N N                             +T  I+LSFLSR ICLDFYN+VL
Sbjct: 297 VYLI-NSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVL 355

Query: 260 QRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQ-----GP----SLEFNIVTRDATRSLAI 310
           QRL EFK  LNS  L L+FV LKY    R +       P    SLE++I+ R ATRS+A+
Sbjct: 356 QRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEYDIIKRGATRSIAV 415

Query: 311 ELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSF 370
           E      +  I  KE      L+ +L + ENKRY++ES+D+++  + +    KN  IL+F
Sbjct: 416 EF-----NQPITSKEGFMNSKLSFLL-SPENKRYIIESVDIINAAERDANLPKNTVILTF 469

Query: 371 LNITMAIEIMDYIQVISSKLNIGKCSFVT 399
           LNI+M +++MD I++      I KC FVT
Sbjct: 470 LNISMTVDVMDRIRLERKDSGISKCVFVT 498

 Score = 72.0 bits (175), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 29/41 (70%), Positives = 35/41 (85%)

Query: 63  TYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103
            YY    +PNAPPTPFD+AYGA+LLPSHLLMGSPF+S+P +
Sbjct: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTM 151

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 36/38 (94%), Gaps = 1/38 (2%)

Query: 997  IPGSDVMAQYLAQLQHSTFMYAANILGASGEE-EYYDE 1033
            +PGSDVM+QYLAQLQHSTFMYAANILGAS +E E+YDE
Sbjct: 987  LPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDE 1024

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  366 bits (939), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 178/309 (57%), Positives = 227/309 (73%), Gaps = 21/309 (6%)

Query: 584  ITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESK 643
            +T +LEN  +TS ++++ +G   GNRT+YIGNINPRSK ED+CNVVRGGILQ I F+  K
Sbjct: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860

Query: 644  HICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVY 703
            HICFVTFIE           +IDPIVLHGN LK+GWGN+SGPLPKSI+LAVTIGA+RNVY
Sbjct: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920

Query: 704  VSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFM 763
            VSLPEFAFKDK+IN+P++++YHE +KLP+  QLR DFS YG  EQINYL+D HCCW+NFM
Sbjct: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980

Query: 764  NISSAIKLVEEAT-NDFDRFNEKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFYK--I 820
            NI+SAI LVEE   +D  RF+ KFD RYNGL+I YGKDRCGN+NKNL+A KNS+F+K   
Sbjct: 981  NINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFKKVK 1040

Query: 821  RQNHNFKLSKLEEKRRDHDRRENGFKHVYNDEETIYNESMETDNQHNEESKENDGKFLQL 880
            +  +  KL K+EE+RR  +  EN  ++         N  +  ++Q  + +       + L
Sbjct: 1041 KPAYQIKLKKIEEERRLQE--ENNLRN---------NNKLSNNSQIRKPA-------VNL 1082

Query: 881  DSLGISLES 889
            +SLGI+ ES
Sbjct: 1083 ESLGITFES 1091

 Score =  139 bits (351), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 143/298 (47%), Gaps = 71/298 (23%)

Query: 173 LEKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPN 232
           + KL   P+ +SY ILPKG D +RTRSLL EN++ +I+  + + NF+    IES+YL+  
Sbjct: 253 INKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKL 312

Query: 233 KNDSNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKY--------- 283
              S    I+LSF+SR ICLDFYNNVLQRL EFK  L+S+SL L+FV LKY         
Sbjct: 313 NPGSKYNSILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVILKYEFTDYNHPI 372

Query: 284 NKTTRDNQGPSLEFN----------------------IVTRDATRSLAIE---------- 311
           N+   DN   S   N                      IV  D    L  E          
Sbjct: 373 NEHASDNGDESSSSNKNLKIDTIKEEEEDEEETDGEEIVIEDIRNDLNKENFPLTFASAL 432

Query: 312 ----LCSNENDSLILE------KEQLFEKILNEILRTDENKRYVLESIDLVST------- 354
               +      SL+L+      K+QL  + LN  +  + N RY+LESI LV+        
Sbjct: 433 QSDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFINNNLNNRYILESISLVNIENNTKNN 492

Query: 355 -------------DKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCSFVT 399
                        D    +FG NY +L+F NI MAIE  DY +   ++LNI  C FV+
Sbjct: 493 KNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFFVS 550

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (92%), Gaps = 2/41 (4%)

Query: 63  TYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103
           TYY  SP+P+APPTPFD +YGATLLPSHLLMGSPF+S+PN+
Sbjct: 96  TYY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNI 134

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 3/43 (6%)

Query: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGASGEEE---YYDEAE 1035
            TIPGSDVM+QYL QLQHSTFMYAANILG S E+    Y D+ E
Sbjct: 1317 TIPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGDDGE 1359

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
           Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  357 bits (917), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 190/423 (44%), Positives = 263/423 (62%), Gaps = 56/423 (13%)

Query: 478 SLDILPRDYPEPEFNFSTDHLPNVTIS--VPTQLDQIP-----GTPRTQEIYI-NDMSPS 529
           +  +LP  Y  P       H  ++TIS  + +++ +        +P+ QE+ + N  +PS
Sbjct: 321 AFTVLPSQYGPPVVEEHNQHCSHITISKALSSKVSRNGSSSSIASPQPQEVLVSNSEAPS 380

Query: 530 FEGIDMMNSSSTMLSGNGTFISNTPML-IPSQSFYMDQNTQIQEAPFRSNSFIHPITDSL 588
                  NS  ++LS      S  P   +P   +YMD +               P+  +L
Sbjct: 381 -----SRNSIVSLLSAR----SQGPTYPVPGYHYYMDMSK--------------PLGQTL 417

Query: 589 ENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFV 648
           + Q + +A+VA+AMG  AGNRT+YIGNI+PRSK EDICNVVRGGILQS+K+IE+KHICFV
Sbjct: 418 QQQYTATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFV 477

Query: 649 TFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPE 708
           TFIE            I+PIVLHG+ LK+GWG++SG LP+SI+LAVTIGASRNVYVSLPE
Sbjct: 478 TFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPE 537

Query: 709 FAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSA 768
           +AFKDK+I DPE++ + EKFKLP  +QL  DFS++G  E IN+L D HCCW+NFMNIS+A
Sbjct: 538 YAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNISNA 597

Query: 769 IKLVEEATN-DFDRFNEKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFYKIRQNHNFK 827
           IKLVE+A N + + F+EKF+ RY GL I YGKDRCGN+NKNL++ KNS+++K  +  ++ 
Sbjct: 598 IKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKASYN 657

Query: 828 LSKLEEKRRDHDRRENGFKHVYNDEETIYNESMETDNQHNEESKENDGKFLQLDSLGISL 887
           +    +++ D + +    K                         EN  K LQ+D+ GIS+
Sbjct: 658 IRLRRQQKSDIEAQAKSGK-----------------------GDENSEKKLQVDAFGISV 694

Query: 888 ESK 890
            S+
Sbjct: 695 GSQ 697

 Score =  150 bits (379), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 88/227 (38%), Positives = 139/227 (61%), Gaps = 26/227 (11%)

Query: 180 PINISYVILPK---GD-DAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKND 235
           P  +++ ILP+   GD D +RTRSL F N++  + LH F+  F K + IES+Y+V  +  
Sbjct: 62  PYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDREQQ 121

Query: 236 SNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSL 295
           S    +++SFL++  CLDFYN +LQ+L EFKK L S+ L+L+F S +     +   GP+L
Sbjct: 122 S----VLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQ-----KVESGPTL 172

Query: 296 E---FNIVTRDATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLV 352
           +   F ++   ATRSL +E     + + +L+K   F+         +   RYV+ESI+ V
Sbjct: 173 QEIKFEVLRAGATRSLGLEFKDEIDFASLLKKFDFFD---------NSGPRYVIESIETV 223

Query: 353 STDKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSK-LNIGKCSFV 398
           +TDK +K FG NYAI+ F++I MA+E M+Y++V + +   + K S+V
Sbjct: 224 NTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTPESFGLTKVSYV 270

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%)

Query: 996  TIPGSDVMAQYLAQLQHSTFMYAANILG 1023
             IPGS+VMAQYLAQLQHSTFMYAA+ILG
Sbjct: 877  AIPGSNVMAQYLAQLQHSTFMYAADILG 904

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  351 bits (901), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 208/514 (40%), Positives = 291/514 (56%), Gaps = 78/514 (15%)

Query: 481 ILPRDYPEPEFNFSTDHLPNVTISVPTQLDQIPGTPRTQEIYIND----------MSPSF 530
           ++P +YP P     ++HL ++TIS P++       P    I ++           +S S 
Sbjct: 409 VVPSEYPTPLIEQHSEHLTSITISRPSKTL----GPSASLIEMDSNATNAGNHHGVSSSL 464

Query: 531 EGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNSF--------IH 582
            G+  MN  S+  SG+      TPM++PS+   ++ NT +   P +            +H
Sbjct: 465 SGVLFMNDPSS--SGS------TPMIVPSE---LNLNTPVMGGPMQGQLMPGPPQPMSLH 513

Query: 583 --------------------PITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKA 622
                               PI  +L+ Q    A  A+ +     NRT+YIGNI+PRSK 
Sbjct: 514 NPSDGNGGSPSYFMDPMVGAPIGQTLQRQYLAGASQANGIN----NRTVYIGNIHPRSKP 569

Query: 623 EDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNY 682
           EDICNVVRGGILQ+IK+I SK ICFVTFIE            ++PIVLHGN L++GWG  
Sbjct: 570 EDICNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQP 629

Query: 683 SGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSS 742
           SG LPK+IALAVTIGASRNVYVSLPE++FK+KYIN+PEFK YH K+KLP  EQLR DF+ 
Sbjct: 630 SGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTK 689

Query: 743 YGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATN----DFDRFNEKFDERYNGLVINYG 798
           YG  EQINYL D HCCWVNFMNI+ AI+LVE++ +    + ++F+ +FD RY  L+I YG
Sbjct: 690 YGQVEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYG 749

Query: 799 KDRCGNINKNLIAGKNSRFYKIRQNHNFKLSKLEEKRRDHDRRENGFKHVYNDEETIYNE 858
           KDRCGN+NKNL A KNSRFYK  +  ++ +     K+    R+E+G   V +D+ T  NE
Sbjct: 750 KDRCGNVNKNLAANKNSRFYKKIKKQSYSM-----KQGKQPRKEDGI--VNSDDLTKNNE 802

Query: 859 SM------ETDNQHNEESKENDGKFLQLDSLGISLESKNEIADDINDALTVDQFENEKSI 912
            +       + N    ES+   G     + LGISL S  +I+ D         + +    
Sbjct: 803 VLPGVQMNSSKNGGVGESQSLVGDQELAEGLGISLTSA-QISPDTGH---THHYSDGVEE 858

Query: 913 TKNNGFENTSFHSDSSSDIELIINSPNSLRTKDN 946
                 ++  + +  SSDI++I+  P+  + +++
Sbjct: 859 GDECDDDDAGYSTSGSSDIDIIVAPPDEFKRRES 892

 Score =  182 bits (461), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 120/335 (35%), Positives = 174/335 (51%), Gaps = 44/335 (13%)

Query: 70  LPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTPXXXXXXXXXXXXXXXXGSSTPRK 129
           +P  P TPFD  YGA+LLPSH+LMGSPF+S+P                         P+ 
Sbjct: 56  MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP-----------------------LRPQA 92

Query: 130 SFFXXXXXXXXXXXXXXXXXXXXFIIXXXXXXXXXXXXXXKEILEKLFTEPINISYVILP 189
            F                     F+               K+ +    +EP +I++ ILP
Sbjct: 93  HFHPSTPGHSSHSLHHAQSARSSFLYYPQPPMLKPIPPRRKKSVTLNHSEPYHINFKILP 152

Query: 190 KGDDAYRTRSLLFENVD--NAINLHSFITNFVKNNSIESIYLVPNKNDSNTCDIILSFLS 247
           KG D Y TRSLL  N++    +++H+F+ +FVK   +ESIYL+    D N   I+LSFL+
Sbjct: 153 KGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM----DDNHS-ILLSFLT 207

Query: 248 RHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSLEFNIVTRDATRS 307
           +  CLDFYNN+LQR  EFK  L+S  L+++FV    +   +      L+ N+VTR ATRS
Sbjct: 208 KATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVCQDESSWFK-----YLQMNVVTRGATRS 262

Query: 308 LAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAI 367
           L +E      DS + E  + F ++    L   +  R+VLE IDL++    N+ FG  Y I
Sbjct: 263 LTVEF----EDS-VKELNEDFVRLKFPWLFCSQ--RFVLERIDLINATTVNQHFGTRYMI 315

Query: 368 LSFLNITMAIEIMDYIQVISSK--LNIGKCSFVTI 400
           L F++I+MA+E+ D++Q  S K  LNI +  FV +
Sbjct: 316 LHFISISMALEVDDFLQQPSQKRQLNISRIQFVNV 350

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/40 (62%), Positives = 29/40 (72%), Gaps = 4/40 (10%)

Query: 997  IPGSDVMAQYLAQLQHSTFMYAANILGASGEEE----YYD 1032
            I G DVM+QYL QL HSTF+YA NILGA+  +E    YYD
Sbjct: 997  IAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYD 1036

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  311 bits (797), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 187/253 (73%), Gaps = 5/253 (1%)

Query: 566 QNTQIQEAPFRSNSFIHP-ITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAED 624
           Q   + E P+     + P IT +++NQ S S +   A+ +   +RT+YIGNINPRSKAED
Sbjct: 605 QQMLLNEYPYIMEPLMPPQITQTIQNQYSKSIQ---AVNAGMEHRTVYIGNINPRSKAED 661

Query: 625 ICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSG 684
           ICNVVRGGILQ IK++  K ICFVTFIE            ++PI+LHGN LK+GWG   G
Sbjct: 662 ICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPG 721

Query: 685 PLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYG 744
           PLPK+IALAVT+GASRNVYVSLP+ AFKDK+INDP+FKEY  ++K+P+  QL+ DF +YG
Sbjct: 722 PLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYG 781

Query: 745 PTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDR-FNEKFDERYNGLVINYGKDRCG 803
             EQ+N+ SD HCCW+NFMNISSAIKLVEE ++  D  F++K + RY GL+I YGKDRCG
Sbjct: 782 TMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCG 841

Query: 804 NINKNLIAGKNSR 816
           NIN+NL+  KN +
Sbjct: 842 NINRNLVFNKNGK 854

 Score =  108 bits (269), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 83/271 (30%), Positives = 131/271 (48%), Gaps = 67/271 (24%)

Query: 181 INISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVP--------- 231
           I   Y ILPKG+D YR+RSLLF NV++ +++  F+    KN  IESIYL+          
Sbjct: 215 IQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGDDIE 274

Query: 232 NKNDSNTCD-------------------------------------------IILSFLSR 248
           N N SN  D                                            +LSF ++
Sbjct: 275 NLNTSNNDDDPNQNYNADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSFFTK 334

Query: 249 HICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSLEFNIVTRDATRSL 308
             CLDFYNN+LQR  E K  + S+ L +NFV ++ ++    N    L+ N+++  ATRSL
Sbjct: 335 ESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWMAN----LKMNVISLGATRSL 390

Query: 309 AIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAIL 368
            +E   +   S         + I + +     + +YV+  +D+V+TD+  K FG +Y +L
Sbjct: 391 YVEFADDSVTS---------DTIWDTLPFLKNSGKYVVIDVDVVTTDERRKNFGLHYCLL 441

Query: 369 SFLNITMAIEIMDYIQVISSKLNIGKCSFVT 399
            FL++TMA+E+ + ++  +    + + SFVT
Sbjct: 442 HFLSVTMALEVKELLE--TGDEAVSRVSFVT 470

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/37 (64%), Positives = 30/37 (81%)

Query: 997  IPGSDVMAQYLAQLQHSTFMYAANILGASGEEEYYDE 1033
            I GSDVM +YL QL H+TF+YAANILGA+ +  +YDE
Sbjct: 1112 IAGSDVMTRYLEQLHHNTFVYAANILGATQDPVFYDE 1148

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 25/33 (75%)

Query: 74  PPTPFDTAYGATLLPSHLLMGSPFISSPNVPTP 106
           P TPFD  YG TLLPSHLL+GSPF+++P    P
Sbjct: 69  PQTPFDPVYGITLLPSHLLVGSPFVNTPQTGGP 101

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  163 bits (413), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 116/203 (57%), Gaps = 20/203 (9%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRTIY+GN+    K E+ICN VRGG+LQ IK +  +H+CFVTFI+            + 
Sbjct: 340 GNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 399

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
            + +H    K+GWG +SGPLP  +ALAV+ GASRN+Y+   +FA  DK    P F E   
Sbjct: 400 GLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA-ADKKSQHPIFTE--- 455

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                    LR  F  +G  EQIN+L + +CC++NF NISSAI  +++          K 
Sbjct: 456 -------AALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI---------KS 499

Query: 787 DERYNGLVINYGKDRCGNINKNL 809
              +  L IN+GKDRCGN+ +  
Sbjct: 500 IPTFKDLKINFGKDRCGNVPRQF 522

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 96/207 (46%), Gaps = 19/207 (9%)

Query: 604 SDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXX 663
           + A +RT+Y+GN+ P    +++ + VR G+++ +K +  K   F++F+E           
Sbjct: 98  TSAPSRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDA 157

Query: 664 FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKD---KYINDPE 720
            +  + +    +K+GWG  +   P   A     GA+RNVY+       KD   ++  DP 
Sbjct: 158 ILKRLNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIGKLN-TNKDICAQWGVDPN 216

Query: 721 FKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFD 780
            +   E       E+LR D S +G  E +  + +    +V+F +I +AIK+V    N   
Sbjct: 217 EEVITE-------EKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLAN--- 266

Query: 781 RFNEKFDERYNGLVINYGKDRCGNINK 807
                 +  Y    I YGKDRC  I K
Sbjct: 267 -----INPYYAQKKIFYGKDRCAFITK 288

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  166 bits (419), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 92/224 (41%), Positives = 130/224 (58%), Gaps = 21/224 (9%)

Query: 584 ITDSLENQLSTSAKVASAMGS--DAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIE 641
           I+++L  Q + +A +A++ G   + GNRT+Y+GN+    K ++ICN VRGG+LQ IK + 
Sbjct: 501 ISNTLLQQSAAAAAIATSAGGPNNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLT 560

Query: 642 SKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRN 701
            +H+CFVTFI+            +  + +     K+GWG +SGPLP  IALAV+ GASRN
Sbjct: 561 DRHVCFVTFIDPTAAAQFYAMSSLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRN 620

Query: 702 VYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVN 761
           VY+   +F    K  N P F E            LR  F  YG  EQIN+L + +CC++N
Sbjct: 621 VYLGNIDFENDIKLHNPPIFTEL----------SLRNIFQQYGDVEQINFLPEKNCCFIN 670

Query: 762 FMNISSAIKLVEEATNDFDRFNEKFDERYNGLVINYGKDRCGNI 805
           F NIS+AI  +E+  N+ D         +  L IN+GKDRCGNI
Sbjct: 671 FTNISNAILAIEKIKNNPD---------FKDLKINFGKDRCGNI 705

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 98/215 (45%), Gaps = 25/215 (11%)

Query: 609 RTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFIDPI 668
           RT+Y+GNI      +D+ + VR G++++IK +  K   F++F++            +  +
Sbjct: 268 RTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDAILKRL 327

Query: 669 VLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVS----------------LPEFAFK 712
            + G  +K+GWG  +   P      VT GA+RNVY+                     +  
Sbjct: 328 NIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTSPSSPS 387

Query: 713 DKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLV 772
           +   +D E K+  +   L + E+LR D   YG  + +  + D    +V+  +I SAIK+V
Sbjct: 388 NNTSDDLEKKKNIDDSPLTE-EKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILSAIKVV 446

Query: 773 EEATNDFDRFNEKFDERYNGLVINYGKDRCGNINK 807
               N+  + N  +  +     I YGKDRC  I K
Sbjct: 447 ----NNLAQTNPYYQNKR----IFYGKDRCAFITK 473

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  160 bits (404), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/199 (39%), Positives = 114/199 (57%), Gaps = 22/199 (11%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRTIY+GN++ R + E++CNVVRGG+LQS+KF+  +H+CFVTF +            + 
Sbjct: 263 GNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMASLH 322

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
            + +     K+GWG +SGPLP  +A A++ GASRNVY       F +    DP   E+ E
Sbjct: 323 GLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEFFE 375

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
           +        LR   S +G  EQ+N + +  C +VNF N+ SAI  VE+    + +F +  
Sbjct: 376 E------RHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQ-VKKWPQFQQ-- 426

Query: 787 DERYNGLVINYGKDRCGNI 805
                 L +NYGKDRCGN+
Sbjct: 427 ------LKVNYGKDRCGNV 439

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 102/231 (44%), Gaps = 29/231 (12%)

Query: 604 SDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXX 663
           + A +RT+Y+GNI P     ++ + V+ G+++  +   +K   FV+F++           
Sbjct: 34  TSAPSRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDA 93

Query: 664 FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKE 723
            ++ + +    +K+GW   +   P       + GA+RNVY+            N P+   
Sbjct: 94  ILNRLRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLG-----------NLPDGVS 142

Query: 724 YHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFN 783
            +E  K         D S YG  + +  LS     +V+  +I  AI     A  +  R N
Sbjct: 143 RYELTK---------DLSVYGEIDSVKLLSSKGVAFVHMASIGQAI----HAVANLQRDN 189

Query: 784 EKFDERYNGLVINYGKDRCGNINKNLIAGKNSRFYKIRQNHNFKLSKLEEK 834
           + + +R     +++GKDRC  + K L   + ++F  + +    ++ +L ++
Sbjct: 190 KIYSDRR----VSFGKDRCAYVTK-LQQSRAAQFLGLPEEDAVRMEQLRDR 235

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  162 bits (410), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 117/199 (58%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRTIY+GN+    K E+ICN VRGG+LQSIK +  +H+CFVTFI+            + 
Sbjct: 386 GNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSLH 445

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
            + +H    K+GWG +SG L  ++ALAV+ GASRN+Y+   +F   D   + P F E   
Sbjct: 446 GLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-ADSERDVPVFTE--- 501

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                  + LR  F  YG  EQIN+L +  CC+VNF NIS+AI  +++          K 
Sbjct: 502 -------QNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKI---------KS 545

Query: 787 DERYNGLVINYGKDRCGNI 805
           +E++  L IN+GKDRCGN+
Sbjct: 546 NEQFKDLKINFGKDRCGNV 564

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 95/212 (44%), Gaps = 29/212 (13%)

Query: 604 SDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXX 663
           + A +RT+Y+GNI P  +  ++ + VR G+++ ++ +  K   F++F++           
Sbjct: 143 TSAPSRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDA 202

Query: 664 FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVS--------LPEFAFKDKY 715
            +  + + G  +K+GWG  +   P   A     GA+RNVY+          P+F      
Sbjct: 203 ILKRLNIGGRDIKVGWGKPTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFG----- 257

Query: 716 INDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEA 775
             DP       +  +   E+LR D   YG  E +  + +    +V+F +I SAIK+V   
Sbjct: 258 -ADP-------RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL 309

Query: 776 TNDFDRFNEKFDERYNGLVINYGKDRCGNINK 807
                      +  Y+   I YGKDRC  + K
Sbjct: 310 AT--------VNPYYSNKKIFYGKDRCAFVTK 333

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  162 bits (410), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/199 (41%), Positives = 118/199 (59%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRTIY+GN+    K E+ICNVVRGG+LQSIK +  +H+CFVTFI+            + 
Sbjct: 384 GNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASLH 443

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
            + +H    K+GWG +SG L  ++ALAV+ GASRN+Y+   +F   D     P F E   
Sbjct: 444 GLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFK-ADSETEHPIFTE--- 499

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                  + LR  F  +G  EQIN+L + +CC+VNF NIS+AI  +++  N         
Sbjct: 500 -------QNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKN--------- 543

Query: 787 DERYNGLVINYGKDRCGNI 805
           + +++ L IN+GKDRCGN+
Sbjct: 544 NPQFSDLKINFGKDRCGNV 562

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 99/208 (47%), Gaps = 21/208 (10%)

Query: 604 SDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXX 663
           + A +RT+Y+GNI P  +A  + + VR G+++ I+ +  K   F++F++           
Sbjct: 141 TSAPSRTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDA 200

Query: 664 FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSL--PEFAFKDKYINDPEF 721
            +  + + G  +K+GWG  +   P   +     GA+RNVY+     + +F  +   DP  
Sbjct: 201 ILKRLNIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPRD 260

Query: 722 KEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEE--ATNDF 779
           +   E       ++LR D S YG  E +  +++    +V+F +I SAIK+V    A N +
Sbjct: 261 EVVTE-------QKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSLAAVNPY 313

Query: 780 DRFNEKFDERYNGLVINYGKDRCGNINK 807
                     Y    I YGKDRC  I K
Sbjct: 314 ----------YANKKIFYGKDRCAFITK 331

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  162 bits (410), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/199 (41%), Positives = 115/199 (57%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRTIY+GN+    K E+ICN VRGG+LQ IK +  +H+CFVTFI+            + 
Sbjct: 393 GNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSLH 452

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
            + +H    K+GWG +SGPLP  +ALAV+ GASRN+Y+   +F   D+ +  P F E   
Sbjct: 453 GLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIFTE--- 508

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                    LR  F  +G  EQIN+L + +CC++NF NISSAI  +++          K 
Sbjct: 509 -------TSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI---------KS 552

Query: 787 DERYNGLVINYGKDRCGNI 805
              +  L IN+GKDRCGN+
Sbjct: 553 IPTFKDLKINFGKDRCGNV 571

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 96/208 (46%), Gaps = 21/208 (10%)

Query: 604 SDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXX 663
           + A +RT+Y+GN+ P     ++ + VR G+++ +K +  K   F++F++           
Sbjct: 151 TSAPSRTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDA 210

Query: 664 FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSL----PEFAFKDKYINDP 719
            +  + +    +K+GWG  +   P   A     GA+RNVY+      P+     ++  DP
Sbjct: 211 ILKRLNIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGADP 268

Query: 720 EFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDF 779
             +   E       E+LR D + +G  E +  +++    +V+F +I SAIK+V    N  
Sbjct: 269 NEETITE-------EKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANLAN-- 319

Query: 780 DRFNEKFDERYNGLVINYGKDRCGNINK 807
                  +  Y    I YGKDRC  I K
Sbjct: 320 ------VNPYYAQKKIFYGKDRCAFITK 341

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  162 bits (411), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 81/199 (40%), Positives = 117/199 (58%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRT+Y+GN+    K E+ICN +RGG+LQ+IK +  +H+CFVTFI+            + 
Sbjct: 470 GNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSLH 529

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
            + +H    K+GWG +SGPLP  IALAV+ GASRN+Y+    F  +D    +  F E   
Sbjct: 530 GLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLGNINFE-EDAKQEESVFAE--- 585

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                  + LR  F  +G  EQIN+L + +CC++NF NIS+AI  +++          K 
Sbjct: 586 -------DTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKI---------KS 629

Query: 787 DERYNGLVINYGKDRCGNI 805
           +  +N L IN+GKDRCGN+
Sbjct: 630 NPHFNNLKINFGKDRCGNV 648

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 131/299 (43%), Gaps = 49/299 (16%)

Query: 537 NSSSTMLSGNGTFISN-TPMLIPSQSFYMDQNTQIQEAPFRSNSFIHPI----------- 584
           N  S ++  NG  +S+ + M +PSQ  Y+D +T +Q A   S+ F+ PI           
Sbjct: 141 NLMSPVIGSNGIGMSDMSSMHLPSQE-YLDYST-LQSA---SSEFLSPIPVNVMSAEPQD 195

Query: 585 ---TDSLENQLSTSAKVASAMGSD----------AGNRTIYIGNINPRSKAEDICNVVRG 631
              T ++  Q +  A +  ++ S           A +RT+Y+GNI      + + + VR 
Sbjct: 196 HMSTVNMIAQFTAEANLPLSLQSGQLNNPRDFTTAPSRTVYLGNIPATITYKALLDYVRT 255

Query: 632 GILQSIKFIESKHICFVTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKSIA 691
           G+++ +K +  K   FV+F++            +  + + G  +K+GWG      P   A
Sbjct: 256 GVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRLNIDGRDIKIGWGKPQPIDPIVRA 315

Query: 692 LAVTIGASRNVYVSLPEFAFKD---KYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQ 748
                GA+RNVY+       KD   K+  DP       K  L   E+L  D S +G  E 
Sbjct: 316 GIANDGATRNVYIGKLN-TNKDSCEKWGADP-------KEILVTKEKLYDDLSQFGEIES 367

Query: 749 INYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKFDERYNGLVINYGKDRCGNINK 807
           I  + D    +V+F +I +AIK V    +         D  Y+   + YGKDRC  I K
Sbjct: 368 IKLVEDRGIAFVHFTSIFAAIKAVANIGS--------IDPYYSNKKVFYGKDRCAFITK 418

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  162 bits (410), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 121/199 (60%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRTIY+GN+    + E+ICNVVRGG+LQS+K +  +++CFVTFI+            + 
Sbjct: 497 GNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSLH 556

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
            + +     K+GWG +SGPL  ++ALAV+ GASRN+Y+   +FA  DK  ++P F E   
Sbjct: 557 GLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIFTE--- 612

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                  + LR  FS YG  EQIN+L + +CC++NF NIS+AI  +++          K 
Sbjct: 613 -------DSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKI---------KS 656

Query: 787 DERYNGLVINYGKDRCGNI 805
           +  +  L IN+GKDRCGNI
Sbjct: 657 NPVFKDLKINFGKDRCGNI 675

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 107/254 (42%), Gaps = 53/254 (20%)

Query: 597 KVASAMGS---------DAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICF 647
           ++ S MGS          A +RT+Y+GNI      +++ + VR G+++ +K I  K   F
Sbjct: 201 RMQSTMGSRLNDPLDFTTAPSRTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAF 260

Query: 648 VTFIEXXXXXXXXXXXFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVS-L 706
           ++F++            +  + ++G  +K+GWG  +   P      +  GA+RNV++  L
Sbjct: 261 ISFLDENSALLFHSDAILKRLNINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQL 320

Query: 707 PEFAF-------------KDKYINDPEFKEYHEKFKLPDP------------------EQ 735
              +F             ++  IN     E  EK    D                    +
Sbjct: 321 KTKSFDPNKAKVTKMPPSRNHDINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAK 380

Query: 736 LRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVE--EATNDFDRFNEKFDERYNGL 793
           LR D + +G  + I  + D    +++F +I+SAIK V    + ND+          Y+  
Sbjct: 381 LRKDLADFGDIDCIKIVEDKGIAFIHFASITSAIKCVHNLNSMNDY----------YSTK 430

Query: 794 VINYGKDRCGNINK 807
            I YGKDRC  I K
Sbjct: 431 KIFYGKDRCAFITK 444

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  161 bits (407), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 118/200 (59%), Gaps = 22/200 (11%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRT+Y+GN+    K E+ICNVVRGG+LQS+K +  +++CFVTFI+            + 
Sbjct: 446 GNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSSLH 505

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPE-FKEYH 725
            + +     K+GWG +SGPLP ++ALAV+ GASRNVY+      F+   + DP  F E  
Sbjct: 506 GLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDPRIFTE-- 561

Query: 726 EKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEK 785
                   + LR  F  YG  EQIN+L + +CC++NF NIS+AI  +++          K
Sbjct: 562 --------DSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKI---------K 604

Query: 786 FDERYNGLVINYGKDRCGNI 805
            +  +  L IN+GKDRCGN+
Sbjct: 605 SNPHFEDLKINFGKDRCGNV 624

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 91/202 (45%), Gaps = 19/202 (9%)

Query: 606 AGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFI 665
           A +RT+Y+GNI      +++ + VR G+++ +K I  K   F++F++            +
Sbjct: 211 APSRTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAIL 270

Query: 666 DPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYH 725
             + + G  +K+GWG  +   P   A  +   A+RNV++        +K  ND   KE  
Sbjct: 271 KRLNIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFI-----GHLNKTDNDSCTKEPI 325

Query: 726 EKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEK 785
            + K      LR D   +G  E +  + +    +V+F +I+SAIK V             
Sbjct: 326 TEAK------LREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNL--------RS 371

Query: 786 FDERYNGLVINYGKDRCGNINK 807
            +  Y    I YGKDRC  I K
Sbjct: 372 MNPYYENKKIAYGKDRCAFITK 393

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  160 bits (404), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 117/203 (57%), Gaps = 20/203 (9%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRT+Y+GN+    K E+ICN VR G+LQS+K +  +H+CFVTFI+            + 
Sbjct: 407 GNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 466

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
            ++L     K+GWG +SGPLP  IALAV+ GASRNVY+   +F  +D   N+  F E   
Sbjct: 467 GLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFE-EDSKRNERVFTE--- 522

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                  + LR  F  YG  EQIN+L   +CC++N+ NIS+AI  +++          K 
Sbjct: 523 -------DNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKI---------KS 566

Query: 787 DERYNGLVINYGKDRCGNINKNL 809
           +  +  L IN+GKDRCGNI   L
Sbjct: 567 NPYFKDLKINFGKDRCGNIPHQL 589

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 118/263 (44%), Gaps = 17/263 (6%)

Query: 547 GTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNSFIHPITDSLENQLSTSAKVASAMG-SD 605
           G+F  N       +S   +Q+ QI E+P+   +         EN L       S +  + 
Sbjct: 107 GSFSGNGHYYTDERSISSEQD-QIAESPYLVAAAAAAAISKTENNLPLQNSFESPVNFTS 165

Query: 606 AGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFI 665
           A +RT+Y+GNI      +++ + VR G+++ +K +  K   F++F++            +
Sbjct: 166 APSRTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAIL 225

Query: 666 DPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVS-LPEFAFKDKYINDPEFKEY 724
             + + G  +K+GWG  +   P       T GA+RNVY+  L   A   + +N P+  E 
Sbjct: 226 KRLNIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIGQLYTDAEVAESLNIPKESE- 284

Query: 725 HEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNE 784
                +   E+L  D   YG  + +  + +    +++F +I SAIK+V    N+    N 
Sbjct: 285 -----IVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVV----NNLAASNR 335

Query: 785 KFDERYNGLVINYGKDRCGNINK 807
            +  R     I YGKDRC  I K
Sbjct: 336 YYQNRK----IFYGKDRCAFITK 354

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  159 bits (403), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 79/199 (39%), Positives = 117/199 (58%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRT+Y+GN+    K E+ICN VRGG+LQS+K +  +H+CFVTFI+            + 
Sbjct: 399 GNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 458

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
            + +H    K+GWG +SG LP ++ALAV+ GASRN+YV   +F   D+   +  F E   
Sbjct: 459 GLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDE-TGETIFTE--- 514

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                  + LR  F  +G  EQIN+L + +CC++NF NIS+AI  +++          K 
Sbjct: 515 -------QNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKI---------KC 558

Query: 787 DERYNGLVINYGKDRCGNI 805
           +  +  L +N+GKDRCGN+
Sbjct: 559 NPYFKNLKVNFGKDRCGNV 577

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 98/206 (47%), Gaps = 21/206 (10%)

Query: 606 AGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFI 665
           A +RT+Y+GNI P   A+ + + VR G+++ +K +  +   F++F++            +
Sbjct: 158 APSRTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAIL 217

Query: 666 DPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSL----PEFAFKDKYINDPEF 721
             + + G  +K+GWG  +   P   A   + GA+RNVY+      P+ A   ++  DP  
Sbjct: 218 KRLNIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNE 275

Query: 722 KEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDR 781
           +   E       E+LR D + +G  E I  + D    +V+F +I SAIK+V    +    
Sbjct: 276 EIVSE-------EKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNLAS---- 324

Query: 782 FNEKFDERYNGLVINYGKDRCGNINK 807
                +  Y    I YGKDRC  I K
Sbjct: 325 ----VNPYYTNKKIFYGKDRCAFITK 346

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  160 bits (405), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 114/199 (57%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRT+Y+GN+    K E+ICN VRGG+LQSIK ++ +H+CFVTFI+            + 
Sbjct: 456 GNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSLY 515

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
              +     K+GWG +SGPLP ++ALAV+ GASRNVY+   +F   D     P F E   
Sbjct: 516 GFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFE-ADSKKEQPIFNE--- 571

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                    LR  F  YG  EQIN+L +  CC++NF NI++AI  +++          K 
Sbjct: 572 -------TALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKI---------KS 615

Query: 787 DERYNGLVINYGKDRCGNI 805
           +  +  L IN+GKDRCGN+
Sbjct: 616 NPHFKSLKINFGKDRCGNV 634

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 93/204 (45%), Gaps = 19/204 (9%)

Query: 604 SDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXX 663
           + A +RT+Y+GNI P    +++ + VR G+++  K +  K   F++F+E           
Sbjct: 219 TSAPSRTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDA 278

Query: 664 FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKE 723
            +  + +    +K+GWG  +   P   +  +  GA+RNVY+            ND   KE
Sbjct: 279 ILKRLNIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGN--------NDRSSKE 330

Query: 724 YHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFN 783
             E       E+LR D   YG  + I  + +    +V+F +I++AIK+V         + 
Sbjct: 331 NKEPLT---EEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQKNPFYQ 387

Query: 784 EKFDERYNGLVINYGKDRCGNINK 807
           EK         I YGKDRC  I K
Sbjct: 388 EK--------KIFYGKDRCAFITK 403

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  155 bits (393), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 114/199 (57%), Gaps = 24/199 (12%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRTIY+GN+    K E+ICNVVRGG+LQ+IK +  +  CF+TFI+            + 
Sbjct: 354 GNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSLH 413

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
            + +  N  K+GWG +SGPL  ++ALA++ GASRN+Y+   +F  K++Y N+        
Sbjct: 414 GLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFNE-------- 465

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                  E LR  F  +G  EQIN+L +  CC+VNF NI+ AI  +++          K 
Sbjct: 466 -------EHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKI---------KS 509

Query: 787 DERYNGLVINYGKDRCGNI 805
              +  L IN+GKDRCGNI
Sbjct: 510 LPEFEDLKINFGKDRCGNI 528

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 102/205 (49%), Gaps = 27/205 (13%)

Query: 604 SDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXX 663
           ++A +RT+Y+GNI      +++ + VR G+++S+K + +K   F++FI+           
Sbjct: 123 TNAPSRTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDA 182

Query: 664 FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVT-IGASRNVYVSLPEFAFKDKYINDPEFK 722
            +  + + G  +K+GWG  S  +   +A  +T  GA+RNVY+         +  +DP   
Sbjct: 183 ILKRLNIRGKDIKIGWGK-SNHIDSIVAARITNDGATRNVYIG--------QLNDDP--- 230

Query: 723 EYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRF 782
                  +   ++L  D   +G  + I +LS+    +V+F +IS AI +V+  +      
Sbjct: 231 ------TITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLS------ 278

Query: 783 NEKFDERYNGLVINYGKDRCGNINK 807
             K +E+Y    I YGKDRC  I K
Sbjct: 279 --KLNEKYKNKRIFYGKDRCAFITK 301

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  156 bits (394), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 81/199 (40%), Positives = 116/199 (58%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRT+Y+GN+    K E+ICNVVRGGILQ+IK +  +H+CFVTFI+            + 
Sbjct: 401 GNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSLH 460

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
            I +     ++GWG + GPLP +IALAV+ GASRNVY+   +F ++D    +P F     
Sbjct: 461 GITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIFTA--- 516

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                  + LR  F  YG  EQ+N+L + +C +VN+ NIS+AI  +++          K 
Sbjct: 517 -------DYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKI---------KS 560

Query: 787 DERYNGLVINYGKDRCGNI 805
           +  +  L IN+GKDRCG I
Sbjct: 561 NPLFKNLKINFGKDRCGTI 579

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 93/206 (45%), Gaps = 17/206 (8%)

Query: 604 SDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXX 663
           + A  +T+Y+GNI P     ++ + VR G+++ +K +  K   F+TF++           
Sbjct: 158 TSAPRKTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDA 217

Query: 664 FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSL--PEFAFKDKYINDPEF 721
            +  + + G  +K+GWG  +   P       + GA+RNVY+ L   +     +   DP  
Sbjct: 218 ILKRLHIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPND 277

Query: 722 KEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDR 781
           ++  E       E+LR D   +G  + +  + +    +++F +I SA+K+V         
Sbjct: 278 EKITE-------EKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANLAG---- 326

Query: 782 FNEKFDERYNGLVINYGKDRCGNINK 807
                +  Y    I YGKDRC  I K
Sbjct: 327 ----INPYYENKKIYYGKDRCAFITK 348

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  153 bits (386), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 81/199 (40%), Positives = 116/199 (58%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRT+Y+G++    K E+ICN VRGG+LQSIK +  +++CFVTFI+            + 
Sbjct: 413 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 472

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
              +     K+GWG +SGPLP ++ALAV+ GASRNVYV   +FA  D   ++  F E   
Sbjct: 473 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA-SDSLNDERIFTE--- 528

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                    LR  F  YG  EQIN+L + +CC++N+ NIS+AI  +++          K 
Sbjct: 529 -------NNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI---------KS 572

Query: 787 DERYNGLVINYGKDRCGNI 805
           +  +  L IN+GKDRCGN+
Sbjct: 573 NPYFKDLKINFGKDRCGNV 591

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 95/204 (46%), Gaps = 23/204 (11%)

Query: 604 SDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXX 663
           + A  RT+Y+GN+ P    +++ + VR G+++ +K I  K   F++F++           
Sbjct: 180 TSAPTRTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDA 239

Query: 664 FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKE 723
            +  + +    +K+GWG  +   P   A   T GA+RNVY+       ++ ++++     
Sbjct: 240 ILKRLNIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHLSE----- 294

Query: 724 YHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFN 783
                     EQLR D   YG  + I  + +    +++F +I +AIK+V   TN   R  
Sbjct: 295 ----------EQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVV---TNLPIR-- 339

Query: 784 EKFDERYNGLVINYGKDRCGNINK 807
              +  Y    I YGKDRC  I K
Sbjct: 340 ---NPYYQNKRIFYGKDRCAFITK 360

 Score = 32.3 bits (72), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 94/211 (44%), Gaps = 43/211 (20%)

Query: 197 TRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKNDSNTCDIILSFLSRHICLDFYN 256
           TR++   NV   + +   + + V++  +E + ++P K     C  I SF+     L F++
Sbjct: 184 TRTVYLGNVPPHLTVKELL-DHVRSGVVEDVKIIPEK----MCAFI-SFVDESAALLFHS 237

Query: 257 N-VLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSLEFNIVTRDATRSLAIELCSN 315
           + +L+RL    +           + + + K TR +  P +   I T  ATR++ I   + 
Sbjct: 238 DAILKRLNIGDRD----------IKIGWGKPTRID--PIVAARITTDGATRNVYIGRMTV 285

Query: 316 ENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVSTDKSNKEFGKNYAILSFLNITM 375
           E +   L +EQ         LR D  +   ++ I ++      KE  K  A + F +I  
Sbjct: 286 EGEESHLSEEQ---------LRADLQEYGEIDCIKII------KE--KGIAFIHFASILN 328

Query: 376 AIEIMDYIQVI-----SSKLNIGK--CSFVT 399
           AI+++  + +      + ++  GK  C+F+T
Sbjct: 329 AIKVVTNLPIRNPYYQNKRIFYGKDRCAFIT 359

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  153 bits (386), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 81/199 (40%), Positives = 115/199 (57%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRT+Y+G++    K E+ICN VRGG+LQSIK +  +++CFVTFI+            + 
Sbjct: 442 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 501

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
              +     K+GWG +SGPLP ++ALAV+ GASRNVYV   +F   D   ++  F E   
Sbjct: 502 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFV-SDSLRDERIFTE--- 557

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                    LR  F  YG  EQIN+L + +CC+VN+ NIS+AI  +++          K 
Sbjct: 558 -------SNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKI---------KS 601

Query: 787 DERYNGLVINYGKDRCGNI 805
           +  +  L IN+GKDRCGN+
Sbjct: 602 NPYFKDLKINFGKDRCGNV 620

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 97/204 (47%), Gaps = 23/204 (11%)

Query: 604 SDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXX 663
           + A +RT+Y+GN+ P    +++ + VR G+++ +K I  K   F++F++           
Sbjct: 209 TSAPSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDA 268

Query: 664 FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKE 723
            +  + +    +K+GWG  +   P   A   T GA+RNVY+       ++ ++++     
Sbjct: 269 ILKRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIDGEESHLSE----- 323

Query: 724 YHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFN 783
                     EQLRID   YG  + I  + +    +++F +I +AIK+V   TN   R  
Sbjct: 324 ----------EQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVV---TNLPIR-- 368

Query: 784 EKFDERYNGLVINYGKDRCGNINK 807
              +  Y    I YGKDRC  I K
Sbjct: 369 ---NPYYQNKRIFYGKDRCAFITK 389

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  153 bits (386), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 81/199 (40%), Positives = 113/199 (56%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRT+Y+GN+    K E+ICNVVRGG+LQ++K +  +H+CFVTFI+            + 
Sbjct: 449 GNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSLH 508

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
            I +     ++GWG + G L  ++ALAV+ GASRNVYV    F  +D    DP F E   
Sbjct: 509 GITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFD-EDSKREDPIFTE--- 564

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                    LR  F  +G  EQINYL + +CC+VN+ NIS+AI  +++          K 
Sbjct: 565 -------SSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKI---------KG 608

Query: 787 DERYNGLVINYGKDRCGNI 805
              +  L IN+GKDRCGN+
Sbjct: 609 HPVFKDLKINFGKDRCGNV 627

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 95/208 (45%), Gaps = 22/208 (10%)

Query: 605 DAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXF 664
           +A ++T+Y+GN       +++ + VR G+++ ++ +  K   FV+F++            
Sbjct: 206 NAPSKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAI 265

Query: 665 IDPIVLHGNTLKLGWGNYSGPLPKSIALAVT-IGASRNVYVSLPEFAFKDKYINDPEFKE 723
           +  + + G  +K+GWG  + P+   +A AV    A+RNVY+         +    P+   
Sbjct: 266 LKRLHIDGRDIKIGWGKPT-PIDPVVATAVANDNATRNVYIG--------QLNTGPKLSS 316

Query: 724 YHEKFKLPDP----EQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDF 779
                 + +P    ++LR+D   +G  + I  + +    +V+F +I +AIK V    N  
Sbjct: 317 QVSPVDVTEPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLAN-- 374

Query: 780 DRFNEKFDERYNGLVINYGKDRCGNINK 807
                  +  Y    I YGKDRC  I K
Sbjct: 375 ------INPYYRNKKIFYGKDRCAFITK 396

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  152 bits (385), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 115/199 (57%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRT+Y+G++    K E+ICN VRGG+LQSIK +  +++CFVTFI+            + 
Sbjct: 429 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 488

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
              +     K+GWG +SGPLP ++ALAV+ GASRNVYV   +F   D   ++  F E   
Sbjct: 489 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFV-GDSLRDERVFTE--- 544

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
                    LR  F  YG  EQIN+L + +CC++N+ NIS+AI  +++          K 
Sbjct: 545 -------SNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI---------KS 588

Query: 787 DERYNGLVINYGKDRCGNI 805
           +  +  L IN+GKDRCGN+
Sbjct: 589 NPYFKDLKINFGKDRCGNV 607

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 97/204 (47%), Gaps = 23/204 (11%)

Query: 604 SDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXX 663
           + A +RT+Y+GN+ P    +++ + VR G+++ +K I  K   FV+FI+           
Sbjct: 196 TSAPSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDA 255

Query: 664 FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKE 723
            +  + +    +K+GWG  +   P   A   T GA+RNVY+       ++ ++++     
Sbjct: 256 ILKRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHLSE----- 310

Query: 724 YHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFN 783
                     EQLR+D   YG  + I  + +    +++F +I +AIK+V   TN   R  
Sbjct: 311 ----------EQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVV---TNLPIR-- 355

Query: 784 EKFDERYNGLVINYGKDRCGNINK 807
              +  Y    I YGKDRC  I K
Sbjct: 356 ---NPYYQNKRIFYGKDRCAFITK 376

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  151 bits (381), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 112/203 (55%), Gaps = 28/203 (13%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRT+Y+GN+    + EDICN +R G+LQ+IK +  +H+CFVTFI+            I 
Sbjct: 413 GNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSIY 472

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAF----KDKYINDPEFK 722
             VL     K+GWG +SGPL   + LAV+ GASRNVY+   +F      +++Y  D    
Sbjct: 473 GFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFTADGTKRERYFTD---- 528

Query: 723 EYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRF 782
                        LR  FS YG  EQIN+L   +CC+VN+ NI++AI  +++  N     
Sbjct: 529 -----------SNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIKN----- 572

Query: 783 NEKFDERYNGLVINYGKDRCGNI 805
               +  +  L IN+GKDRCGNI
Sbjct: 573 ----NPTFKNLKINFGKDRCGNI 591

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 101/206 (49%), Gaps = 14/206 (6%)

Query: 606 AGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFI 665
           A +RT+Y+GNI P   A D+ + VR G+++ +K +  K   F++F++            +
Sbjct: 165 APSRTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAIL 224

Query: 666 DPIVLHGNTLKLGWGNYSGPLPKSIALAV-TIGASRNVYVSLPEFAFKDKYINDPEFKEY 724
             + + G  +K+GWG  S PL   IA +V T GA+RN+++        +K   D +   Y
Sbjct: 225 KRLNIDGKDIKIGWGKPS-PLSPIIATSVATDGATRNIFIGQLNTTDHNKQ-KDNDATIY 282

Query: 725 HEKFKLPD---PEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDR 781
           H      D    E+LR D   YG  + I    +    +V+F +I SAIK+V   +N    
Sbjct: 283 HGSDDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSNPY 342

Query: 782 FNEKFDERYNGLVINYGKDRCGNINK 807
           +++K         I YGKDRC  I K
Sbjct: 343 YSKK--------KIYYGKDRCAFITK 360

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  151 bits (381), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/199 (39%), Positives = 116/199 (58%), Gaps = 20/199 (10%)

Query: 607 GNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXXFID 666
           GNRT+Y+G++    K E+ICN VRGG+LQSIK +  +++CFVTFI+            + 
Sbjct: 431 GNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSLY 490

Query: 667 PIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHE 726
              +     K+GWG +SGPLP ++ALAV+ GASRNVYV          Y++D    E   
Sbjct: 491 GFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDYVSDSVRDE--- 541

Query: 727 KFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKF 786
             ++    +LR  F  YG  EQIN+L + +CC++N+ NIS+AI  +++          K 
Sbjct: 542 --RIFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI---------KS 590

Query: 787 DERYNGLVINYGKDRCGNI 805
           +  +  L IN+GKDRCGN+
Sbjct: 591 NPYFKDLKINFGKDRCGNV 609

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 95/204 (46%), Gaps = 23/204 (11%)

Query: 604 SDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHICFVTFIEXXXXXXXXXXX 663
           + A +RT+Y+GN+ P    +++ + VR G+++ +K I  K   F++F++           
Sbjct: 198 TSAQSRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDA 257

Query: 664 FIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSLPEFAFKDKYINDPEFKE 723
            +  + +    +K+GWG  +   P   A   T GA+RNVY+       ++ +++      
Sbjct: 258 ILKRLNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHLSG----- 312

Query: 724 YHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATNDFDRFN 783
                     EQLR D   YG  + I  + +    +++F +I +AIK+V   TN   R  
Sbjct: 313 ----------EQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVV---TNLPIR-- 357

Query: 784 EKFDERYNGLVINYGKDRCGNINK 807
              +  Y    I YGKDRC  I K
Sbjct: 358 ---NLYYQNKRIFYGKDRCAFITK 378

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 734 EQLRIDFSSYGPTEQIN-YLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKFDERYNG 792
           ++L+ DFS +G    I+  +S   C  +NF +I SA+  ++   N     N K+ E +  
Sbjct: 303 QELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQSYKNANSPLNRKYAESW-- 360

Query: 793 LVINYGKD 800
             I YGKD
Sbjct: 361 -TIGYGKD 367

>KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {ON}
           Anc_8.670 YOR242C
          Length = 374

 Score = 35.4 bits (80), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 732 DPEQLRIDFSSYGPTEQIN-YLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKFDERY 790
           DP  +  DF  +G  +++   +S   C  VN+ NI SA+K +E   +     + K+   Y
Sbjct: 299 DPSIIVEDFGQFGRIQEVTPIISRKLCVAVNYYNILSALKAIESYEDPNSELHRKY---Y 355

Query: 791 NGLVINYGKD 800
               I +GKD
Sbjct: 356 KSWAIWFGKD 365

>Smik_9.200 Chr9 complement(332149..332898) [750 bp, 249 aa] {ON}
           YIR001C (REAL)
          Length = 249

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 7   SRKNSGFHIYQSQQPAQDQYYSAFDTTNPLMSYPQFEQ-PYGATFPPPLSSSTHF---QQ 62
           SRK +    Y      Q+QY+  +    PLM+YP  +  PY A +PP  S + +F   + 
Sbjct: 137 SRKRTNIPGYNRHYNTQNQYFQQWQWNYPLMAYPNPDSFPYYAPYPPNQSPNQNFGYNKS 196

Query: 63  TYYKG 67
            YY+G
Sbjct: 197 GYYRG 201

>KLLA0F24398g Chr6 complement(2271709..2274876) [3168 bp, 1055 aa]
           {ON} highly similar to uniprot|P53914 Saccharomyces
           cerevisiae YNL132W KRE33 Essential protein of unknown
           function heterozygous mutant shows haploinsufficiency in
           K1 killer toxin resistance
          Length = 1055

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 45/101 (44%), Gaps = 10/101 (9%)

Query: 218 FVKNNSIESIYLVPNKND---SNTCDIILSFLSRH------ICLDFYNNVLQRLK-EFKK 267
           F KNN    +YL    ND    +TC ++     R          DF+   L  L  +FKK
Sbjct: 734 FWKNNGFVPVYLRQTANDLTGEHTCVMVKVLEGRESKWLAEFAKDFHKRFLSLLSFDFKK 793

Query: 268 HLNSESLNLNFVSLKYNKTTRDNQGPSLEFNIVTRDATRSL 308
               E+LN+   + K     +D++G S +  ++TRD   S+
Sbjct: 794 FTAIEALNVIESAKKGETLDQDSEGRSFQNKVLTRDQLDSI 834

>Skud_15.409 Chr15 complement(727725..728840) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 732 DPEQLRIDFSSYGPTEQIN-YLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNEKFDERY 790
           D ++L  DF ++G   +I   +S   C  + F +ISSA++ +EE        N K+   +
Sbjct: 296 DIQELEKDFRNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYGQKGSYINTKY---F 352

Query: 791 NGLVINYGKD 800
               I YGKD
Sbjct: 353 KAWTIWYGKD 362

>KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON}
           Anc_8.466 YDL209C
          Length = 330

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 735 QLRIDFSSYGPTEQINYLSDSHCCWVNFMNISSAIKLVEEATN 777
           +LR  F+  GP ++I Y+++ +C +V F N  +A    E  TN
Sbjct: 151 RLRFMFNKLGPIDKIRYVANKNCAFVKFRNARNAEFAKEAMTN 193

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 109,310,637
Number of extensions: 5285127
Number of successful extensions: 25588
Number of sequences better than 10.0: 383
Number of HSP's gapped: 26687
Number of HSP's successfully gapped: 487
Length of query: 1042
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 922
Effective length of database: 39,721,479
Effective search space: 36623203638
Effective search space used: 36623203638
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)