Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A028408.843ON52052024680.0
NDAI0E002808.843ON54951216020.0
NCAS0B002908.843ON54248815470.0
KNAG0G034308.843ON54250315150.0
Skud_13.258.843ON53752414670.0
Suva_13.278.843ON55351114360.0
YML116W (ATR1)8.843ON54251014330.0
YMR279C8.843ON54050914240.0
Smik_13.188.843ON54549314130.0
Suva_13.4678.843ON54347214090.0
NDAI0K004008.843ON55348514000.0
NCAS0A02540singletonON53951613960.0
KNAG0J002608.843ON55048913910.0
Smik_13.4928.843ON54347213890.0
NCAS0C004008.843ON51750513810.0
KAFR0B03930singletonON55550413700.0
SAKL0D01386g8.843ON52146513660.0
Skud_13.4518.843ON53948313640.0
CAGL0B02343g8.843ON53750313600.0
KLTH0C03806g8.843ON52548613351e-180
TDEL0B005508.843ON53751713281e-179
Kwal_27.102458.843ON51548513181e-178
KAFR0B039408.843ON54752112961e-174
Kpol_541.168.843ON52850612941e-174
CAGL0M03003g8.843ON55852112881e-173
TBLA0D032708.843ON55048312781e-171
TPHA0C047908.843ON55652212601e-168
TBLA0D03280singletonON58048212541e-167
TBLA0C01160singletonON6004729811e-126
Smik_15.560na 1ON5164857273e-89
KLTH0C10560gna 1ON5154847264e-89
Suva_8.435na 1ON5154917248e-89
Skud_15.545na 1ON5164827213e-88
YOR378Wna 1ON5154817171e-87
Kwal_23.6547na 1ON5114686872e-83
KLLA0B00352gna 1ON4984726723e-81
TDEL0G04950singletonON5125096542e-78
SAKL0C06116gsingletonON1851904545e-53
KNAG0D00130na 1ON5654164422e-47
KAFR0C04860na 1ON5344743734e-38
CAGL0L02519gna 1ON5294473648e-37
NCAS0A05720na 1ON5634693437e-34
NDAI0K02730singletonON6045443218e-31
YKR105C (VBA5)singletonON5823761054e-04
Smik_13.2722.473ON561841028e-04
YMR088C (VBA1)2.473ON562841000.001
Suva_13.2652.473ON561143990.002
TDEL0A024902.473ON55479980.003
Skud_13.2442.473ON56284980.003
NCAS0A078102.473ON56884950.005
NDAI0H022002.473ON57184950.006
KLLA0C18931gna 2ON553218940.008
CAGL0J01375g2.473ON56484920.013
TDEL0F039908.272ON63170920.014
Suva_10.11singletonON540128910.018
SAKL0E02992g2.473ON57079900.023
TDEL0D06610singletonON497130890.031
KLLA0A04631g8.272ON57984890.032
SAKL0F00440gsingletonON544121880.039
Skud_6.16na 3ON54997880.039
Smik_6.24na 3ON54481850.099
SAKL0A08228gsingletonON56985830.16
KNAG0E025602.473ON57879830.17
ZYRO0G21868gna 4ON620148810.26
KLTH0D16962gsingletonON57185810.27
Kwal_34.15746na 2ON518104810.27
ZYRO0G21890gsingletonON57682800.39
YPR198W (SGE1)singletonON543228790.42
Kpol_543.448.272ON64348800.42
TPHA0G031502.473ON60078790.44
SAKL0A00726gsingletonON598143790.45
Smik_11.368singletonON580416790.51
AGR076C8.272ON68684780.60
SAKL0D04510gna 5ON53185780.68
KAFR0J009302.242ON566245770.76
KLLA0E24113g8.570ON575186770.78
NDAI0D010202.242ON592172770.79
NCAS0C03460na 6ON630133770.81
Skud_16.503singletonON543228770.81
TPHA0A017508.272ON63667770.85
ZYRO0C01430g8.272ON59084770.89
KLTH0C10142gsingletonON573223770.90
YCL069W (VBA3)singletonON458182761.0
YNL065W (AQR1)2.242ON586243751.3
SAKL0H16808g8.272ON65748751.4
SAKL0F16632gsingletonON615147751.6
TDEL0B019008.446ON68755751.6
KLTH0H16214gsingletonON551134741.7
KAFR0B010807.309ON726117732.3
KLLA0F17776gna 7ON55371722.9
KLTH0C10120gsingletonON65185723.2
KAFR0B055508.261ON555108723.3
TBLA0C01100na 8ON64983723.6
Smik_12.114.6ON166135723.8
SAKL0F00198gsingletonON537138713.8
TBLA0F030408.272ON90666724.1
Skud_18.3singletonON590226714.2
SAKL0B12716gsingletonON632138714.3
NCAS0F04060singletonON610108705.1
NCAS0I03210singletonON568108705.3
Skud_14.2672.242ON562243706.2
KLTH0B00594gsingletonON61884697.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A02840
         (520 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   955   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      621   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      600   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   588   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   569   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   557   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   556   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   553   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   548   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   547   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               543   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   542   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   540   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   539   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      536   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   532   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   530   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   530   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   528   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   518   e-180
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   516   e-179
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   512   e-178
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   503   e-174
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   503   e-174
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   500   e-173
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   496   e-171
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   489   e-168
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   487   e-167
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   382   e-126
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   284   3e-89
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   284   4e-89
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   283   8e-89
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   282   3e-88
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   280   1e-87
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   269   2e-83
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   263   3e-81
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   256   2e-78
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   179   5e-53
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   174   2e-47
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     148   4e-38
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   144   8e-37
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            136   7e-34
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   128   8e-31
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    45   4e-04
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    44   8e-04
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    43   0.001
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    43   0.002
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    42   0.003
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    42   0.003
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    41   0.005
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    41   0.006
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    41   0.008
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    40   0.013
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    40   0.014
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    40   0.018
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    39   0.023
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    39   0.031
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    39   0.032
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    39   0.039
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    39   0.039
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    37   0.099
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    37   0.16 
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    37   0.17 
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    36   0.26 
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    36   0.27 
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    36   0.27 
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    35   0.39 
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    35   0.42 
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    35   0.42 
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    35   0.44 
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    35   0.45 
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    35   0.51 
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    35   0.60 
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    35   0.68 
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    34   0.76 
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    34   0.78 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    34   0.79 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    34   0.81 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    34   0.81 
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    34   0.85 
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    34   0.89 
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    34   0.90 
YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease ...    34   1.0  
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    33   1.3  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    33   1.4  
SAKL0F16632g Chr6 complement(1375911..1377758) [1848 bp, 615 aa]...    33   1.6  
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    33   1.6  
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    33   1.7  
KAFR0B01080 Chr2 (204541..206721) [2181 bp, 726 aa] {ON} Anc_7.3...    33   2.3  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    32   2.9  
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    32   3.2  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...    32   3.3  
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     32   3.6  
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...    32   3.8  
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    32   3.8  
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    32   4.1  
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    32   4.2  
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    32   4.3  
NCAS0F04060 Chr6 (809459..811291) [1833 bp, 610 aa] {ON}               32   5.1  
NCAS0I03210 Chr9 (600725..602431) [1707 bp, 568 aa] {ON}               32   5.3  
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    32   6.2  
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    31   7.3  

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/520 (92%), Positives = 479/520 (92%)

Query: 1   MAESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQ 60
           MAESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQ
Sbjct: 1   MAESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQ 60

Query: 61  LLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLI 120
           LLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLI
Sbjct: 61  LLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLI 120

Query: 121 GGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNM 180
           GGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNM
Sbjct: 121 GGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNM 180

Query: 181 VISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTN 240
           VISLIAASAPV          LIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTN
Sbjct: 181 VISLIAASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTN 240

Query: 241 VNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFA 300
           VNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWD                   TYEINFA
Sbjct: 241 VNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFA 300

Query: 301 PSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGI 360
           PSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGI
Sbjct: 301 PSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGI 360

Query: 361 FGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGL 420
           FGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGL
Sbjct: 361 FGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGL 420

Query: 421 DTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGY 480
           DTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGY
Sbjct: 421 DTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGY 480

Query: 481 RSAEYXXXXXXXXXXXXACILVIDKLVAKYRNKNSIKNSA 520
           RSAEY            ACILVIDKLVAKYRNKNSIKNSA
Sbjct: 481 RSAEYLGIGLSGLGLLLACILVIDKLVAKYRNKNSIKNSA 520

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/512 (59%), Positives = 379/512 (74%), Gaps = 1/512 (0%)

Query: 3   ESRTSSIKEHIQSDISIDK-SSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQL 61
           E   SSI +   +++S D+  S+E+ +  + + SKWQ+P YF+N +QEYLF+ SCM +QL
Sbjct: 28  EEECSSITKEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMSQL 87

Query: 62  LNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIG 121
           LNQA TPQTLSIMN+++DSF S    +TWL+ASFPLV+GSFILISGRIGDIYGLKKTLIG
Sbjct: 88  LNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLIG 147

Query: 122 GYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMV 181
           GY+F IIWSLI GFT YS +D F II+RAFQGLGIAF LPNV+G +GNIY   + RKN+V
Sbjct: 148 GYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKNIV 207

Query: 182 ISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNV 241
           IS+I ASAP+          LI TE+P QWPW+FYAFAIA + NL ISIYSIP+NIPTN+
Sbjct: 208 ISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPTNI 267

Query: 242 NGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAP 301
           +GF MDWIGS + V GLIL NF WNQGPIVGW                    TYEI +A 
Sbjct: 268 HGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKYAK 327

Query: 302 SPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIF 361
           SP++  E+T +R++I+ +  LFLGWGS+GI+SFYYFSF+LNLRHYS +WAG +YF+F I+
Sbjct: 328 SPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIW 387

Query: 362 GVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLD 421
           G +A+  VG  IK+I+A VIL FSM+ F +G  +LSV PVDQ+YF++ L  M IL  G+D
Sbjct: 388 GTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFGMD 447

Query: 422 TSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYR 481
            SFPAA IILSDGL M+YQGMAGSLA TMVNYSMSLCLGMG TVERQINK G+++LKGYR
Sbjct: 448 MSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKGYR 507

Query: 482 SAEYXXXXXXXXXXXXACILVIDKLVAKYRNK 513
           +AEY            + I + + L AK + +
Sbjct: 508 AAEYLGVGLAGLGIVISGIYMAEVLWAKRKER 539

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/488 (62%), Positives = 362/488 (74%), Gaps = 5/488 (1%)

Query: 3   ESRTSSIKEHI----QSDIS-IDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCM 57
           ES  SSI E        DI  I+K    + E    E SKWQ+P YF+N +QEYLF+ SCM
Sbjct: 17  ESAASSITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEYLFIFSCM 76

Query: 58  TTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKK 117
            +QLLNQA TPQTLSIMN+++DSFNS    +TWL+ASFPLV+GSFILISGRIGDIYGLKK
Sbjct: 77  MSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKK 136

Query: 118 TLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLR 177
           TL+GGYIF IIWS+I G T YS SDTF I++RAFQGL IAF LPNV+G +GNIY   S R
Sbjct: 137 TLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNR 196

Query: 178 KNMVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNI 237
           KN+VIS+I ASAP+          LI TE P QWPW+FYAFAIA +FNL ISIYSIP+++
Sbjct: 197 KNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSV 256

Query: 238 PTNVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEI 297
           PTNV+GF MDWIGS L V GLIL NF WNQGPIVGW                    TYE+
Sbjct: 257 PTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEV 316

Query: 298 NFAPSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFI 357
            +A SPL+  E+T +R++I+ +  LFLGWGS+GI+SFYYFSF+LNLRHYS +WAG +YF+
Sbjct: 317 KYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFM 376

Query: 358 FGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILG 417
           F I+G +A+  VG  IKKI+A  IL  SMV F +G  +LSV PVDQ+YF++ L  M IL 
Sbjct: 377 FAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILS 436

Query: 418 VGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVL 477
            G+D SFPAA IILSDGL M+YQGMAGSLA TMVNYSMSLCLGMG TVERQINK G D+L
Sbjct: 437 FGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLL 496

Query: 478 KGYRSAEY 485
           KGYR AEY
Sbjct: 497 KGYRGAEY 504

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/503 (57%), Positives = 362/503 (71%)

Query: 11  EHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQT 70
           E+  SD     +             KWQD  YF+N +QEY+FVG+CM +QLLNQA  PQT
Sbjct: 30  ENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQT 89

Query: 71  LSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWS 130
           LS+MN+L+ SF+S+  NQTWL+ASFPLV+GSFILISGR+GDIYGLK +L+GG IF IIW+
Sbjct: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149

Query: 131 LICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAP 190
           LI GFT Y+ SDTF I++R+FQGLG+AF LPNV+G +GNIY   + RKN+VISLI A AP
Sbjct: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAP 209

Query: 191 VXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIG 250
           V          LI T++P  WPWSFYA AIA +  LL ++YSIP++IPTNV+GF MDWIG
Sbjct: 210 VGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIG 269

Query: 251 SALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLIAREIT 310
           S L V GLIL NF WNQGPI GW                     YE+++A SPL+ R IT
Sbjct: 270 SGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVIT 329

Query: 311 HSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVG 370
            +R+M++ +  LFLGWGS+GI+SFYYF+F+LNLRHYS VWAGG+YF+F I+GV+AS  VG
Sbjct: 330 QNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVG 389

Query: 371 ISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATII 430
           +SI+KI+A +IL FSM+ F VG  +LSV PV Q+YF++ L  M IL  G+D SFPAA II
Sbjct: 390 LSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAII 449

Query: 431 LSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYXXXXX 490
           LSD LP +YQGMAGSLA TMVNYSMSLCLGMG+TVE QIN++G+D+LKGYR+AEY     
Sbjct: 450 LSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGI 509

Query: 491 XXXXXXXACILVIDKLVAKYRNK 513
                  + I + ++L    + +
Sbjct: 510 ASLAVILSLIYMCERLWIDRKER 532

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/524 (53%), Positives = 362/524 (69%), Gaps = 12/524 (2%)

Query: 2   AESRTSSIKEHIQSDISIDKSS----NEKC--------EVIVREKSKWQDPGYFKNSFQE 49
           AESR  S +   +S  ++ KSS    NE+         E +  +K +WQ+P YFKNS+ E
Sbjct: 10  AESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHE 69

Query: 50  YLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRI 109
           YLF+ +CM +QLLNQA T QTLSIMN++++SF S+ +++TWL+ASFPLV+GSFILISGR+
Sbjct: 70  YLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRL 129

Query: 110 GDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGN 169
           GDIYGLKK L  GY+ +IIWSLICG T YS SDTF II+RAFQGLGIAF LPNV+G IGN
Sbjct: 130 GDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGN 189

Query: 170 IYHVGSLRKNMVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLIS 229
           IY  G+ RKN+VISL+ A APV          LI T++P QWPW+FYA+ I    NL +S
Sbjct: 190 IYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALS 249

Query: 230 IYSIPSNIPTNVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXX 289
           +YSIP+NIPTN+  F MDWIGSAL V GL+L NF WNQ PI GWD               
Sbjct: 250 VYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFL 309

Query: 290 XXXXTYEINFAPSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPV 349
                YE  FA SPL+ R +   R+MI  +  LF GWGS+GI++FYYF F LN+RHYS V
Sbjct: 310 VVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAV 369

Query: 350 WAGGSYFIFGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLT 409
           WAGG+YF+F I+G++A+  VGI IKK++  V L  SM+ F +G+ + SV PV ++YF+  
Sbjct: 370 WAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQ 429

Query: 410 LAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQI 469
           L  M IL  G+D SFPA++II SD LPMEYQGMAGSL  T+VNYSMSLCLGMG TVE  +
Sbjct: 430 LGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHV 489

Query: 470 NKDGQDVLKGYRSAEYXXXXXXXXXXXXACILVIDKLVAKYRNK 513
           + DG+ VLKGYR A+Y            + + ++++++  ++ K
Sbjct: 490 DPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAK 533

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/511 (52%), Positives = 361/511 (70%), Gaps = 1/511 (0%)

Query: 3   ESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLL 62
           E+  SS + + +  ++    +N + EV+ + K KWQ+P YFK  +QEYLF+ +CM +QLL
Sbjct: 34  EAEDSSPRNNKEGALTTIVLTNSEDEVM-KTKQKWQNPNYFKYPWQEYLFIFTCMISQLL 92

Query: 63  NQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGG 122
           NQ+ T QTLSIMN+L+DSF S  ++++WL+ASFPLV+GSFILISGR+GDI+GLK  L+ G
Sbjct: 93  NQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNMLLIG 152

Query: 123 YIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVI 182
           Y+ +IIWSLICG T YS SDTF I++RAFQGLGIAF LPNV+G IGN+Y  G+ RKN+VI
Sbjct: 153 YVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKNIVI 212

Query: 183 SLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVN 242
           S I A AP+          LI T +P+QWPW+FYA+ I    NL++SIY+IP+NIPTNV+
Sbjct: 213 SFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPTNVH 272

Query: 243 GFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPS 302
            F MDWIGS L V GL+L N  WNQ PI GW+                    YEI+FA S
Sbjct: 273 RFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHFAKS 332

Query: 303 PLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFG 362
           PL+ + +   R+MI  + +LF GWGS+GI++FYYF F LN+RHY+P+WAGGSYF+F I+G
Sbjct: 333 PLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFLIWG 392

Query: 363 VLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDT 422
           ++A+  VG SIK+++  V L F+MV F VG+ + SV PV ++YF++ +  M IL  G+D 
Sbjct: 393 IIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFGMDL 452

Query: 423 SFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRS 482
           SFPA++II SD LPMEYQGMAGSL  T+VNYSMSLCLGMG TVE Q++ DG+ +LKGYR 
Sbjct: 453 SFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKGYRG 512

Query: 483 AEYXXXXXXXXXXXXACILVIDKLVAKYRNK 513
           A+Y            + + +++  +  +R K
Sbjct: 513 AQYLGIGLASLACIISGLYMVECYIKDHRAK 543

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/510 (53%), Positives = 354/510 (69%), Gaps = 5/510 (0%)

Query: 4   SRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLN 63
           SR ++I E + +  +  +S +E    +V    KWQ+P YFK ++QEYLF+ +CM +QLLN
Sbjct: 28  SRDNNIGESLTAT-AFTQSEDE----MVDSNQKWQNPNYFKYAWQEYLFIFTCMISQLLN 82

Query: 64  QATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGY 123
           QA T QTLSIMN+LSDSF S  ++++WL+ASFPLV+GSFILISGR+GDIYGLKK L+ GY
Sbjct: 83  QAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGY 142

Query: 124 IFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVIS 183
           + +IIWSLICG T YS SDTF II+RAFQGLGIAF LPNV+G IGNIY  G+ RKN+VIS
Sbjct: 143 VLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVIS 202

Query: 184 LIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNG 243
            + A AP+          LI TE P QWPW+FYA++IA   N ++SIY+IPS IPTN++ 
Sbjct: 203 FVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTNIHH 262

Query: 244 FKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSP 303
           F MDWIGS L V GLIL NF WNQ PI GW+                    YEI FA +P
Sbjct: 263 FSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAKTP 322

Query: 304 LIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGV 363
           L+ R +   R+MI  +  LF GWGS+GI++FYYF F LN+R Y+ +WAGG+YF+F I+G+
Sbjct: 323 LLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMFLIWGI 382

Query: 364 LASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTS 423
           +A+  VG +IK ++  V L FSMV F VG+ + SV PV ++YF+  L  M IL  G+D S
Sbjct: 383 IAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLS 442

Query: 424 FPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSA 483
           FPA++II SD LPMEYQGMAGSL  T+VNYSMSLCLGMG TVE Q+N DG+ +LKGYR A
Sbjct: 443 FPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLKGYRGA 502

Query: 484 EYXXXXXXXXXXXXACILVIDKLVAKYRNK 513
           +Y            + + +++  +   R +
Sbjct: 503 QYLGIGLASLACMISGLYMVESFIKGRRAR 532

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/509 (53%), Positives = 345/509 (67%), Gaps = 6/509 (1%)

Query: 7   SSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQAT 66
           S+  E + + +S  KS+       V   S WQDP YF +  +E +F+ +CM  QLLNQA 
Sbjct: 33  STEDEEVTTIVSSTKSTQ------VTNDSPWQDPTYFSSFGKELMFIATCMLAQLLNQAG 86

Query: 67  TPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFL 126
               L IMNVLS SFNS  +NQ WL+ASFPL AGSFILISGR+GDIYGLKK LI GY+ +
Sbjct: 87  QTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLIVGYVIV 146

Query: 127 IIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIA 186
           I+WS+I G + YS SD F I +RAFQG+GIAF LPN++G +G++Y VGS RKN+VIS I 
Sbjct: 147 IVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRKNIVISFIG 206

Query: 187 ASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKM 246
           A AP           LIVTE P+QWPW FYAF IA   +LL++ YSIP+N+PTN++G  M
Sbjct: 207 ACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSM 266

Query: 247 DWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLIA 306
           DW GSAL + GLILFNF WNQ PIVGWD                    YE  +A  PL+ 
Sbjct: 267 DWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFVYESKYAEVPLLP 326

Query: 307 REITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLAS 366
           R +T +R+MI+ +  +FLGWGS+GIW+FYY SF LNLRHYSPVW GG+YF+F IFG +A+
Sbjct: 327 RAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSMAA 386

Query: 367 AFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPA 426
            FV  SIK++   ++L FS++ F  G+ + SV PV+QSY+KL  A  AIL  G+D SFPA
Sbjct: 387 FFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPA 446

Query: 427 ATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYX 486
           ++IILSDGLPM+YQGMAGSL  T++NYS SLCLGMG TVE QINK G D+LKGYR+A Y 
Sbjct: 447 SSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLKGYRAAVYL 506

Query: 487 XXXXXXXXXXXACILVIDKLVAKYRNKNS 515
                      +   +++ L  ++R    
Sbjct: 507 GVGLASLGVVISVTYMLENLWNRHRKSED 535

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/493 (54%), Positives = 345/493 (69%)

Query: 28  EVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSN 87
           + +V    KWQ+P YFK ++QEYLF+ +CM +QLLNQA T QTLSIMN+LSDSF S  ++
Sbjct: 50  DEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNS 109

Query: 88  QTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLII 147
           ++WL+ASFPLV+GSFILISGR+GDIYGLKK L+ GY+ +IIWSLICG T YS SDTF II
Sbjct: 110 KSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFII 169

Query: 148 ARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVXXXXXXXXXXLIVTES 207
            RAFQGLGIAF LPNV+G IGNIY  G+ RKN+VIS + A AP+          LI TE+
Sbjct: 170 CRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEN 229

Query: 208 PSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGLILFNFAWNQ 267
           P+QWPW+FYAF+IA   N  +SIY+IP+NIPTN++ F MDWIGS L V GLIL NF WNQ
Sbjct: 230 PNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQ 289

Query: 268 GPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLIAREITHSRNMIITIFTLFLGWG 327
            PI GW                     YE+ FA SPL+   +    +MI  +  LF GWG
Sbjct: 290 APISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWG 349

Query: 328 SYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAPVILLFSMV 387
           S+GI++FYYF F LN+RHY+ +WAGG+YF+F I+G++A+  VG +IK ++  V L FSMV
Sbjct: 350 SFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMV 409

Query: 388 LFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLA 447
            F VG+ + SV PV ++YF+  L  M IL  G+D SFPA++II SD LPMEYQGMAGSL 
Sbjct: 410 AFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLV 469

Query: 448 LTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYXXXXXXXXXXXXACILVIDKLV 507
            T+VNYSMSLCLGMG TVE Q++ DG+ +LKGYR A+Y            + + +++  +
Sbjct: 470 NTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFI 529

Query: 508 AKYRNKNSIKNSA 520
             ++ K + +N  
Sbjct: 530 NDHKAKAATENDC 542

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/472 (56%), Positives = 329/472 (69%), Gaps = 2/472 (0%)

Query: 14  QSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSI 73
             D++   SSN+  +V     S WQDP YF +  +E +F+ +CM  QLLNQA     L+I
Sbjct: 36  DEDVTTVASSNKSTQV--SNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTI 93

Query: 74  MNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLIC 133
           MNVLS SFNS    Q WL+ASFPLVAGSFILISGR+GDIYGLKK L+ GY+ +I+WSLIC
Sbjct: 94  MNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLIC 153

Query: 134 GFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVXX 193
           G + YS +D F I  RAFQGLGIAF LPNV+G +G++Y VGS RKN+VIS I A AP   
Sbjct: 154 GLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAGG 213

Query: 194 XXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSAL 253
                   LIV E   QWPW FYAFAIA   N++++ YSIP+NIPTNV+GF MDW GS L
Sbjct: 214 MFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVL 273

Query: 254 IVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLIAREITHSR 313
            V GLILFNF WNQ P  GW                     YE+ +A  PL+   +T +R
Sbjct: 274 AVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNR 333

Query: 314 NMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISI 373
           +MI+ +  +FLGWGS+GIW+FYY SF LNLRHYSPVW GG+YF+F IFG +A+  V +SI
Sbjct: 334 HMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSI 393

Query: 374 KKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSD 433
           K++    +L F++V F VG+ + SV PV QS++KL     AIL  G+D SFPA++IILSD
Sbjct: 394 KRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSD 453

Query: 434 GLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEY 485
           GLPMEYQGMAGSL  T++NYS SLCLGMG TVE QINK+G+D+LKGYR A Y
Sbjct: 454 GLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIY 505

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/485 (56%), Positives = 347/485 (71%), Gaps = 4/485 (0%)

Query: 2   AESRTSSIKEHIQSDISIDKSSNEKCEVIVREK-SKWQDPGYFKNSFQEYLFVGSCMTTQ 60
           +  R ++IKE    D  I   S       ++E  S WQ+P YF +SF+EY+FV +CM   
Sbjct: 30  SSERKTAIKEQ---DDEIGSDSTTTSSSSLQENNSSWQNPDYFSSSFKEYIFVATCMIAN 86

Query: 61  LLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLI 120
           LLNQA   Q LS MNV+SDSF+SS   QTWL+ASFPLV+GSFILISGR+GDIYGLK+ +I
Sbjct: 87  LLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRMMI 146

Query: 121 GGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNM 180
           GG+IF+IIWSLICGFT Y+ SDTF I+ARAFQGLGI+F LPNV+G +GNIY VG+LRKN+
Sbjct: 147 GGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNV 206

Query: 181 VISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTN 240
           VISLI   AP           LIVTE+P QWPW FYA+A+A +  L++  Y++P NIPTN
Sbjct: 207 VISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLVMGYYTVPDNIPTN 266

Query: 241 VNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFA 300
           VNGF MDWIGS L V GLILFNF WNQGPIVGW+                    YEI +A
Sbjct: 267 VNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVYEIKYA 326

Query: 301 PSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGI 360
             PL+ + +T + +++  +  LFLGWGS+GIW+FYYF+F LNLR YSPVW+GG++F+F I
Sbjct: 327 KVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGGTFFVFII 386

Query: 361 FGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGL 420
           FG +A+  V ++IKK+   ++L FS + F  G+ ++SV PV Q+Y++ T     IL  G+
Sbjct: 387 FGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGM 446

Query: 421 DTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGY 480
           D  FPA++IILSD LPM+YQGMA SL  T+VNYS SLCLGMG TVERQINK G D+LKGY
Sbjct: 447 DLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGY 506

Query: 481 RSAEY 485
           R+A Y
Sbjct: 507 RAALY 511

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/516 (51%), Positives = 353/516 (68%), Gaps = 4/516 (0%)

Query: 2   AESRTSSIKEHIQSDISIDKSSNE----KCEVIVREKSKWQDPGYFKNSFQEYLFVGSCM 57
           +++ +SS       D +I  +  E      + ++ + S WQ+P YF + ++EY F+ +CM
Sbjct: 11  SDNFSSSTVSFPNEDKNISHNEKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCM 70

Query: 58  TTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKK 117
              LLNQA   Q LS MNV+S+SF+S    QTWL+ASFPLV+GSFILISGRIGDIYGLKK
Sbjct: 71  VANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKK 130

Query: 118 TLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLR 177
           T+IGGYIF+IIWSL+CGF  ++ +DTF I+ RAFQGLGI+F LPNV+G IGNIY VG+LR
Sbjct: 131 TMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLR 190

Query: 178 KNMVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNI 237
           KN+VIS+I  +AP           LIVTE+  QWPW FYA+A+    NL++++YS+P+ I
Sbjct: 191 KNIVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCI 250

Query: 238 PTNVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEI 297
           PTNV+ F MDWIGS + V GLILFNF WNQGP+ GWD                    YE+
Sbjct: 251 PTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYEL 310

Query: 298 NFAPSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFI 357
            +  SPL+  E+T +  ++  +  LFLGWG++GIW+FYYF+F LNLR YSPVW GG+YF+
Sbjct: 311 KYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFM 370

Query: 358 FGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILG 417
           F I+G +A+  V  +IKK+   ++L FS + F +G+ +LSV P+ Q Y+++ L    IL 
Sbjct: 371 FIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILC 430

Query: 418 VGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVL 477
            G+D SFPA++IILSD LPM+YQGMAGSL  T++NY+ SLCLGMG TVERQINK G+D+L
Sbjct: 431 FGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLL 490

Query: 478 KGYRSAEYXXXXXXXXXXXXACILVIDKLVAKYRNK 513
           KGYRSA Y            A I +   L  K R++
Sbjct: 491 KGYRSALYLAVGLGGLGSCIAFINLCYTLWMKRRDR 526

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/489 (52%), Positives = 341/489 (69%), Gaps = 7/489 (1%)

Query: 4   SRTSSIKEHIQSDISIDKSSNEKCEV-------IVREKSKWQDPGYFKNSFQEYLFVGSC 56
           ++ +   ++ Q+++   K+ + + E             + WQ+P YF N +QEY F+ +C
Sbjct: 22  NQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTC 81

Query: 57  MTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLK 116
           M  QLLNQA   Q  + MN+L+D+FNSS   QTWL+ASFPLV+GSFIL+SGRIGDIYGLK
Sbjct: 82  MLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLK 141

Query: 117 KTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSL 176
           KTLIGGY+ ++IWSLICGF  Y+ +D F I+ RAFQGLGIAF LPNV+G IGNIY   +L
Sbjct: 142 KTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTL 201

Query: 177 RKNMVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSN 236
           RKN VIS +   AP+          LI  E+P QWPW FYA+AI  + N++++IYSIPS 
Sbjct: 202 RKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPST 261

Query: 237 IPTNVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYE 296
           +PTN++GF MDW GSA+ V G+ILFNF WNQGPI GW+                    YE
Sbjct: 262 VPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYE 321

Query: 297 INFAPSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYF 356
           I FA SPL+  E+  +R++ + +  +F+GWGS+GIW+FYY++F LNLRHYS VWAGG++F
Sbjct: 322 IKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFF 381

Query: 357 IFGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAIL 416
           +F I+G +A+  V ++IK++   V+L FSM  F VG  +LSV PV QSY+K+ L    IL
Sbjct: 382 MFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIIL 441

Query: 417 GVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDV 476
             G+D SFPA++IILSD LP +YQGMAGSL  TMVNYS SLCLG+G+T E Q+NK+G D 
Sbjct: 442 SFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDK 501

Query: 477 LKGYRSAEY 485
           LKGYR+A Y
Sbjct: 502 LKGYRAALY 510

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/472 (57%), Positives = 335/472 (70%), Gaps = 2/472 (0%)

Query: 14  QSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSI 73
             +++   SSNE  +V     S WQDP YF +  +E +F+ +CM  QLLNQA     L I
Sbjct: 36  DEEVTTVTSSNESNQV--TNDSPWQDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCI 93

Query: 74  MNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLIC 133
           MNVLS SFNS  +NQ WL+ASFPL AGSFILISGR+GDIYGLKK L+ GY+ +IIWS+I 
Sbjct: 94  MNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLLIGYVIIIIWSIIS 153

Query: 134 GFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVXX 193
           G + YS SD F I  RAFQGLGIAF LPN++G +G++Y VGSLRKN+VIS+I A AP   
Sbjct: 154 GLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAGG 213

Query: 194 XXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSAL 253
                   LIVTE P QWPW FYAF+IA   +LL++ YSIP+N+PTNV+G  MDW GS L
Sbjct: 214 MFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTL 273

Query: 254 IVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLIAREITHSR 313
            V GLILFNF WNQ PI GW                     YEI +A  PL+   +T +R
Sbjct: 274 AVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYAEVPLLPHAVTKNR 333

Query: 314 NMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISI 373
           +MI+ +  +FLGWGS+GIW+FYY SF LNLRHYSPVW GG+YF+F IFG +A+ FV  SI
Sbjct: 334 HMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSI 393

Query: 374 KKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSD 433
           K++   ++L F+++ F  G+ + SV PV+QSY+KL  A  AIL  G+D SFPA++IILSD
Sbjct: 394 KRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSD 453

Query: 434 GLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEY 485
           GLPM+YQGMAGSL  T++NYS SLCLGMG TVERQINK GQ++LKGYR+A Y
Sbjct: 454 GLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGYRAAIY 505

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/505 (51%), Positives = 350/505 (69%), Gaps = 3/505 (0%)

Query: 11  EHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQT 70
           E+ +  +S  +     C+ ++   + WQ+  YF++  +EY F+ +CM   LLNQA   Q 
Sbjct: 2   ENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQV 61

Query: 71  LSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWS 130
           LS MNV+S+SF+S    QTWL+ASFPLV+GSFILISGRIGDIYGLKKT+IGGYIF+IIW+
Sbjct: 62  LSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWT 121

Query: 131 LICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAP 190
           L+CGF  Y+ SDTF I+ RAFQGLGI+F LPN++G +GNIY VG+LRKN+VISLI  +AP
Sbjct: 122 LLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAP 181

Query: 191 VXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIG 250
                      LI TES  QWPW FYA+A+A   NL+++IYS+P N+PTNV+ F MDW+G
Sbjct: 182 TGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMG 241

Query: 251 SALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLIAREIT 310
           + + V GLILFNF WNQGP+ GW                     YE+ F  SPL+ RE+T
Sbjct: 242 AIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVT 301

Query: 311 HSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVG 370
            +  ++  +  LFLGWGS+GIW+FYY++F LNLR+YSP+WAG ++F+F I+G +A+  VG
Sbjct: 302 KNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVG 361

Query: 371 ISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATII 430
            +I ++   V+L FS + F +G+ +LSV P+ Q+Y+++ +    IL  G+D SFPA++II
Sbjct: 362 FTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSII 421

Query: 431 LSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYXXXXX 490
           LSD LPM+YQGMAGSL  T++NYS SLCLGMG TVERQINK G+++L+GYRSA Y     
Sbjct: 422 LSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALY---LA 478

Query: 491 XXXXXXXACILVIDKLVAKYRNKNS 515
                  AC+  ++     +R + S
Sbjct: 479 VGLGGLGACVAFLNLCYDLWRKRKS 503

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/504 (51%), Positives = 344/504 (68%), Gaps = 1/504 (0%)

Query: 6   TSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQA 65
           ++S+ E   S IS+ + ++   E      + WQ+P YF + ++EYLF+ +CM + LLNQA
Sbjct: 39  STSVSEK-TSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQA 97

Query: 66  TTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIF 125
              Q  S MNV+  +FN+  S++TWL+ASFPLV+GSFIL+SGRIGDIYGLK+T+IGG I 
Sbjct: 98  GQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIV 157

Query: 126 LIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLI 185
           +IIWSLICGF  YS S TF II RAFQGLGIAF LPNV+G +GNIY VGSLRKN+VIS I
Sbjct: 158 MIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCI 217

Query: 186 AASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFK 245
              AP           LI T++  QWPW FYA+A A   NL+++IYSIP  +P NV+GF 
Sbjct: 218 GMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFS 277

Query: 246 MDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLI 305
           MDW GS + V GLILFNF WN+ PIVGW+                    YEI FA SPL+
Sbjct: 278 MDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLL 337

Query: 306 AREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLA 365
            + +TH+ N+I+ +  +F+GWGS+GIW+FYY++F+LNLR Y+P+ AG S+ +F ++G +A
Sbjct: 338 PQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIA 397

Query: 366 SAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFP 425
           +  V  +IK++   V+L  SMV F VG+ +LS+ PV Q+Y+K+T     IL  G+D SFP
Sbjct: 398 AFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFP 457

Query: 426 AATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEY 485
           A++IILSD LPMEYQGMAGSL  T+VNYS SLCLGMG T E Q+NK+G D+LKGYR+A Y
Sbjct: 458 ASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRAALY 517

Query: 486 XXXXXXXXXXXXACILVIDKLVAK 509
                       A + + + L  K
Sbjct: 518 VGIGLGVVGVIIAALFLFESLRQK 541

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/465 (56%), Positives = 333/465 (71%), Gaps = 5/465 (1%)

Query: 24  NEKCEVIVREKSKW---QDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDS 80
            E  +V V +K KW   QDP YF   ++EYLF+ + M +QLLNQA T QTLS++N+LS +
Sbjct: 26  TEHSDVQVDDK-KWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKN 84

Query: 81  FNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSK 140
           F+SS S QTWL+ASFPLV+GSFIL+SG+IGDIYGLKKTL+ GY+  IIWSLICG T Y+ 
Sbjct: 85  FDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTS 144

Query: 141 SDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVXXXXXXXXX 200
           S  F II+RAFQGLGIAF LPN++G +GNIY  G+ RKNMVISLI A AP+         
Sbjct: 145 SVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFS 204

Query: 201 XLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGLIL 260
            LI T S  +W W+FYA+ I  + N+ +SI+ IP+ IPTNV G  MDWIGS + + G+IL
Sbjct: 205 GLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGLLGMIL 263

Query: 261 FNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLIAREITHSRNMIITIF 320
           FNF WNQGPIVGWD                    YE  +A  PLI R   H+  +++T+ 
Sbjct: 264 FNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLL 323

Query: 321 TLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAPV 380
            +F GWGS+GIW+FYYF FVLNLR Y+P+WAGGSYF+F I+G++A+  VG +IK+I   +
Sbjct: 324 AVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSL 383

Query: 381 ILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQ 440
           IL  SM+ F  G  +LSV PVDQ+YF++ L  M IL  G+D SFPA++IILSD LPME Q
Sbjct: 384 ILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQ 443

Query: 441 GMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEY 485
           GMAGSL  TM+NYSMS+CLG+  TVE QINK+G D+LKGYR+A Y
Sbjct: 444 GMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALY 488

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/483 (54%), Positives = 341/483 (70%), Gaps = 6/483 (1%)

Query: 8   SIKEHIQSDISIDK-----SSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLL 62
           S+KE  +  +S D+     +S+ K   I  + S WQDP YF +  +E +F+G+CM  QLL
Sbjct: 23  SMKEEDKVIVSTDEEVTTVASSSKSNQISND-SPWQDPTYFSSFGKELMFIGTCMLAQLL 81

Query: 63  NQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGG 122
           NQA     L IMNVLS SF S  +NQ WL+ASFPL AGSFILISGR+GDIYGLKK L+ G
Sbjct: 82  NQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIG 141

Query: 123 YIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVI 182
           Y+ +I+WS+I G + YS +D+F I  RAFQG+GIAF LPN++G +G++Y VGSLRKN+VI
Sbjct: 142 YVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVI 201

Query: 183 SLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVN 242
           S+I A  P           LIVTE P+QWPW FYAF IA   ++L++ YSIP+N+PTNV+
Sbjct: 202 SVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVH 261

Query: 243 GFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPS 302
           G  MDW GS L V GLILFNF WN+ PI GWD                    YEI +A  
Sbjct: 262 GLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAEV 321

Query: 303 PLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFG 362
           PL+   +T +R+MI+ +  +F+GWGS+GIW+FYY SF LNLRHYSPVW GG+YF+F IFG
Sbjct: 322 PLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFG 381

Query: 363 VLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDT 422
            +A+ FV  SIK++   ++L F+++ F  G+ + SV PV+QSY+KL  A  A+L  G+D 
Sbjct: 382 TIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDL 441

Query: 423 SFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRS 482
           SFPA++IILSDGLPM+YQGMAGSL  T++NYS SLCLGMG TVE QINK G++VL+GYR+
Sbjct: 442 SFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRA 501

Query: 483 AEY 485
           A Y
Sbjct: 502 AVY 504

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/503 (51%), Positives = 345/503 (68%), Gaps = 5/503 (0%)

Query: 20  DKSSNEKCEV-IVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLS 78
           D    ++C+   +    KWQ+P YF ++ +EYLF+ SC  +QLLNQA   QT  IMN+++
Sbjct: 32  DIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVA 91

Query: 79  DSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYY 138
           DS +S    Q WL+A+FPL++GSFILISGRIGDIYGLKKTL+ GY+FLI+WSLICG T Y
Sbjct: 92  DSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKY 151

Query: 139 SKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVXXXXXXX 198
           + SD+F I++RAFQGLGI+  LPN++G +G+IY  GS RKNMVISLI   AP+       
Sbjct: 152 AHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAV 211

Query: 199 XXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGL 258
              LI TE  +QWPW+FY++AI  + N ++SI+ IP+ IPTNV+G KMDWIGS L V GL
Sbjct: 212 FSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGL 271

Query: 259 ILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAP-SPLIAREITHSRNMII 317
           I+ NF WNQ PI GWD                    YE++F   +PL+ +E+  S   II
Sbjct: 272 IMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTII 331

Query: 318 TIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKIT 377
            +F LF GWGS+GI+SFYYF+F LNLRHY+P+WAGG+YF+F I+G++A+  VG +IKK+ 
Sbjct: 332 VLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVY 391

Query: 378 APVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPM 437
             +IL  SMV F  G+ ++SV P+ Q+YF+  L  M IL  G+D SFPA++I+LSD LP+
Sbjct: 392 PSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPL 451

Query: 438 EYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYXXXXXXXXXXXX 497
           +YQGMAGSL  TMVNYSMS CLG+   VE+ +N  G+DVLKGYR A Y            
Sbjct: 452 QYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACII 511

Query: 498 ACILVIDKLVAKYRNKNSIKNSA 520
           +  L++ +++   +N+   K+SA
Sbjct: 512 SGALMLSEIIQGRKNE---KDSA 531

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  518 bits (1335), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 255/486 (52%), Positives = 332/486 (68%), Gaps = 2/486 (0%)

Query: 1   MAESRTSSIKEHIQSDISIDKSSN-EKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTT 59
           M    T   K+   SDIS     N E  ++++  +S+ Q+P YF   ++EYLFV S M +
Sbjct: 1   MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLS 60

Query: 60  QLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTL 119
           QLLNQA   Q   + ++LS+   +  S Q WL+ASFPLV+GSFIL+SG++GDIYGLKKTL
Sbjct: 61  QLLNQAAALQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120

Query: 120 IGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKN 179
           +GGY  ++IWSLICG + Y+ +  F I+AR+FQGLGIAF LPNV G +GNIY   +  KN
Sbjct: 121 LGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKN 180

Query: 180 MVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPT 239
           MV S+I A AP+          LI TES + W W+FYA+ I  + N LI+ Y IP NIPT
Sbjct: 181 MVFSMIGACAPIGATLGCLFSGLIGTESEA-WAWTFYAYTIVAALNGLIAWYVIPDNIPT 239

Query: 240 NVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINF 299
           NV+ FKMDW+GS L V GLI+FNF WNQ P  GWD                    +E  F
Sbjct: 240 NVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARF 299

Query: 300 APSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFG 359
           A  PL+ R +  +R +++ + +LFLGWGS+GIW++YY +FVLNLRHY+P+WAGGSYF+F 
Sbjct: 300 AKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFA 359

Query: 360 IFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVG 419
           IFG +A+  VG +I K    +ILL S++ F VG  +LSV PVDQ+YF+++L  M IL  G
Sbjct: 360 IFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFG 419

Query: 420 LDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKG 479
           +D SFPA++IILSD LP +YQGMAGSL  TM+NYSMSLCLG+  T ERQ+NKDG D+LKG
Sbjct: 420 MDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKG 479

Query: 480 YRSAEY 485
           YR+A Y
Sbjct: 480 YRAALY 485

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  516 bits (1328), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 260/517 (50%), Positives = 346/517 (66%), Gaps = 6/517 (1%)

Query: 7   SSIKEHIQSDISIDK---SSNEKCEVIVRE-KSKWQDPGYFKNSFQEYLFVGSCMTTQLL 62
           SS +  I+ ++S +    ++ ++  V V E +S WQDP YFK  + E LFV SCM  QLL
Sbjct: 17  SSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLL 76

Query: 63  NQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGG 122
           NQA +  TLS M VL    +SS +  +WL+ASFPLV+GSFILISGR+GDIYGLKK L+ G
Sbjct: 77  NQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLG 136

Query: 123 YIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVI 182
           YI+L IWSLICG + +S +DTF I +RAFQGLGI+F LPN++G +GNIY  G+ RKN+VI
Sbjct: 137 YIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVI 196

Query: 183 SLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVN 242
           SLI   AP+          ++V    S WPW+FYA+ IA     +IS + IP++IP NVN
Sbjct: 197 SLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVN 256

Query: 243 GFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPS 302
            F MDWIGSAL V+GL+LFNF WNQ  +VGW                     +EI +A  
Sbjct: 257 KFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAKV 316

Query: 303 PLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFG 362
           PL+ +E+T SR++I+ + +L  GWGS+GIW FYYF FVL LR+YSPVWAGG++F+  I G
Sbjct: 317 PLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVG 376

Query: 363 VLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDT 422
            +A+  VG SIK++   V+L FSM+ F  G+ +LSV PV ++YF+  L  M IL  G+D 
Sbjct: 377 CIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDL 436

Query: 423 SFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRS 482
           SFPAA+IILSD L M+YQGMAGSL  T+VNYSMSL LG+G T+ERQINK G  +L+G+R+
Sbjct: 437 SFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRA 496

Query: 483 AEYXXXXXXXXXXXXACILVIDK--LVAKYRNKNSIK 517
           A Y            + + V+ K  + +K R +N ++
Sbjct: 497 ALYFAIGVGSLGILISGVFVLQKELMRSKSRKENELE 533

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  512 bits (1318), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 253/485 (52%), Positives = 333/485 (68%), Gaps = 2/485 (0%)

Query: 1   MAESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQ 60
           M E+      E +QS  +  +  + + E I   KS+ Q+P YF   ++EY+FV S M +Q
Sbjct: 3   MKENDDEENWEKLQSSSAAGEERDGQTEAI-GPKSRLQNPDYFDKPWKEYIFVLSSMLSQ 61

Query: 61  LLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLI 120
           LLNQA T QT  + +VLS   N+  S Q WL+ASFPLV+GSFIL+SG++GDIYGLKKTL+
Sbjct: 62  LLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLL 121

Query: 121 GGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNM 180
           GGY+ ++IWSLICG + Y+ +  F ++AR+FQGLGIAF LPNV+G +GNIY   +  KN+
Sbjct: 122 GGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNL 181

Query: 181 VISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTN 240
           V SLI A AP+          LI   +   W W+FYA+AI  + N L++++ IP+NIPTN
Sbjct: 182 VFSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTN 240

Query: 241 VNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFA 300
           VN +KMDWIGSA+ V GLILFNF WNQ PI GW                    TYEI FA
Sbjct: 241 VNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFA 300

Query: 301 PSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGI 360
             PL+   +  +R +++ + +LF GWGS+GIW+FYY SF+LNLRHYSP+WAGG+YF+F I
Sbjct: 301 KQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAI 360

Query: 361 FGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGL 420
           +G++AS  VG +I K    VIL  SMV F  G  +L+V PV Q+YF++TL  M IL  G+
Sbjct: 361 WGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGM 420

Query: 421 DTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGY 480
           D SFPAA+IILSD LP +YQGMAGSL  TM++YSMSLCLG+  T E Q+NK+G D+LKGY
Sbjct: 421 DLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGY 480

Query: 481 RSAEY 485
           ++A Y
Sbjct: 481 QAALY 485

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  503 bits (1296), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 251/521 (48%), Positives = 335/521 (64%), Gaps = 6/521 (1%)

Query: 1   MAESRTSSIKEHIQSDISIDKSSNEKCEVI------VREKSKWQDPGYFKNSFQEYLFVG 54
           + + +T+++      D+  D    ++  +       +   SKWQDP YFK+S+QEY F+G
Sbjct: 19  IEDFQTTTVTAQTSLDVLSDSVKKDQISITDDDVSSISNNSKWQDPTYFKSSWQEYTFIG 78

Query: 55  SCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYG 114
           +CM   LLNQA   QTLS MNVL+DS NS  + +TWL+ASF L +GSFIL+SGRIGDIYG
Sbjct: 79  TCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYG 138

Query: 115 LKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVG 174
           LK T IGG I   IWS++CG + Y+++ TF II RAFQGLG+AF LPNV+G +GNIY+VG
Sbjct: 139 LKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVG 198

Query: 175 SLRKNMVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIP 234
           S+RKN+VIS I   APV          LIV  +  QWPW F+A AIA   NL++ IYSIP
Sbjct: 199 SMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIP 258

Query: 235 SNIPTNVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXT 294
           +++PTN+   KMDWIGS L V GLIL NF WNQ PI GW                     
Sbjct: 259 NHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFI 318

Query: 295 YEINFAPSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGS 354
           YE+  A SPL+  E+T +R+++  I +LFLGWG++GIW+FYY++F LNLRH+SP+WAG +
Sbjct: 319 YELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGST 378

Query: 355 YFIFGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMA 414
           +F+F IFG L +  V  +I K+   V+   S + F  G  + SV   DQ+Y++ +L    
Sbjct: 379 HFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQI 438

Query: 415 ILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQ 474
           IL +G+D SFP ++IILSD LPM+YQGM+GSL  T+ NY+ SLCLGMG T E Q N  G+
Sbjct: 439 ILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGK 498

Query: 475 DVLKGYRSAEYXXXXXXXXXXXXACILVIDKLVAKYRNKNS 515
           DVLKGYR+A Y            +   + + L  +YR +  
Sbjct: 499 DVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQ 539

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  503 bits (1294), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 257/506 (50%), Positives = 335/506 (66%), Gaps = 3/506 (0%)

Query: 10  KEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQ 69
           +E I+SD S    +N++   +  + S  ++P YF ++ QEY F+ SCM +QLLN A T Q
Sbjct: 18  EETIRSDCS---DANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQ 74

Query: 70  TLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIW 129
           TLSIMNVL+   +SS S + WLVASFPLV+GSFIL+SGR+GDIYGLKK LI GY+ L+IW
Sbjct: 75  TLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIW 134

Query: 130 SLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASA 189
           SLI G + YS S  F IIARAFQGLGI+  LPNV+G IG IY  G+L+KNMVIS++ A +
Sbjct: 135 SLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMS 194

Query: 190 PVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWI 249
           P+          L+ TES   WPW+FYA+ +A   N  IS YSIP+NIPTNVN   MDWI
Sbjct: 195 PIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWI 254

Query: 250 GSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLIAREI 309
           GS   V GLILFNF WNQ P  GW+                    YE+ +A +PL+  EI
Sbjct: 255 GSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEI 314

Query: 310 THSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFV 369
             +R +I+ +  +  GWGS+GIW+FYYFSFVLNLR+YSP+WAGGSYFIF I G + +   
Sbjct: 315 IRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISC 374

Query: 370 GISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATI 429
           G  +KKI   V+L FSMV F +G  + SV PV Q+YF+  L  M IL +G+D SFPA++I
Sbjct: 375 GFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSI 434

Query: 430 ILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYXXXX 489
           ILSD LP ++QGMAGSL  T++NYS SL LG+  TVE+  NK+G D+L+GYR A Y    
Sbjct: 435 ILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIA 494

Query: 490 XXXXXXXXACILVIDKLVAKYRNKNS 515
                   A + +++ +   Y+++  
Sbjct: 495 CSGVAVLIAGLYMVETIFDSYKDRKE 520

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  500 bits (1288), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 260/521 (49%), Positives = 344/521 (66%), Gaps = 3/521 (0%)

Query: 2   AESRTSSIKEHIQSDISIDKSSNEKCEV--IVREKSKWQDPGYFKNSFQEYLFVGSCMTT 59
            E  +SS +    SD     S    C V       S +Q+P YF+  F+E +F+ SCM  
Sbjct: 36  CEECSSSDECQSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVA 95

Query: 60  QLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTL 119
           QLLNQA   Q+LS MNVL+D F S+ S Q WL+ASFPLV+GSFILISGR+GDIYGLKK L
Sbjct: 96  QLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKAL 155

Query: 120 IGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKN 179
             GYI + +WS+ICG   Y+ SD F I+ R+FQGLGIAF LPN++G +GNIY VG+LRKN
Sbjct: 156 SVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKN 215

Query: 180 MVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPT 239
           +VIS I   AP           LIVTE   QWPW FYAF IA   N+L+++YSIP+N+PT
Sbjct: 216 IVISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPT 275

Query: 240 NVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINF 299
           N+N   MDWIGS L V+GL+L N  WNQ PIVGW                     YEI +
Sbjct: 276 NLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKY 335

Query: 300 APSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFG 359
           A SPL+   +  ++ +++ +  LF GWGS+GIW++YY++F LNLR Y+P+WAGG++F+F 
Sbjct: 336 ATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFV 395

Query: 360 IFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVG 419
           I+G +A+  V ++IKK+   V+L FSMV F  G+ +LSV PV Q+Y+++ +    IL  G
Sbjct: 396 IWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFG 455

Query: 420 LDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKG 479
           +D SFPA++IILSD LPM+YQGMAGSL  T+VNYS SLCLGMGNTVE+Q N  G D+LKG
Sbjct: 456 MDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKG 515

Query: 480 YRSAEYXXXXXXXXXXXXACILVIDKLVAKYRNKNSIKNSA 520
           YRSA Y            + + ++  ++AK R++  I++  
Sbjct: 516 YRSALYLAIGLASAGVCVSLVFLVTDIIAK-RHRKRIESEC 555

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  496 bits (1278), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 247/483 (51%), Positives = 324/483 (67%), Gaps = 8/483 (1%)

Query: 3   ESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLL 62
           +SR SS+   +   +S D + N+       E S +Q+P YFKN +QE+ F+ S M  QLL
Sbjct: 36  DSR-SSLNSSLTQVLSTDTADND-------ESSSYQNPDYFKNKYQEFGFIFSGMIGQLL 87

Query: 63  NQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGG 122
           +QA   QTLSIMNVL+   +S+ S Q WL++SFPL  GSFIL+SGR+GDIYGLKK L+GG
Sbjct: 88  SQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGG 147

Query: 123 YIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVI 182
           YI   +WS+ICG + Y+ +D F I ARAFQGLG+AF LPN++G IG IY  G  RKNM+I
Sbjct: 148 YIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMII 207

Query: 183 SLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVN 242
           S+I A +P           L V    S WPWSFYAF +    NL+IS Y IP++IPTN++
Sbjct: 208 SIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIH 267

Query: 243 GFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPS 302
           G KMDW+GS L V GLI+ NF +NQ PIVGW                     YE+ +A +
Sbjct: 268 GLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKT 327

Query: 303 PLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFG 362
           PLI + I+ +R M++ +F+LF GWGS+GIW+FYYFSF LNLRHYSP+WAG SYFIF I G
Sbjct: 328 PLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISG 387

Query: 363 VLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDT 422
              +   G++IKKI   V+   SM+ F  G  + +  PV+Q++F+  L  M +L +G+D 
Sbjct: 388 STVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDF 447

Query: 423 SFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRS 482
           SFPA++IILSD LPM+YQGMAGSL  T++NYS S+CLGM  TVE + N  G+D+L GYR+
Sbjct: 448 SFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRA 507

Query: 483 AEY 485
           A Y
Sbjct: 508 AIY 510

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  489 bits (1260), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 240/522 (45%), Positives = 328/522 (62%), Gaps = 4/522 (0%)

Query: 2   AESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKW----QDPGYFKNSFQEYLFVGSCM 57
           +++ T +  + I S   +  + +EK    VR         Q P YF +   E+ F+ +C+
Sbjct: 26  SDNSTVNSSQKIDSSEQVVPTDSEKYFATVRSSESLSVSSQKPQYFSSKLHEWAFIFTCL 85

Query: 58  TTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKK 117
             QLLNQA T Q++SIMN++++ F S  S Q WL ASFPLV+GSFIL+ GR GDIYGLKK
Sbjct: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145

Query: 118 TLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLR 177
            L+ GY  L IWS+ICG T+Y+ SD F I+A+AFQGLG++F LPN++G +G IY  GS++
Sbjct: 146 MLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMK 205

Query: 178 KNMVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNI 237
           KN+ IS I A AP+          ++V +    WPW+FYAFAI      +   + +P N+
Sbjct: 206 KNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNV 265

Query: 238 PTNVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEI 297
           PTN N  KMDWIGSA+ V GL+LF+F WNQ P+ GWD                    YEI
Sbjct: 266 PTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAYIIVLLVISVILIIAFFIYEI 325

Query: 298 NFAPSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFI 357
           N+A  PL+ + IT +R++I+ +  +F+GWG++GIWSFYYFSF LNLRH+SPVW GG+YF 
Sbjct: 326 NYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFA 385

Query: 358 FGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILG 417
           F + G   ++ VG  IK I   +IL+ S+  F +G  + +V P DQ+Y++ T   M +L 
Sbjct: 386 FILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFAVTPADQTYWRNTFGMMLLLP 445

Query: 418 VGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVL 477
           +G+D SFPA++IILSD LP EYQGMAGSL  TMVNYS S CLG+  TVE+QIN  G D+L
Sbjct: 446 LGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLL 505

Query: 478 KGYRSAEYXXXXXXXXXXXXACILVIDKLVAKYRNKNSIKNS 519
           KGYR+A Y            A + + +     Y+ K  + N 
Sbjct: 506 KGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLAND 547

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  487 bits (1254), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 241/482 (50%), Positives = 322/482 (66%), Gaps = 2/482 (0%)

Query: 3   ESRT-SSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQL 61
           +S+T +S+ E I S  S+   S+   E +  E +K   P YFKN   EYLF+ SCM +Q 
Sbjct: 52  DSQTNTSMNEVIGSISSVSNDSDINSENLQSE-NKVLSPKYFKNRTHEYLFIISCMVSQF 110

Query: 62  LNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIG 121
           ++QA   Q LSIMN+L++  N+ +S Q WL+ASF L  GSFIL+SGR+GDIYGLKK L+G
Sbjct: 111 MSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVLLG 170

Query: 122 GYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMV 181
           GY  L IWSLICGF+ YS +D F I +RAFQGLG+AF LPN +G IG IY  GS++KNM+
Sbjct: 171 GYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKNMI 230

Query: 182 ISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNV 241
           I  + A +P+          +I T+ P QWPWSFY+F I    N+++S YSIP+NIPTN+
Sbjct: 231 IGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPTNI 290

Query: 242 NGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAP 301
               MDWIG+ L + GL++ NF +NQ PIVGW                     YE+ +A 
Sbjct: 291 YNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAK 350

Query: 302 SPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIF 361
           +PLI + I+ +R M++ +F LF GWG++G W+FYYFSFVLN+R Y+  WAGGSYFIF + 
Sbjct: 351 TPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFIVS 410

Query: 362 GVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLD 421
           G   +   G  +KK+   VIL  SM+ F  G  +L+V P+ QSYF+  L  M +L +G+D
Sbjct: 411 GCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIGID 470

Query: 422 TSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYR 481
            SFPAA+IILSD LP++YQGMAGSL  T+ NYS S+CLGM  +VE   N +GQ++LKGYR
Sbjct: 471 LSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKGYR 530

Query: 482 SA 483
           +A
Sbjct: 531 NA 532

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  382 bits (981), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 191/472 (40%), Positives = 279/472 (59%), Gaps = 3/472 (0%)

Query: 14  QSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSI 73
           +S +S     N+     + E    + P  FKN FQE+ FV   +  Q L+Q    Q LS 
Sbjct: 90  ESSLSATPPDNKP---FITESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLST 146

Query: 74  MNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLIC 133
           MN+L++  ++++  Q WL+A+FPL  G  ILISGR+GDI+GLKK L+ GYI   IW+LIC
Sbjct: 147 MNILAEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLIC 206

Query: 134 GFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVXX 193
           GF+ Y+ SD   I++R FQGLG+A  LPN+   IG IY     +KNM+  +I A +P+  
Sbjct: 207 GFSSYAHSDDLFIVSRTFQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGA 266

Query: 194 XXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSAL 253
                   L V  +   WPWSFY+FAI    N +I+ + IP++I  N  G KMDWIGSAL
Sbjct: 267 TLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSAL 326

Query: 254 IVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLIAREITHSR 313
            + GL++ NF +NQ PI GW                     YE+  A  PLI + I  + 
Sbjct: 327 GLFGLVVLNFVFNQTPIDGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNY 386

Query: 314 NMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISI 373
            +I+ + TLF GWG + IW+FYYF+F LNLRHYSP+WA  S F+  I G + +    +++
Sbjct: 387 RLILILLTLFCGWGGFAIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAV 446

Query: 374 KKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSD 433
           +++  P++L FSM+ F  G  L +V P+ Q++F+     M +  +G+  SFP+A+++ ++
Sbjct: 447 QRMKPPILLFFSMLGFLGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAE 506

Query: 434 GLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEY 485
            LP  Y+ MAGSL    +NY+ S+C+GM  +     N  GQD+L G+R+A Y
Sbjct: 507 TLPTHYKSMAGSLVNVAINYATSICVGMAGSANVNHNNHGQDLLHGFRAASY 558

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  284 bits (727), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 173/485 (35%), Positives = 260/485 (53%), Gaps = 22/485 (4%)

Query: 10  KEHIQSDISIDKSSNE--KCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATT 67
           +E++  ++   K  +E    E  V+E+         ++   E  FVG   + QL+ QA  
Sbjct: 9   EENLDMNVETLKKDDEVLSDEFDVQEEKP-------ESLLWESAFVGVLCSAQLMTQAGL 61

Query: 68  PQTLSIMNVLSDSFNSSRSNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFL 126
            Q+L+ ++++ DSF ++   Q +W  +++ L  G+FILI+GR+GDI+G KK  + G+ + 
Sbjct: 62  GQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWY 121

Query: 127 IIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIA 186
            +WSL+ GF+ YS +  F    RAFQG+G AF LPN +  +G  Y  G  RKNMV SL  
Sbjct: 122 ALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFG 179

Query: 187 ASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSN-IPT-NVNGF 244
           ASAP           ++     + WPW+++   IAC    +   Y IP   +P  +V  F
Sbjct: 180 ASAPGGFVLGAVFSSML--GQLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASF 237

Query: 245 KM----DWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFA 300
           K+    D+ GS   V GLILFNFAWNQGP+VGW                      E   A
Sbjct: 238 KLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR-A 296

Query: 301 PSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGI 360
             PL+      S    + +  +  GW S+GIW FY + F+ + R  +P+ +   +    I
Sbjct: 297 AFPLLPFAALSSDTAFV-LSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAI 355

Query: 361 FGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGL 420
            G  A+   G  +       ++ F+M  F VGT L++ APV Q+Y+  T   + ++  G+
Sbjct: 356 SGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGM 415

Query: 421 DTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGY 480
           D SFPAATI+LSD +P E+QG+A SL  T+VNYS+S+ LG+  T+E  +N  G +VLKGY
Sbjct: 416 DMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGY 475

Query: 481 RSAEY 485
           R + Y
Sbjct: 476 RCSWY 480

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  284 bits (726), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 170/484 (35%), Positives = 263/484 (54%), Gaps = 17/484 (3%)

Query: 10  KEHIQSDISIDKSS--NEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATT 67
           +E+ + D  + + S  ++  E+     +  Q P   ++   E  FVG     QL+ QA  
Sbjct: 7   EENQKKDDGLTRESTHDQGQELSQPHHNGIQKP---ESLLGEAAFVGVICGAQLMTQAGL 63

Query: 68  PQTLSIMNVLSDSFNSSRSNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFL 126
            Q+++ ++++ DSF +    Q +W  A++ L  G+FILI+GR+GD+YG KK  I G+ + 
Sbjct: 64  GQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWY 123

Query: 127 IIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIA 186
            +WSL+ GF+ YS +  F    RAFQG+G A  LPN +  +G  Y  G  RK M++SL  
Sbjct: 124 ALWSLLAGFSVYS-NQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGR-RKAMILSLFG 181

Query: 187 ASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPS----NIPTNVN 242
           A+AP           +      + WPW+++A  I C F  +  I  IP      + T+V+
Sbjct: 182 ATAPAGFVLGAVFSSIF--GQLTWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSVS 239

Query: 243 GF-KMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAP 301
            + ++D  GS   V GL+L NFAWNQGP+VGW                      E + AP
Sbjct: 240 TYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIE-SRAP 298

Query: 302 SPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIF 361
            PL+      S +    +  +  GW S+GIW +Y++ F+  LR +SP+     +    I 
Sbjct: 299 HPLLPLSAL-SSDAAFVLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAIS 357

Query: 362 GVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLD 421
           G+ A+   G  I ++ A +++LF+M  F VG  L++ APV Q Y+      + ++  G+D
Sbjct: 358 GLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMD 417

Query: 422 TSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYR 481
            SFPAATI+LSD +P E+QG+A SL   +VNYS+S+ LG+  TVE ++N  G ++LKGYR
Sbjct: 418 MSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYR 477

Query: 482 SAEY 485
            A Y
Sbjct: 478 GAWY 481

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  283 bits (724), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 175/491 (35%), Positives = 268/491 (54%), Gaps = 24/491 (4%)

Query: 5   RTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQD--PGYFKNSFQEYLFVGSCMTTQLL 62
           R S  ++++++     K+ +E    ++  + + QD  PG   +   E  FVG   + QL+
Sbjct: 4   RPSVTQKNLETSAETTKTDDE----VLLNQFELQDETPG---SLVWEAAFVGVLCSAQLM 56

Query: 63  NQATTPQTLSIMNVLSDSFNSSRSNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIG 121
            QA   Q+++ ++++ DSF ++   Q +W  +S+ L  G+FILI+GR+GDI+G +K  I 
Sbjct: 57  TQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFIL 116

Query: 122 GYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMV 181
           G+ +  +WSL+ GF+ YS +  F    RAFQG+G AF LPN +  +G  Y  G  RKNMV
Sbjct: 117 GFFWYALWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RKNMV 174

Query: 182 ISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIY------SIPS 235
            SL  ASAP           ++     + WPW+++   IAC F L ++ Y       +PS
Sbjct: 175 FSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWIMGIAC-FLLAVAGYFVIPHVQMPS 231

Query: 236 NIPTNVNGF-KMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXT 294
               + N   ++D+ GS   V GLILFNFAWNQGP+VGW+                    
Sbjct: 232 RDSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVF 291

Query: 295 YEINFAPSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGS 354
            E + A  PL+      S +    +  +  GW S+GIW FY + F+   R  SP+ +   
Sbjct: 292 IE-SRAAYPLLPFA-ALSSDAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQ 349

Query: 355 YFIFGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMA 414
           +    I G  A+   G  +    A  ++LF+M  F VG  L++ APV Q+Y+  T   + 
Sbjct: 350 FAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSII 409

Query: 415 ILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQ 474
           ++  G+D SFPAATI+LS+ +P E+QG+A SL  T+VNYS+S+ LG+  T+E Q+N  G 
Sbjct: 410 VMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGA 469

Query: 475 DVLKGYRSAEY 485
           + LKGYR + Y
Sbjct: 470 NALKGYRCSWY 480

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  282 bits (721), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 171/482 (35%), Positives = 261/482 (54%), Gaps = 18/482 (3%)

Query: 13  IQSDISIDKSSNEKCEVIVREKSKWQD--PGYFKNSFQEYLFVGSCMTTQLLNQATTPQT 70
           +Q D   +  + +K + +V ++   QD  PG   +   E  FVG   + QL+ QA   Q+
Sbjct: 8   MQKDFDTNTGTLKKDDEVVLDEFDIQDETPG---SLLWETAFVGVLCSAQLMTQAGLGQS 64

Query: 71  LSIMNVLSDSFNSSRSNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIW 129
           L+ ++++  SF ++   Q +W  +++ L  G+FILI+GR+GDI+G KK  + G+ +  +W
Sbjct: 65  LAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALW 124

Query: 130 SLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASA 189
           SL+ GF+ YS +  F    RAFQG+G AF LPN +  +G  Y  G  RKNMV SL  A A
Sbjct: 125 SLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFGACA 182

Query: 190 PVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIP-SNIPT-NVNGFKM- 246
           P           L+     + WPW+++   IAC F  +   + IP + +P+ + + FK+ 
Sbjct: 183 PGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLL 240

Query: 247 ---DWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSP 303
              D+ GS   V GLILFNFAWNQGP+VGW                      E   A  P
Sbjct: 241 ERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR-AAFP 299

Query: 304 LIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGV 363
           L+      S    + +  +  GW S+GIW FY + F+ + R  +P+ +   +    + G 
Sbjct: 300 LLPFAALSSDTAFV-LSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGF 358

Query: 364 LASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTS 423
            A+   G  + +     ++LF+M  F  GT L++ APV Q+Y+  T   + ++  G+D S
Sbjct: 359 CAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMS 418

Query: 424 FPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSA 483
           FPAATI+LSD +P E+QG+A SL  T+VNYS+S+ LG+  T+E  +N  G   LKGYR +
Sbjct: 419 FPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCS 478

Query: 484 EY 485
            Y
Sbjct: 479 WY 480

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  280 bits (717), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 170/481 (35%), Positives = 263/481 (54%), Gaps = 19/481 (3%)

Query: 14  QSDISIDKSSNEKCEVIVRE-KSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLS 72
           Q ++  +  + +K + ++ E   + + P   K+   E  FVG   + QL+ QA   Q+L+
Sbjct: 9   QKNLDTNAEALKKEDKVLSEFDIQDERP---KSLLWESAFVGVLCSAQLMTQAGLGQSLA 65

Query: 73  IMNVLSDSFNSSRSNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
            ++++ +SF ++ + Q +W  +++ L  G+FILI+GR+GDI+G KK  + G+ +  +WSL
Sbjct: 66  PLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL 125

Query: 132 ICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPV 191
           + GF+ YS +  F    RAFQG+G AF LPN +  +G  Y  G  RKNMV SL  ASAP 
Sbjct: 126 LAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPG 183

Query: 192 XXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIP---TNVNGFKM-- 246
                     ++     + WPW+++   IAC F L ++ Y +  + P    + + FK+  
Sbjct: 184 GFFLGAVFSSML--GQLAWWPWAYWIMGIAC-FVLAVAGYFVIPHTPMPSRDASSFKLLE 240

Query: 247 --DWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPL 304
             D+ GS   V GLILFNFAWNQGP+VGW                      E   A  PL
Sbjct: 241 RIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESR-AAFPL 299

Query: 305 IAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVL 364
           +      S    + +  +  GW S+GIW FY + F+ + R  +P+ +   +    I G  
Sbjct: 300 LPFAALSSDTAFV-LSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFC 358

Query: 365 ASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSF 424
           A+   G  +       ++LF+M  F VGT L++ APV Q+Y+  T   + ++  G+D SF
Sbjct: 359 AAVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSF 418

Query: 425 PAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAE 484
           PAATI+LSD +P E+QG+A SL  T+VNYS+S+ LG+  T+E ++N  G   LKGYR + 
Sbjct: 419 PAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSW 478

Query: 485 Y 485
           Y
Sbjct: 479 Y 479

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  269 bits (687), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 161/468 (34%), Positives = 253/468 (54%), Gaps = 15/468 (3%)

Query: 24  NEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNS 83
           NE+ E +   +S  + P   ++  +E LFVG     QL+ QA   Q+++ + ++ +SF  
Sbjct: 17  NEEGESLQLVQSHVEKP---QSLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGI 73

Query: 84  SRSNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSD 142
           S   Q +W  A++ L  G+FILI+GR+GD++G KK  + G+++  +WSL+ GF+ YS + 
Sbjct: 74  SNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYS-NQ 132

Query: 143 TFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVXXXXXXXXXXL 202
            F    RA QG+G AF LPN +  +G  Y  G  RK MV S+  A+AP           +
Sbjct: 133 IFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSI 191

Query: 203 IVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVN---GF--KMDWIGSALIVTG 257
                 + WPW+++A   AC    +  I  IP   P  ++   G   ++D  G+   + G
Sbjct: 192 F--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILG 249

Query: 258 LILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLIAREITHSRNMII 317
           L L NFAWNQGP+VGW                      E + A  PL+      S ++  
Sbjct: 250 LALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIE-SRARFPLLPFA-ALSTDLAY 307

Query: 318 TIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKIT 377
            +  +  GW S+GIW FY++ F+ + R  SP+     +    I G+ A+   G  +  + 
Sbjct: 308 VLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVP 367

Query: 378 APVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPM 437
           A  ++L +M+ F VG  L++ AP++Q+Y+  T   + I+  G+D SFPAATI++S+ +P 
Sbjct: 368 ACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPH 427

Query: 438 EYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEY 485
           E+QG+A SL  T+VNYS+SL LG   T+E ++N  G + L+GYR A Y
Sbjct: 428 EHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWY 475

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  263 bits (672), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 155/472 (32%), Positives = 248/472 (52%), Gaps = 20/472 (4%)

Query: 21  KSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDS 80
            S  E+  ++++   +W       +  +E   +    + QL+ QA   Q++  + ++ DS
Sbjct: 7   NSHEEQDSLLLQNSREW------TSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDS 60

Query: 81  FNSSRSNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYS 139
           F      Q +W  ++F L  G+FILI+GR+GD +G KK  + G+++  +WS++ GF+ YS
Sbjct: 61  FGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS 120

Query: 140 KSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVXXXXXXXX 199
            +  F    RAFQG+G AFTLPN +  I   Y  G  ++NM+ SL  A AP         
Sbjct: 121 -NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVF 178

Query: 200 XXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNG-----FKMDWIGSALI 254
             L+     + WPW+++   I C    +     IP + P + +       ++D  GS   
Sbjct: 179 SSLL--SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTG 236

Query: 255 VTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLI-AREITHSR 313
           V GLILFNFAWNQGP+VGW+                     E + A  PL+  R++  S 
Sbjct: 237 VVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIE-SRAKHPLLPVRKL--SS 293

Query: 314 NMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISI 373
           + I  +  +  GW S+GIW +Y +  + NLR   P+ +   +    I G+ A+      +
Sbjct: 294 DTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLL 353

Query: 374 KKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSD 433
            + +   +++ +M+ F VG+ L++  PV Q+Y+  T   + ++  G+D SFPAATIILS 
Sbjct: 354 TRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILST 413

Query: 434 GLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEY 485
            +P  +QG+A SL  T++NYS+S+ LG   T+E QI+    D+LKGYR A Y
Sbjct: 414 AMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYY 465

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  256 bits (654), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 168/509 (33%), Positives = 265/509 (52%), Gaps = 21/509 (4%)

Query: 11  EHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQT 70
           E  +  IS ++ S+++      ++  W     F    +EY FV + +  Q  NQA     
Sbjct: 16  ECTERSISCNQESSKE----AYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMI 71

Query: 71  LSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWS 130
           L ++NVLSDSF+       +L+ S+P+V GSF+LI GR+G+++G K+TL+GGYI LI+ S
Sbjct: 72  LPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSS 126

Query: 131 LICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYH--VGSLRKNMVISLIAAS 188
           L+ G + YSKS  F +I RAFQG+G+A  LPN        Y     + RK ++ ++I   
Sbjct: 127 LLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCG 186

Query: 189 APVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTN----VNGF 244
           A            + VT S S W W++Y + IA +  L +S YS+P NI       +NG 
Sbjct: 187 ASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNITKKNKPCLNG- 245

Query: 245 KMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPL 304
            + W  +     GL++ N A N   +   +                    +E+ F+  P+
Sbjct: 246 -LGWFSNR--SCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPV 302

Query: 305 IAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVL 364
            ++E+  + ++ + + ++F GWG+YGIWS Y+F F+LNLR+YSP+ AG +Y    I G +
Sbjct: 303 FSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYV 362

Query: 365 ASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSF 424
           A   + + +K+    + LLFS + F     +LSV P+ QSYF+ TL  M  L +GLD SF
Sbjct: 363 AEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSF 422

Query: 425 PAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAE 484
           P++ IIL + LP +Y  M   L   + NY++S   G+ N+  R ++    +++K YR   
Sbjct: 423 PSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSSI--ELIKYYRYVY 480

Query: 485 YXXXXXXXXXXXXACILVIDKLVAKYRNK 513
           Y            A I +    +  YR K
Sbjct: 481 YFAIGLSAIGLFAAGIQLARASIMYYRGK 509

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  179 bits (454), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 120/190 (63%), Gaps = 34/190 (17%)

Query: 57  MTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLK 116
           M +QLLNQ  T QTL ++NVLS  F SS + QT LVAS PLV+GSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 117 KTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSL 176
            TL+ GY  +I+WS ICG T Y+ S  F +IARAFQGLG+AF LPNV+GT+ N+Y  GS+
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 177 RKNMVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSN 236
           RKNMV                                  YA+ +A S N+ + ++++P N
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 237 IPTNVNGFKM 246
           IPTNV G  M
Sbjct: 147 IPTNVRGQAM 156

 Score = 37.0 bits (84), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 435 LPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVL 477
           +P   +G A      M+ YSM +CLG+  TVE +++K G D L
Sbjct: 147 IPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  174 bits (442), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 119/416 (28%), Positives = 201/416 (48%), Gaps = 12/416 (2%)

Query: 48  QEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFN-SSRSNQTWLVASFPLVAGSFILIS 106
            E +FV    ++Q+L  A   Q +  M+V+ + F  +  S+  W    +    GSF+LI+
Sbjct: 77  HEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIA 136

Query: 107 GRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGT 166
           G++GD+ G K   + GY +L +WSL+ GF+ Y  S  F    RA QG+G AFT  + +  
Sbjct: 137 GKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSI 196

Query: 167 IGNIYHVGSLRKNMVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNL 226
           +G  Y     RKN + S   A              L      + W W++++ AIAC   +
Sbjct: 197 LGKSYPPCK-RKNFIFSFFGACGSFGVVLGMVFSALFT--QLAHWSWAYWSMAIACVVII 253

Query: 227 LISIYSIPSNI---PTNVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXX 283
           ++SI+ IP ++       N F  D++G+ L VTGL+LF+ AWNQ P  G+          
Sbjct: 254 ILSIFFIPGDVVEKHETSNVFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLI 313

Query: 284 XXXXXXXXXXTYEINFAPSPLIAREITH-SRNMIITIFTLFLGWGSYGIWSFYYFSFVLN 342
                       E      PL+    TH S N +  +  +F  + S+ +W+ Y F F L 
Sbjct: 314 VSVVILALAMYVETK-VDDPLLPW--THISANTLKVLLAIFFAYASFTMWAAYTFRFNLM 370

Query: 343 LRHYSPVWAGGSYFIFGIFGVLASAFVGISIK-KITAPVILLFSMVLFCVGTTLLSVAPV 401
            +  + + A        + GV A+ F  + +   +   + +L S++ F V   L++    
Sbjct: 371 AKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGA 430

Query: 402 DQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSL 457
            Q+Y+        ++  GLD SFP+AT++LS+ +P +++G+  SL   ++NY+ +L
Sbjct: 431 GQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATAL 486

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  148 bits (373), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 132/474 (27%), Positives = 224/474 (47%), Gaps = 25/474 (5%)

Query: 3   ESRTSS-IKEH-IQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQ 60
           E+ TSS ++ H   S + +  S NE     +  K+   D       F+E + V    + Q
Sbjct: 8   ETLTSSKLQPHEPTSPVKVVPSHNE-----ILSKT---DEHPLNMQFKEIIIVLLISSGQ 59

Query: 61  LLNQATTPQTLSIMNVLSDSFNSSRSNQT----WLVASFPLVAGSFILISGRIGDIYGLK 116
            ++     Q +  M  ++ +F S R +Q     W  A++   A +F++I+G++GDI G K
Sbjct: 60  FISLLGAVQGIPQMASIASTF-SLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGHK 118

Query: 117 KTLIGGYIFLIIWSLICGFTYYSKSDT-FLIIARAFQGLGIAFTLPNVVGTIGNIYHVGS 175
              I GY +L +WSL+ GF+ Y+K++  F    R  QG+G AF  P  +  +G  Y    
Sbjct: 119 NMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPPCK 178

Query: 176 LRKNMVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIP- 234
            RKN V S   A  P           L      + W W++++ A+ C    ++S   IP 
Sbjct: 179 -RKNYVFSFYGACGPFGIVAGSVFSALFTQL--TTWAWTYWSMAVTCLIITILSYIFIPK 235

Query: 235 SNIPTNVNG--FKMDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXX 292
            N P       +  D++G    +TG+ILF+  WNQ P+  +                   
Sbjct: 236 DNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTMA 295

Query: 293 XTYEINFAPSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAG 352
              + +    PLI  + +   N+I  +  +F G+  + IW FY + F L  ++ S + A 
Sbjct: 296 LIID-SRVKDPLIPWK-SMCSNVIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLLAA 353

Query: 353 GSYFIFGIFGVLASAF-VGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLA 411
             +   GI G+ A+ F V +  KK+   + LL ++  F +   L+S   + ++Y+     
Sbjct: 354 AKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGNAFV 413

Query: 412 GMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTV 465
              I+ +GLD +FP+AT++LS+G+  E QG+A +LA T +NY  +L  G+   +
Sbjct: 414 ATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLI 467

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  144 bits (364), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 113/447 (25%), Positives = 206/447 (46%), Gaps = 16/447 (3%)

Query: 44  KNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQT---WLVASFPLVAG 100
           K   +E   V   +++QL+      Q + I   L + +    +      W  AS+ L + 
Sbjct: 33  KTWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSA 92

Query: 101 SFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSD-TFLIIARAFQGLGIAFT 159
             +LI+G++GD+ G K+ ++ G+I+L IWSLI GF+YY + +  F   ARA QG+G  F 
Sbjct: 93  VMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFI 152

Query: 160 LPNVVGTIGNIYHVGSLRKNMVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFA 219
           +PN +  +G  Y    L+K ++ S+                 L      ++W W+++A A
Sbjct: 153 VPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQL--TKWAWNYWALA 210

Query: 220 IACSFNLLISIYSI-PSNIPTNVNG----FKMDWIGSALIVTGLILFNFAWNQGPIVGWD 274
             C    + +I  I P NI    N      + D++G+   V+GL+LF+ A+ Q   +GW 
Sbjct: 211 CVCVLYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWS 270

Query: 275 XXXXXXXXXXXXXXXXXXXTYEINFAPSPLIAREITHSR-NMIITIFTLFLGWGSYGIWS 333
                                +      PL+  +  H R ++++ +  ++ G+ S+ IW+
Sbjct: 271 PPHTYITLIIGVILILIAMFVDWR-VDDPLVPLQ--HLRADVVVILICVYFGFLSFVIWA 327

Query: 334 FYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIK-KITAPVILLFSMVLFCVG 392
            +++ F   + + SP+          I  + A+ F    ++  I AP +++ SMV F V 
Sbjct: 328 NWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVP 387

Query: 393 TTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVN 452
             L++    + +Y+        I    +D + P AT++ SD +  E QG+A SL +T+++
Sbjct: 388 NILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVIS 447

Query: 453 YSMSLCLGMGNTVERQINKDGQDVLKG 479
           Y++S+       V   +   G D   G
Sbjct: 448 YAISIGPSYTAMVMWYVAPLGNDSTPG 474

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  136 bits (343), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 115/469 (24%), Positives = 211/469 (44%), Gaps = 29/469 (6%)

Query: 21  KSSNEKCEVIVREKSKWQ----DPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNV 76
           + + E+C  +   +++ Q    +P    +  +E +F+    ++Q ++ A   Q +  M+ 
Sbjct: 39  QRTKEQCSNLQPAQAQDQLESMNPPPGPSRLRECMFIVIIASSQFISLAAASQAILQMDA 98

Query: 77  LSDSFN--SSRSNQT-WLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLIC 133
           ++  F   + RS +  W  A+F +  G+FI+ +G++ D+ G K   I GY +  +WSL+ 
Sbjct: 99  ITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLV 158

Query: 134 GFTYYSKSD--TFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPV 191
           G + Y+     TF    R  QG+G A   P+ +  +G  Y+  S +KN+V SL     P+
Sbjct: 159 GISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGK-YYPPSCKKNIVFSLYGFCVPL 217

Query: 192 XXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSN--IPTNVNGFK---- 245
                     +    +   W W++++ AI  +F  LIS + IP +  I +     K    
Sbjct: 218 GVVVGGVFSAIFTQLA--HWSWNYWSMAIVSAFFTLISCFYIPPDEIIKSEEQKKKRAWF 275

Query: 246 ----MDWIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAP 301
                D++G+ L V  L+LF   WNQ     +                      E  +  
Sbjct: 276 HLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVTLIVSLVCFVAMVIVEF-YVD 334

Query: 302 SPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIF 361
            P+I     H +  I  +  +F  + S+ IW FY + +   +R+ + +     +    I 
Sbjct: 335 DPIIPARKIHPQT-IKALLVVFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIA 393

Query: 362 GVLASAFVGISIK-KITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGL 420
           G +A+ F  + I   +   + LL     F +   L       +SY+      + I+ +GL
Sbjct: 394 GFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRTESYWARPFLTIIIISIGL 453

Query: 421 DTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQI 469
           D SFP+AT++LS+G+P E +G++ +L  T +NY      G+G  + + I
Sbjct: 454 DISFPSATLLLSNGVPQELRGISAALVGTALNYGT----GIGPPIAQTI 498

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  128 bits (321), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 122/544 (22%), Positives = 229/544 (42%), Gaps = 80/544 (14%)

Query: 8   SIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSF-QEYLFVGSCMTTQLLNQAT 66
           ++ E +Q     D+ S++     +    K Q P    NS+  + +F+    ++Q +  A+
Sbjct: 37  TVTETVQ-----DQQSHKVTHSSLIRLQKLQSP---TNSYLNDIIFIFLICSSQFITLAS 88

Query: 67  TPQTLSIMNVLSDSFN---SSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGY 123
             Q +  M+ LS  F    +S     W+ ASF +  G+FI+++G++ DI   +   I GY
Sbjct: 89  ASQAILQMDSLSVWFKIPPTSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGY 148

Query: 124 IFLIIWSLICGF-TYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSL------ 176
           ++  +W+LI GF +Y  K+  FL I R  QG+G A   P+ +  +   Y V         
Sbjct: 149 VWFSLWTLITGFASYVPKNMIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQ 208

Query: 177 ----------------------------------------RKNMVISLIAASAPVXXXXX 196
                                                    K++  SL  A AP+     
Sbjct: 209 SKSPTTSAPSPSHDIEKNLSSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIG 268

Query: 197 XXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIP-----TNVNGFK----MD 247
                +    +   WPW++++ +I  +   ++S + +   IP     +N N  K     D
Sbjct: 269 GIFSAIFTQLA--TWPWNYWSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFD 326

Query: 248 WIGSALIVTGLILFNFAWNQGPIVGWDXXXXXXXXXXXXXXXXXXXTYEINFAPSPLIAR 307
           ++G  L ++ LILF  +W+Q  +  +                     +E  F  +P+I  
Sbjct: 327 FLGVILGISALILFGVSWDQATMYKFKTIHVYLTLLFSLVSFIAMIIWEYYFN-NPIIPI 385

Query: 308 EITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASA 367
              H    I  +  +F  + S+  W FY +     ++  SP+     +    + G++++ 
Sbjct: 386 RQIHP-GTIKALLVVFFSYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISAT 444

Query: 368 F-VGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPA 426
           F + + +K++   + LL     F +   LL    +D SY+      +  + +GLD SFP+
Sbjct: 445 FSILLIVKRVPVQIRLLAGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPS 504

Query: 427 ATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNT-VERQIN------KDGQDVLKG 479
           AT++L++G+P E QG+  +L  +++NY  ++   +  T ++ Q         D +  LKG
Sbjct: 505 ATLLLTNGIPPEIQGICAALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKG 564

Query: 480 YRSA 483
              A
Sbjct: 565 IHIA 568

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 87/376 (23%), Positives = 138/376 (36%), Gaps = 63/376 (16%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +I++V+++ F +  S   WLV  + L      LI GR   I G + +LI   +     SL
Sbjct: 59  TIIDVVAEQFGN-YSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 132 ICGFTYYSKSDTFLIIARAFQGLGIA--FTLPNVVGTIGNIYHVGSLRKNMVISLIAASA 189
           I      + S   LI  R   G+G +   TL  V+G       VG   + +VIS+++ + 
Sbjct: 118 IAAL---ASSMNMLIFGRVVAGVGGSGLQTLCFVIGCT----MVGERSRPLVISILSCAF 170

Query: 190 PVXXXXXXXXXXLIVTESPSQWPWSFY----------------------------AFAIA 221
            V             T     W W FY                              AI 
Sbjct: 171 AVAAIVGPIIGGAFTTHV--TWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIG 228

Query: 222 CSFNLLISIYSIPSNIPTNVNG--FKMDWIGSALIVTGLILF---------NFAWNQGPI 270
              +   S +    N    +NG  FK D+ G AL   GL+LF          ++WN G +
Sbjct: 229 TISSFTFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQV 288

Query: 271 VGWDXXXXXXXXXXXXXXXXXXXTYE---INFAPSPLIAREITHSRNMIITIFTLFL--- 324
           + +                     +     N +  PL+ R +     +II     FL   
Sbjct: 289 ITYLVLGVLLFIFSLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIVNMVTFLLCT 348

Query: 325 GWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFI-FGIFGVLASAFVGISIKKI-TAPVIL 382
           G+    I+S  +F  +      S  W  G + I   I  V+A+   G+  KK+     +L
Sbjct: 349 GYNGQMIYSVQFFQLIFA----SSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLL 404

Query: 383 LFSMVLFCVGTTLLSV 398
           +F  VL  +G  L+++
Sbjct: 405 IFGGVLGVIGAGLMTL 420

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 4/84 (4%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +IMN +++ F+ S   Q W+  SF L   +F  + G++ DI G K  L+  + F   + +
Sbjct: 58  NIMNRVAEEFSESSRKQ-WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFF---FGI 113

Query: 132 ICGFTYYSKSDTFLIIARAFQGLG 155
            C  T ++++ T   IARA  G+G
Sbjct: 114 GCLLTCFARNVTEFSIARAICGIG 137

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +IMN +++ F+ S   Q W+  SF L   +F  + G++ DI G K  L+    F   + L
Sbjct: 58  NIMNRVAEEFSESSKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQFF---FGL 113

Query: 132 ICGFTYYSKSDTFLIIARAFQGLG 155
            C  T ++++ T   IARA  G+G
Sbjct: 114 GCLLTCFARNVTEFSIARAICGIG 137

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 71/143 (49%), Gaps = 13/143 (9%)

Query: 18  SIDKSSN-----EKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLS 72
           ++D+++N     E+ EV+  E+ K+ +   +  +  ++  + S      L+   +    +
Sbjct: 3   TLDETANLLPAPEEAEVLPLEQ-KYHE---YNLALPKFPILFSLWLGSFLSSLDSTIVAN 58

Query: 73  IMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLI 132
           IMN +++ F+ S   Q W+  SF L   +F  + G++ DI G +  L+    F   + L 
Sbjct: 59  IMNRVAEEFSESSKKQ-WIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFF---FGLG 114

Query: 133 CGFTYYSKSDTFLIIARAFQGLG 155
           C  T ++++ T   IARA  G+G
Sbjct: 115 CLMTCFARNVTEFSIARAVCGIG 137

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +IMN +++ F+ S   Q W+  SF L   +F  + G++ D+ G K  L+  Y FL+I   
Sbjct: 57  NIMNRVAEEFSESDKKQ-WIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIG-- 113

Query: 132 ICGFTYYSKSDTFLIIARA 150
            C  T  +++ T   +ARA
Sbjct: 114 -CLLTCLARNVTEFAVARA 131

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 46/84 (54%), Gaps = 4/84 (4%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +IMN +++ F+ S S + W+  SF L   +F  + G++ DI G K  L+    F   + L
Sbjct: 58  NIMNRVAEDFSES-SRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLIAQFF---FGL 113

Query: 132 ICGFTYYSKSDTFLIIARAFQGLG 155
            C  T ++++ T   IARA  G+G
Sbjct: 114 GCLLTCFARNVTEFSIARAICGIG 137

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +IMN +++ F  S   Q W+  SF L   +F  + G++ DI G K  ++  + F   + L
Sbjct: 62  NIMNKVAEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFF---FGL 117

Query: 132 ICGFTYYSKSDTFLIIARAFQGLG 155
            C  T ++++ T   IARA  G+G
Sbjct: 118 GCFLTCFAQNITQFSIARAICGIG 141

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +IMN +++ F  S   Q W+  SF L   +F  + G++ DI G K  ++  + F   + L
Sbjct: 65  NIMNRVAEEFAESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFF---FGL 120

Query: 132 ICGFTYYSKSDTFLIIARAFQGLG 155
            C  T ++++ T   IARA  G+G
Sbjct: 121 GCLLTCFAQNVTQFSIARAICGMG 144

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 89/218 (40%), Gaps = 19/218 (8%)

Query: 62  LNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIG 121
           L+ A+    + ++  +   FN S +   W + S+ +    FI   GR+GDI G    +  
Sbjct: 34  LDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIMMCV 93

Query: 122 GYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMV 181
             +   I+SL+C       + T   + RAFQG+  A  +P     +  ++   +L++   
Sbjct: 94  FSVIFGIFSLLCAVVPNFIAFT---VFRAFQGMAGAGIVPCAYALVNKMFQGPNLQRYFS 150

Query: 182 I--SLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFY-----AFAIACSFNLLISIYSIP 234
           I  S+I+A A V              E+   +   FY     + A A    +LI    + 
Sbjct: 151 ILSSVISAMAGVGFIIGGAF-----GETALGYKSFFYFLFAASLATAAVICVLIGYPELL 205

Query: 235 SNIPTNVNGF----KMDWIGSALIVTGLILFNFAWNQG 268
            N  +    F    K+D IG  L ++G IL      QG
Sbjct: 206 LNRHSYKEKFQRVYKLDVIGCLLFISGSILLVVGLTQG 243

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 44/84 (52%), Gaps = 4/84 (4%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +IMN +++ F  S   Q W+  S+ L   +F  + G++ D+ G K  ++  + F   + L
Sbjct: 59  NIMNRVAEEFQESDKKQ-WIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFF---FGL 114

Query: 132 ICGFTYYSKSDTFLIIARAFQGLG 155
            C  T ++ S T   IARA  G+G
Sbjct: 115 GCLLTCFANSVTQFAIARAICGVG 138

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 86  SNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFL 145
           S  +W+  S+ L + +F  + G++ DI+G K  L+   +  +I  L+CG    SKS  +L
Sbjct: 146 SKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGL---SKSFWWL 202

Query: 146 IIARAFQGLG 155
           +IAR   G+G
Sbjct: 203 VIARFVAGVG 212

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 58/128 (45%), Gaps = 8/128 (6%)

Query: 34  KSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVA 93
           +++ Q   Y  N     +F+G   T  LLN A+    +S+++ L+  ++ S +  +W + 
Sbjct: 17  RNRCQKSTYQLNVNVALIFLGC--TFDLLNVASM---ISLIDDLAQKYDISYTTASWSLT 71

Query: 94  SFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQG 153
           S+ +    FI   GR+GDI G          F  I SL+C       +     + RA QG
Sbjct: 72  SYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLCAVM---PNFPAFAVFRAIQG 128

Query: 154 LGIAFTLP 161
           +  A  +P
Sbjct: 129 ISAAGLVP 136

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 4/79 (5%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +IMN +++ F  S   Q W+  SF L   +F  + G++ DI G K  L+  + F   + L
Sbjct: 73  NIMNRVAEEFQESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTF---FCL 128

Query: 132 ICGFTYYSKSDTFLIIARA 150
            C  T ++++ T   IARA
Sbjct: 129 GCLLTCFARNVTEFSIARA 147

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 62/130 (47%), Gaps = 8/130 (6%)

Query: 28  EVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSN 87
           + I++ ++K Q      N     +F+G   +  L+N ++    +S+++ LS  ++ S + 
Sbjct: 11  QAILKLRTKCQTSTVNLNVNVALIFLGC--SIDLINVSSM---ISLIDELSTKYSISYTT 65

Query: 88  QTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLII 147
            +W + S+ +    FI   GR+GDI G  +          I SL+CG       + F ++
Sbjct: 66  ASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLLCGLM--PNFEAFAVM 123

Query: 148 ARAFQGLGIA 157
            RA QG+  A
Sbjct: 124 -RALQGIAAA 132

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 47/84 (55%), Gaps = 4/84 (4%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           ++++ ++  FN   S+ +W+  ++ L + +F  + G+I DI+G +  +I   +F I+  L
Sbjct: 83  TLLSHIASEFNE-LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCL 141

Query: 132 ICGFTYYSKSDTFLIIARAFQGLG 155
           ICG    SK+   L+  R   G+G
Sbjct: 142 ICGL---SKNLWTLVAGRFIAGIG 162

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 52/121 (42%), Gaps = 4/121 (3%)

Query: 43  FKN-SFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGS 101
           F+N SF  Y+ +   M +   +       LS    + +++    +  +W + ++ +    
Sbjct: 16  FQNISFHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTASWALTAYAITFAG 75

Query: 102 FILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLP 161
           FI   GR+GDI G     +       I SLIC     +   TF +  RA QG+  A  +P
Sbjct: 76  FIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVV--NNFGTFAVF-RALQGIAAAGIVP 132

Query: 162 N 162
           +
Sbjct: 133 S 133

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 9/97 (9%)

Query: 18  SIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVL 77
            I K SN   E+    ++K Q   Y  N     +F+G   T  LLN A+    +S+++ L
Sbjct: 5   KIAKLSNALEEI----RNKCQKSRYQLNVNVGLIFLGC--TFDLLNVASM---ISLIDDL 55

Query: 78  SDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYG 114
           + ++N S +  +W + S+ +    FI   GR+GDI G
Sbjct: 56  AKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIG 92

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 34  KSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVA 93
           ++K Q   Y  N     +F+G   T  LLN A+    +S+++ L+  +N S +  +W + 
Sbjct: 17  RNKCQKSPYQLNVNVGLIFLGC--TFDLLNVASM---ISLIDDLAKKYNISYTTASWSLT 71

Query: 94  SFPLVAGSFILISGRIGDIYG 114
           S+ +    FI   GR+GDI G
Sbjct: 72  SYAVTFAGFIACMGRLGDIVG 92

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 402 DQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGM 461
           D  ++K+  +  A++G G+   +P A  I   G P + +G+A  +A T     + +   +
Sbjct: 403 DNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSV 462

Query: 462 GNTVERQIN--KDGQDVLKGYRS 482
             +V   IN  K  +D ++ +R+
Sbjct: 463 MASVLGDINEMKGKEDAIQNFRT 485

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 71  LSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWS 130
           ++I+N ++D FN+  S   WL+  + L    F L+ GR   I+G K TL+   I   I S
Sbjct: 41  VTILNTIADKFNA-YSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 131 LICGFTYYSKSDTFLIIARAFQGLG 155
           L+      S S   +I  R   G G
Sbjct: 100 LVIA---VSNSMDMIIGGRVIAGCG 121

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 4/79 (5%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +IMN ++  F  S   Q W+  S+ L   +F  + G++ DI G K  +I  + F   ++L
Sbjct: 64  NIMNSIAAEFAESDKKQ-WIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFF---FAL 119

Query: 132 ICGFTYYSKSDTFLIIARA 150
            C  T ++++ T   IARA
Sbjct: 120 GCLLTCFAQNVTQFSIARA 138

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 67/148 (45%), Gaps = 21/148 (14%)

Query: 10  KEHIQSDISIDKSSNEKCEVIVREKS--KWQDPGYFKNSFQEYLFVGSCMTTQLLNQATT 67
           +EH    +  +K   E  E+ +R+    KW     + NS    L  G+ ++T + + A+ 
Sbjct: 75  REH-SGALEGNKEDEEDLEIDLRDPKTFKWVLTSLWTNSALSAL-DGTIVSTTVNDVASR 132

Query: 68  PQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLI 127
            Q  S++              TW+  ++ L   +   + G+I DI G +K L+ G    I
Sbjct: 133 FQQASMV--------------TWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGE---I 175

Query: 128 IWSLICGFTYYSKSDTFLIIARAFQGLG 155
           ++++  G   +SKS   L IAR   G+G
Sbjct: 176 VFAVGVGLCIFSKSIPQLAIARGICGIG 203

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 71  LSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWS 130
           +++ + +   FN   +N  WL+A + L    F+L+ GRI  + GLK +L+   +     S
Sbjct: 28  ITLYDTIGQEFND-YANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGS 86

Query: 131 LICGFTYYSKSDTFLIIARAFQGLG 155
           L+ G    + S   LI AR   G G
Sbjct: 87  LMAG---AANSMGMLIGARVISGFG 108

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 6/104 (5%)

Query: 58  TTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKK 117
           T  LLN A     +S++  L +++    +  +W + S+ +    FI   GR+GDI G   
Sbjct: 38  TFDLLNVAGV---ISVIEDLGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDIVGNSV 94

Query: 118 TLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLP 161
                     ++SL+C         TF +  RA QG+  A  +P
Sbjct: 95  LFTISCFLFTLFSLLCAVV--RDFPTFAVF-RALQGISAAGIVP 135

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 4/82 (4%)

Query: 74  MNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLIC 133
           +N ++  F  + S  TW+  ++ L   +   + G+I DI G +K L+ G +   +  L+C
Sbjct: 84  VNDIASQFQQA-SMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFALGVLLC 142

Query: 134 GFTYYSKSDTFLIIARAFQGLG 155
            F   + +   L IARA  G+G
Sbjct: 143 NF---ANTIPQLAIARAICGIG 161

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 81/228 (35%), Gaps = 54/228 (23%)

Query: 87  NQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLI 146
           N  WLV  + L    F+L+ GR+ +I G K+ L+   I   I SLI      S S   LI
Sbjct: 44  NIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISAL---SNSMATLI 100

Query: 147 IAR---AFQGLGIAFTLPNVVGT-IGNIYHVGSLRKNMVISLIAASAPVXXXXXXXXXXL 202
             R    F G GI  +L  VVGT I    H G +   + IS + A              L
Sbjct: 101 SGRVVAGFGGSGIE-SLAFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHL 159

Query: 203 IVTESPSQWPWSFYAFAIACSFNLLISIYS-----------IPSNIPTNVN--------- 242
                   W W FY      +F  +I  +            +PS I   +N         
Sbjct: 160 -------SWRWCFYINLPIGAFAFIILAFCNTSGEPHQKMWLPSKIKKIMNYDYGELLKA 212

Query: 243 ----------GFKMDWIGSALIVTGLILF---------NFAWNQGPIV 271
                      FK+D +G  L   G  L          NF WN G I+
Sbjct: 213 SFWKNTFEVLVFKLDMVGIILSSAGFTLLMLGLSFGGNNFPWNSGIII 260

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 89  TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFT 136
           +W+  ++ L + +F  I G+I DI+G K  LI   I   + SLICG +
Sbjct: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 73  IMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLI 132
           IMN +++ FN+S   Q W+  S+ L   +F  + GR+ DI G K T +    F  + S +
Sbjct: 89  IMNRVAEDFNASNQKQ-WIATSYLLTNTAFQPLYGRLSDIIGRKYTQLIVPFFFGMGSFL 147

Query: 133 CGFTYYSKSDTFLIIARA 150
              T +SK+     +ARA
Sbjct: 148 ---TTFSKTLPQFALARA 162

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 52/143 (36%), Gaps = 11/143 (7%)

Query: 20  DKSSNEKC-------EVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLS 72
           D SS E C         +V +  K          F  Y  +GS      L+        +
Sbjct: 6   DNSSKELCTQAESSTSEVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDILIVST 65

Query: 73  IMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLI 132
           I+  +S  FN   S   WLV  + L      L+ GR   I G K +++   I   + SL+
Sbjct: 66  IIETVSRDFNE-YSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLV 124

Query: 133 CGFTYYSKSDTFLIIARAFQGLG 155
                 + S   LI  R   G+G
Sbjct: 125 SAL---ANSMNMLIGGRVISGVG 144

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 89/416 (21%), Positives = 153/416 (36%), Gaps = 64/416 (15%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +I++V+++ F +  S   WLV  + L      L+ GR   I G + +LI   +     SL
Sbjct: 57  TIIDVVAEQFGN-YSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSL 115

Query: 132 ICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPV 191
           +        +   ++I            L  +   IG    V    + +VIS+++ +  V
Sbjct: 116 VAALA----NSMNMLIVGRVVAGVGGSGLQTLCFVIG-CTMVNERSRPLVISILSCAFAV 170

Query: 192 XXXXXXXXXXLIVTESPSQWPWSFY------AFAIAC--------SFNLLISIYSI---- 233
                        T     W W FY       FA+          S N+L    +I    
Sbjct: 171 AAIVGPIIGGAFTTH--VTWRWCFYINLPIGGFAVIMFLLTYKTKSENILQQTRNILGRI 228

Query: 234 ----------PSNIPTNVNG--FKMDWIGSALIVTGLILF---------NFAWNQGPIVG 272
                     P N+   + G  FK D++G AL   GL+LF          ++WN G I+ 
Sbjct: 229 SKFELRRLTEPGNLRKALIGILFKFDFLGFALSSAGLVLFLLGLTFGGNKYSWNSGQIIT 288

Query: 273 WDXXXXXXXXXXXXXXXXXXXTYE---INFAPSPLIAREITHSRNMII---TIFTLFLGW 326
           +                     +     N +  PL  + +     +II     F L +G+
Sbjct: 289 YLVLGILLFVFSLIYDFFIFQKFNPEPDNTSYRPLFLKRLVAKPAVIIVNMVTFLLCIGY 348

Query: 327 GSYGIWSFYYFSFVLNLRHYSPVWAGGSYFI-FGIFGVLASAFVGISIKKI-TAPVILLF 384
               I+S  +F  +      S  W  G + I   I  V+A+   G+  KK+     +L+F
Sbjct: 349 NGQMIYSVQFFQLIFA----SSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIF 404

Query: 385 SMVLFCVGTTLLSVAPVDQSYFK----LTLAGMAILGVGLDTSFPAATIILSDGLP 436
             +L  +G  L+++   + +       L L G++ LG  L  S  +A + +    P
Sbjct: 405 GGILGVIGAGLMTLMSNNSTSSTQIGVLILPGLS-LGFALQASLMSAQLQIKKDRP 459

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           ++++ ++  FN      +W+  ++ L + +F  + G++ DI+G +  L+   +   + +L
Sbjct: 162 TLLDHIASEFNE-LPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGAL 220

Query: 132 ICGFTYYSKSDTFLIIARAFQGLG 155
           ICG    SK+   L++ R   G+G
Sbjct: 221 ICGM---SKNLWVLVLGRFVAGIG 241

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 70  TLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIW 129
           TL++  + S  F+ +    TW +    ++     ++ G IGD YG K + I    F+++ 
Sbjct: 95  TLNVKKI-SHDFDVTTKQVTWGITLVLMLRVVGAVLFGYIGDRYGRKVSFIINLFFMMVL 153

Query: 130 SLICGFTYYSKSDTFLIIARAFQGL 154
            +I GF  ++    + +IARAF G+
Sbjct: 154 EIITGFIKHNFK--YFLIARAFFGV 176

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 49/245 (20%), Positives = 95/245 (38%), Gaps = 13/245 (5%)

Query: 4   SRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLN 63
           SRT++  E    D S + S +E+ +  + E  +   P       Q++  V     T   +
Sbjct: 46  SRTTT-NELGDDDTSSECSHDEQEQQHIVEGEQ-NYPHTLLTYRQKWFMVFLMTITGFWS 103

Query: 64  QATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGY 123
              +P     +  L   FN   +     V  + L  G    ISG + D+YG +  ++GG 
Sbjct: 104 SLGSPIYYPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGM 163

Query: 124 IFLIIWSLICGFTYYSKSDTFLIIA--RAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMV 181
           +  ++ S+       +K+ ++ +I   R  Q +GI+ T+    G + +     ++++   
Sbjct: 164 LIFVVASI-----GIAKAPSYGVIVFLRCIQSIGISPTIAISSGVVSDF----TVKRERG 214

Query: 182 ISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNV 241
             + A S  V            V  +   W   F+   I C   ++I  + +P    T V
Sbjct: 215 TFVGATSGLVLIGQGIGPLLGAVITAALHWRAVFWFLTIGCGSCMIIGFFLLPETKRTIV 274

Query: 242 NGFKM 246
               +
Sbjct: 275 GNLSI 279

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 75/186 (40%), Gaps = 26/186 (13%)

Query: 3   ESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQ-----------DPGYFKNSFQEYL 51
           ES  + I E   +D   DKS  E+  ++  EK               +P Y  ++F  Y 
Sbjct: 52  ESDMTDISEIKDTDFDSDKSKEEQSSIVRNEKHPETAFTALEPEIAYNPPY--SAFSNYQ 109

Query: 52  FVGSCMTT---QLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLV--AGSFILIS 106
            V   +       L   T    +  + +L   FN+S +     VA+F  V   G F+   
Sbjct: 110 VVSILLIIIYIGFLGPVTGNIYIPALPILQSEFNTSTTAINGTVAAFMGVFAVGPFLW-- 167

Query: 107 GRIGDIYGLKKTLIGGYIFLIIWSLICG--FTYYSKSDTFLIIARAFQGLGIAFTLPNVV 164
             +   +G +K L   YIF ++ +LI         K    L I R FQ +G +  +P  V
Sbjct: 168 -AVHADFGGRKFL---YIFSLMIALIANVLLAAVPKHLAALYILRVFQAIGTSAVIPLGV 223

Query: 165 GTIGNI 170
           GT+ ++
Sbjct: 224 GTVSDL 229

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 70/172 (40%), Gaps = 15/172 (8%)

Query: 74  MNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWS--L 131
           +  L   FN   +     V  + L  G    +SG + D++G +  ++GG +  ++ S  L
Sbjct: 125 LRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGL 184

Query: 132 ICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPV 191
            C  +Y       +   R  Q +GI+ T+    G +G+     +L+      + A S  V
Sbjct: 185 ACAPSY-----GVICFLRCIQSIGISPTIAISSGVVGDF----TLKHERGTFVGATSGLV 235

Query: 192 XXXXXXXXXXLIVTESPSQWPWS--FYAFAIACSFNLLISIYSIPSNIPTNV 241
                     LI     ++W W   F+  AI     L+++ +++P    T V
Sbjct: 236 --LLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIV 285

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 57/133 (42%), Gaps = 11/133 (8%)

Query: 86  SNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFL 145
           S   W+ A + L      L+ GRI  I G K  ++   I   I SLI G    + S   L
Sbjct: 113 SKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISG---VANSMNML 169

Query: 146 IIARAFQGLGIA--FTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVXXXXXXXXXXLI 203
           I  R   G+G +   +L  V+G+  N+  V   R+ ++I+ ++++  V            
Sbjct: 170 IGGRVIAGVGGSGIQSLAFVIGS--NL--VDERRRGLIIACMSSAFAVASVIGPFLGGAF 225

Query: 204 VTESPSQWPWSFY 216
            T   + W W FY
Sbjct: 226 TTH--ATWRWCFY 236

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 83/228 (36%), Gaps = 54/228 (23%)

Query: 87  NQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLI 146
           N  WLV  + L    F+L+ GR+ +I G  + L+   I   + SLI      S S   LI
Sbjct: 44  NIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISAL---SNSMGTLI 100

Query: 147 IAR---AFQGLGIAFTLPNVVGT-IGNIYHVGSLRKNMVISLIAASAPVXXXXXXXXXXL 202
             R    F G GI  +L  VVGT I    H G++   +  S + A              L
Sbjct: 101 SGRLIAGFGGSGIE-SLAFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGAFNEHL 159

Query: 203 IVTESPSQWPWSFY------AFAIA----CS--------FNLLISIYSIPS--------- 235
                   W W FY      AFA+     C+         +LL  I SI S         
Sbjct: 160 -------SWRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSIMSYKYDEVFKA 212

Query: 236 ---NIPTNVNGFKMDWIGSALIVTGLILF---------NFAWNQGPIV 271
                   V  FK+D IG  L   G  L          NFAWN   I+
Sbjct: 213 SFWKKAFKVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSSTII 260

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 89  TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIA 148
           +W+  ++ L + +F  + G+I DI+G K  L    +   I  LICG    +KS   L+I 
Sbjct: 133 SWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICG---TAKSFWVLVIG 189

Query: 149 RAFQGLG 155
           R   G+G
Sbjct: 190 RFISGVG 196

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 4/84 (4%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +IM  ++  FN      +W+  ++ L + +F  + G++ DI+G K  L+   I  ++  L
Sbjct: 101 TIMAHIASEFNE-LPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCL 159

Query: 132 ICGFTYYSKSDTFLIIARAFQGLG 155
           +CG T    S   L+ AR   G+G
Sbjct: 160 MCGLT---PSFWGLVGARFISGIG 180

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 84/223 (37%), Gaps = 50/223 (22%)

Query: 90  WLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIAR 149
           WLV  + L    F L+ GR+  I GLK +L    +   I SLI      S S   +I  R
Sbjct: 46  WLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVA---VSNSMGMIIGGR 102

Query: 150 AFQGLGIA--FTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVXXXXXXXXXXLIVTES 207
              G G +   +L  VVGT      V    + MVI+++  +  V             TE+
Sbjct: 103 VVAGCGGSGIQSLVFVVGT----SLVEERNRGMVITVLGLAFAVAFAVGPVIGGAF-TEN 157

Query: 208 PSQWPWSFY------AFAIA-CSFNLLISIYSIPSNIPTNVNG----------------- 243
            S W W FY        A+   +F+   +  S+   +  N                    
Sbjct: 158 VS-WRWCFYINLPIGGVALTMLTFSYNTTEKSVQETLTYNCRQLQTYRYGQWVTASFWRR 216

Query: 244 ------FKMDWIGSALIVTGLILF---------NFAWNQGPIV 271
                 F +D+IG AL  TG +LF          +AWN G I+
Sbjct: 217 AYNFLMFDLDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTII 259

>YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease of
           basic amino acids in the vacuolar membrane
          Length = 458

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 72/182 (39%), Gaps = 23/182 (12%)

Query: 236 NIPTNVNG--FKMDWIGSALIVTGLILF---------NFAWNQGPIVGWDXXXXXXXXXX 284
           N    +NG  FK D+ G AL   GL+LF          ++WN G ++ +           
Sbjct: 119 NFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVIAYLVLGVLLFIFS 178

Query: 285 XXXXXXXXXTYE---INFAPSPLIAREITHSRNMII---TIFTLFLGWGSYGIWSFYYFS 338
                     +     N +  PL+ R +     +II     F L  G+    I+S  +F 
Sbjct: 179 LVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIINMVTFLLCTGYNGQMIYSVQFFQ 238

Query: 339 FVLNLRHYSPVWAGGSYFI-FGIFGVLASAFVGISIKKI-TAPVILLFSMVLFCVGTTLL 396
            +      S  W  G + I   I  V+A+   G+  KK+     +L+F  VL  +G  L+
Sbjct: 239 LIFA----SSAWKAGLHLIPIVITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLM 294

Query: 397 SV 398
           ++
Sbjct: 295 TL 296

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 50/243 (20%), Positives = 95/243 (39%), Gaps = 16/243 (6%)

Query: 1   MAESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQ 60
           ++++ T  I+  + S+ S   SS++K +   +  ++ + P    +  Q++  V       
Sbjct: 52  LSKTTTREIEGDLDSETS-SHSSDDKVDPTQQITAETKAPYTLLSYGQKWGMVAILTMCG 110

Query: 61  LLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLI 120
             +   +P     +  L   FN   +     V  + L  G    +SG + D +G +  ++
Sbjct: 111 FWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIIL 170

Query: 121 GGYIFLIIWS--LICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRK 178
            G +  +I S  L C  +Y       +I  R  Q +GI+ T+    G +G+     +L+ 
Sbjct: 171 AGMLIYVIASIGLACAPSY-----GVIIFLRCIQSIGISPTIAISSGVVGDF----TLKH 221

Query: 179 NMVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWS--FYAFAIACSFNLLISIYSIPSN 236
                + A S  V          LI     ++W W   F+   I C    LI+   +P  
Sbjct: 222 ERGTFVGATSGFV--LLGQCFGSLIGAVLTARWDWRAIFWFLTIGCGSCFLIAFLILPET 279

Query: 237 IPT 239
             T
Sbjct: 280 KRT 282

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 89  TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFT 136
           +W+  ++ L + +F  + G+I DI+G K  LI   +   +  LICG +
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

>SAKL0F16632g Chr6 complement(1375911..1377758) [1848 bp, 615 aa]
           {ON} similar to gnl|GLV|KLLA0F24200g Kluyveromyces
           lactis KLLA0F24200g and some similarities with
           uniprot|P53918 Saccharomyces cerevisiae YNL125C ESBP6
          Length = 615

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 59/147 (40%), Gaps = 15/147 (10%)

Query: 102 FILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLP 161
           F+L+  RI   +G K  ++ G +FL +  ++   +Y +K     +      G+GIAF   
Sbjct: 201 FVLLFSRI---FGFKVPMLLGTVFLFLGHMLA--SYAAKLWQLYLTQGLLCGMGIAFVFA 255

Query: 162 NVVGTIGNIYHVGSLRKN---MVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWSFYAF 218
                +   +    LRK    + +SL+   A            +  T  P    W+    
Sbjct: 256 PATVVLPGWF----LRKRSFAVGLSLVGTGAGGVTYSLAVNQIIQRTGDPR---WALRTL 308

Query: 219 AIACSFNLLISIYSIPSNIPTNVNGFK 245
           AIACS   L++I  I   +P    G K
Sbjct: 309 AIACSVTCLVAIAVIRQRVPATPIGIK 335

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 104 LISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAF 158
           L+ GR+G+ +G ++T+  G +  +I  L  GF   +     LII R   GLG+  
Sbjct: 163 LLVGRLGEKWGRRRTIKYGSLIFVIGGLFQGF---ADKMMHLIIGRTISGLGVGL 214

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 57/134 (42%), Gaps = 8/134 (5%)

Query: 28  EVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSN 87
           E I   + + Q+  Y        +F+G   T  LLN A     +S++  L +++    + 
Sbjct: 14  EGIYNLRRRCQNSKYQLIINMALIFLGC--TFDLLNVA---GVISVIEDLGETYGLEYTT 68

Query: 88  QTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLII 147
            +W + S+ +     I   GR+GDI G          F  ++ L+C     +    F ++
Sbjct: 69  ASWALTSYAITFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVV--TNFPAFAVL 126

Query: 148 ARAFQGLGIAFTLP 161
            RA QG+  A  +P
Sbjct: 127 -RALQGIAAAGLVP 139

>KAFR0B01080 Chr2 (204541..206721) [2181 bp, 726 aa] {ON} Anc_7.309
           YDL194W
          Length = 726

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 58/117 (49%), Gaps = 10/117 (8%)

Query: 73  IMNVLSDSFNSSRSNQTWLVASFPLVAGSFI--LISGRIGDIYGLKKTLIGGYIFLIIWS 130
           ++  L+ + +S  + Q  ++ SF L  G+F   L +  I DIYG K  +I      +I+S
Sbjct: 90  VLQHLTPNHSSFSNTQLSILVSF-LSLGTFFGALTAPWISDIYGRKPAIIVSTA--VIFS 146

Query: 131 LICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAA 187
           +       +KS T LI+ R   G GI      ++  +  +Y   + +KN+  ++I++
Sbjct: 147 IGNSLQVAAKSLTLLIVGRVVSGFGIG-----IISAVVPLYQAEAAQKNLRGAIISS 198

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 2/71 (2%)

Query: 86  SNQ-TWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTF 144
           SNQ +W+  S+ L   +F  + G++ D++G K  LI   +      ++CG   ++KS   
Sbjct: 66  SNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCILCG-APFTKSLWM 124

Query: 145 LIIARAFQGLG 155
           L I R   G+G
Sbjct: 125 LCIGRFIAGVG 135

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 71  LSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWS 130
           +++   + + FN   ++  WLV  + L +  F L+ GR+  + GLK  L+   +   I S
Sbjct: 64  VTLYETIGEKFND-YNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGS 122

Query: 131 LICGFTYYSKSDTFLIIARAFQGLG 155
           LI      S S   LI  R   G G
Sbjct: 123 LIAAV---SNSMGMLIAGRVVAGAG 144

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 19/108 (17%)

Query: 370 GISIKKITAPVILLFSMVLFC----------VGTTLLSVAPVDQS----YFKLTLAGMAI 415
            I+  K T PV+L+F  +LF           +  T ++VA   ++    YF L L  + +
Sbjct: 405 AITYLKYTFPVMLMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLM 464

Query: 416 LGVGLDTS-----FPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLC 458
           +   L  +     FP   + +S+ LP   Q +  S+ L + N  +S+C
Sbjct: 465 INFPLALTIGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISIC 512

>TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432
          Length = 649

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 15/83 (18%)

Query: 104 LISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTL--- 160
           L+S  + D  G K +L   ++  I+W + CG    S     L++ R   G+GI F +   
Sbjct: 83  LLSPSVSDALGRKCSL---HVSCILWCIGCGIQSGSTGVAMLVVGRVIAGVGIGFGVAAA 139

Query: 161 ---------PNVVGTIGNIYHVG 174
                    P V GT+  I+ + 
Sbjct: 140 PMYCVELAPPRVRGTVVGIFQLA 162

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
           YLL048C (REAL)
          Length = 1661

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 2/35 (5%)

Query: 315 MIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPV 349
           +I+TIFT+   + +Y IW  YY+  VL+L+  +P+
Sbjct: 35  LILTIFTVL--FVTYNIWKHYYYYNVLHLKQKNPI 67

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 58/138 (42%), Gaps = 11/138 (7%)

Query: 25  EKCEVIVREKSKWQDP--GYFKN-----SFQEYLFVGSCMTTQLLNQATTPQTLSIMNVL 77
           E   VIV ++S  QD   G+  +      F+ Y  +GS      L         + + V+
Sbjct: 9   ESMGVIVEDRSSAQDESSGHVGDPQPLSGFKLYANMGSLTLVLFLAALDILIMSASIEVI 68

Query: 78  SDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTY 137
           S+ FN   S   W+V+ + L      L+ GR   I+G K +L+   +     SLI   + 
Sbjct: 69  SEQFND-YSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLI---SA 124

Query: 138 YSKSDTFLIIARAFQGLG 155
            S S   LI  R   G+G
Sbjct: 125 VSNSMNVLIGGRVVAGIG 142

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 3/66 (4%)

Query: 90  WLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLIIAR 149
           W+  S+ L +  F  + G++ DI+G K  LI   +      +ICG    S S   L+  R
Sbjct: 436 WVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGM---SNSLNMLVWGR 492

Query: 150 AFQGLG 155
              G+G
Sbjct: 493 FVAGIG 498

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 87/226 (38%), Gaps = 28/226 (12%)

Query: 234 PSNIPTNVNG--FKMDWIGSALIVTGLILF---------NFAWNQGPIVGWDXXXXXXXX 282
           P N+   +N   FK D+ G AL  TGL+LF          + W+ G ++ +         
Sbjct: 249 PGNLRKAINCLIFKFDFFGFALSSTGLVLFLLGLTFGGNKYTWSSGQVITYLVLGIVLFI 308

Query: 283 XXXXXXXXXXXTY---EINFAPSPLIAREITHSRNMIITIFTLFL---GWGSYGIWSFYY 336
                       +     N +  PL  R +     +II     FL   G+    I+S  +
Sbjct: 309 FSLVYDFFLFDKFNPERDNISYRPLFLRRLVAKPAIIIVNMVTFLLCTGYNGQMIYSVQF 368

Query: 337 FSFVLNLRHYSPVWAGGSYFI-FGIFGVLASAFVGISIKKI-TAPVILLFSMVLFCVGTT 394
           F  +      S  W  G + I   I  V+A+   GI  KK+     +L+F   L  +G  
Sbjct: 369 FQLIFA----SSAWKAGLHLIPIVITNVIAAIASGIITKKLGLVKPLLIFGGFLGVIGAG 424

Query: 395 LLSVAPVDQSYFK----LTLAGMAILGVGLDTSFPAATIILSDGLP 436
           L+++   + +       L L G + LG  L  S  +A + ++   P
Sbjct: 425 LMTLMKNNSTSSTQIGVLILPGFS-LGFALQASLMSAQLQINKDRP 469

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 58/138 (42%), Gaps = 11/138 (7%)

Query: 25  EKCEVIVREKSKWQDP--GYFKN-----SFQEYLFVGSCMTTQLLNQATTPQTLSIMNVL 77
           E   VIV ++S  QD   G+  +      F+ Y  +GS      L         + + V+
Sbjct: 9   ESMGVIVEDRSSAQDESSGHVGDPQPLSGFKLYANMGSLTLVLFLAALDILIMSASIEVI 68

Query: 78  SDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTY 137
           S+ FN   S   W+V+ + L      L+ GR   I+G K +L+   +     SLI   + 
Sbjct: 69  SEQFND-YSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLI---SA 124

Query: 138 YSKSDTFLIIARAFQGLG 155
            S S   LI  R   G+G
Sbjct: 125 VSNSMNVLIGGRVVAGIG 142

>NCAS0F04060 Chr6 (809459..811291) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 53/108 (49%), Gaps = 3/108 (2%)

Query: 344 RHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQ 403
            ++S V  G    IF I G+     +G    +I   + L+  +V+F VG  ++ +A +D+
Sbjct: 145 HYFSNVRTGLVVSIFNIGGLFGCLILGDLANRIGRKMALVAVVVIFMVGI-IIQIASIDK 203

Query: 404 SYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMV 451
            Y       ++ LGVG  + F  + ++LS+  P   +G  GS+   MV
Sbjct: 204 WYQYFIGRIISGLGVGAISIF--SPMLLSEVAPKHLRGTLGSMYQLMV 249

>NCAS0I03210 Chr9 (600725..602431) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 53/108 (49%), Gaps = 3/108 (2%)

Query: 344 RHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQ 403
            ++S V  G    IF I G+     +G    +I   + L+  +V+F VG  ++ +A +D+
Sbjct: 103 HYFSNVRTGLVVSIFNIGGLFGCLILGDLANRIGRKMALVAVVVIFMVGI-IIQIASIDK 161

Query: 404 SYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMV 451
            Y       ++ LGVG  + F  + ++LS+  P   +G  GS+   MV
Sbjct: 162 WYQYFIGRIISGLGVGAISIF--SPMLLSEVAPKHLRGTLGSMYQLMV 207

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 49/243 (20%), Positives = 94/243 (38%), Gaps = 16/243 (6%)

Query: 1   MAESRTSSIKEHIQSDISIDKSSNEKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQ 60
           ++++ T  I+  ++S+ S   S ++K +   +  ++   P    +  Q++  V       
Sbjct: 52  LSKATTREIEGDLESETS-SHSGDDKIDPQQQITAETGAPYTLLSYGQKWGMVAILTMCG 110

Query: 61  LLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLI 120
             +   +P     +  L   FN   +     V  + L  G    ISG + D +G +  ++
Sbjct: 111 FWSSLGSPIYYPALRQLEKQFNVDENMINITVVVYLLFQGVSPTISGGLADCFGRRPIIL 170

Query: 121 GGYIFLIIWS--LICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRK 178
            G +  ++ S  L C  +Y       +I  R  Q +GI+ T+    G +G+     +L+ 
Sbjct: 171 AGMLIYVVASIGLACAPSY-----GVIIFLRCIQSIGISPTIAISSGVVGDF----TLKH 221

Query: 179 NMVISLIAASAPVXXXXXXXXXXLIVTESPSQWPWS--FYAFAIACSFNLLISIYSIPSN 236
                + A S  V          LI     ++W W   F+   I C    LI+   +P  
Sbjct: 222 ERGTFVGATSGFV--LLGQCFGSLIGAVLTARWDWRSIFWFLTIGCGSCFLIAFLVLPET 279

Query: 237 IPT 239
             T
Sbjct: 280 KRT 282

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 4/84 (4%)

Query: 72  SIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSL 131
           +IM  ++  FN   S   WLV  + L      L+ GR G + G K +++   +   + SL
Sbjct: 97  TIMETVAAKFNG-YSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSL 155

Query: 132 ICGFTYYSKSDTFLIIARAFQGLG 155
           I      + S T LI  R   G+G
Sbjct: 156 IAA---AATSMTMLIGGRVISGIG 176

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,922,438
Number of extensions: 1871297
Number of successful extensions: 6584
Number of sequences better than 10.0: 159
Number of HSP's gapped: 6660
Number of HSP's successfully gapped: 168
Length of query: 520
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 406
Effective length of database: 40,409,475
Effective search space: 16406246850
Effective search space used: 16406246850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)