Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A028308.842ON50750726550.0
YML115C (VAN1)8.842ON53550718560.0
Suva_13.288.842ON53050418420.0
KNAG0G034208.842ON51148918200.0
NCAS0B003008.842ON52349918180.0
Skud_13.268.842ON53941518120.0
NDAI0E002908.842ON52249317910.0
Smik_13.198.842ON53641417900.0
ZYRO0G14234g8.842ON50947917710.0
SAKL0D01430g8.842ON44745017220.0
TDEL0B005608.842ON50946517080.0
KLLA0D01529g8.842ON50148916510.0
Kpol_541.158.842ON49850816480.0
TBLA0B032708.842ON52042016080.0
KLTH0C03828g8.842ON40440615830.0
CAGL0B02321g8.842ON51249715670.0
Ecym_46138.842ON52449915560.0
TPHA0C047808.842ON52550515480.0
ABL124W8.842ON48542315000.0
Kwal_27.102468.842ON33933913660.0
NCAS0G041101.479ON4943619971e-130
CAGL0L01331g1.479ON4473619901e-129
Smik_5.571.479ON4913539871e-128
Kwal_27.101571.479ON4763619851e-128
KLTH0C03432g1.479ON4893619861e-128
YEL036C (ANP1)1.479ON5003549871e-128
Ecym_35731.479ON4473619791e-128
Skud_5.541.479ON4913539781e-127
Suva_5.331.479ON4953539781e-127
NDAI0G003401.479ON5043609781e-127
SAKL0D11792g1.479ON4833619761e-127
KNAG0I003001.479ON4573639671e-126
KAFR0I027701.479ON4553619621e-125
TBLA0B021701.479ON5723619621e-123
NDAI0B012501.479ON4463619501e-123
Kpol_370.51.479ON6453539651e-123
TPHA0O004301.479ON5483539561e-123
KLLA0E22155g1.479ON4503619411e-122
TDEL0C026001.479ON4623629411e-122
AFR357W1.479ON4343629311e-121
ZYRO0F05170g1.479ON6083549301e-118
KLLA0E12849g8.500ON3923564261e-46
KLTH0E11616g8.500ON3943674252e-46
TBLA0H033408.500ON3933704208e-46
SAKL0H11110g8.500ON3933704191e-45
KNAG0A021508.500ON3963564191e-45
Smik_16.1868.500ON3953534182e-45
TPHA0L013708.500ON3924544155e-45
NCAS0C023308.500ON3933674145e-45
NDAI0E030208.500ON3963524146e-45
Kwal_27.118648.500ON4533464132e-44
Kpol_1031.788.500ON3923694093e-44
Skud_16.2328.500ON3953564084e-44
TDEL0B013708.500ON3963704085e-44
KAFR0H013908.500ON3983554077e-44
YPL050C (MNN9)8.500ON3953564067e-44
Suva_16.2658.500ON3953564051e-43
ZYRO0F08492g8.500ON3963574014e-43
CAGL0L12804g8.500ON3933513944e-42
Ecym_25508.500ON3903483874e-41
NCAS0B024408.500ON4003603752e-39
AGL259C8.500ON3893483639e-38
NDAI0C052508.500ON4023483366e-34
KNAG0A039908.500ON3573382192e-18
SAKL0H20438gsingletonON5652081261e-06
NDAI0B044352.120ON238109722.1
KAFR0C052605.503ON99075742.3
TPHA0J024506.229ON149059724.1
KNAG0E023502.439ON53269714.3
KLLA0D16093g7.190ON12241674.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A02830
         (507 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...  1027   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   719   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   714   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   705   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   704   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   702   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   694   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   694   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   686   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   667   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   662   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   640   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   639   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   624   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   614   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   608   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   603   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   600   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   582   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   530   0.0  
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    388   e-130
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   385   e-129
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   384   e-128
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   384   e-128
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   384   e-128
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   384   e-128
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   381   e-128
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   381   e-127
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   381   e-127
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   381   e-127
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   380   e-127
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   377   e-126
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   375   e-125
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   375   e-123
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   370   e-123
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   376   e-123
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   372   e-123
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   367   e-122
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   367   e-122
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   363   e-121
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   362   e-118
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   168   1e-46
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   168   2e-46
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   166   8e-46
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   166   1e-45
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   166   1e-45
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   165   2e-45
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   164   5e-45
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   164   5e-45
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   164   6e-45
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   163   2e-44
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   162   3e-44
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   161   4e-44
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   161   5e-44
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   161   7e-44
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   160   7e-44
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   160   1e-43
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   159   4e-43
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   156   4e-42
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   153   4e-41
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   149   2e-39
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   144   9e-38
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   134   6e-34
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    89   2e-18
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    53   1e-06
NDAI0B04435 Chr2 complement(1112119..1112835) [717 bp, 238 aa] {...    32   2.1  
KAFR0C05260 Chr3 complement(1053681..1056653) [2973 bp, 990 aa] ...    33   2.3  
TPHA0J02450 Chr10 (539862..544334) [4473 bp, 1490 aa] {ON} Anc_6...    32   4.1  
KNAG0E02350 Chr5 (468554..470152) [1599 bp, 532 aa] {ON} Anc_2.4...    32   4.3  
KLLA0D16093g Chr4 complement(1356056..1356424) [369 bp, 122 aa] ...    30   4.7  

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score = 1027 bits (2655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/507 (97%), Positives = 495/507 (97%)

Query: 1   MEFVRNLKRLSYKKGSVGGLPRTNSLYETDSEKKLNFTPKNRKRRLNYAKIIFGFFVSFL 60
           MEFVRNLKRLSYKKGSVGGLPRTNSLYETDSEKKLNFTPKNRKRRLNYAKIIFGFFVSFL
Sbjct: 1   MEFVRNLKRLSYKKGSVGGLPRTNSLYETDSEKKLNFTPKNRKRRLNYAKIIFGFFVSFL 60

Query: 61  ILFLMLNFEFNASKLNKTIIDIAQKTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLIS 120
           ILFLMLNFEFNASKLNKTIIDIAQKTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLIS
Sbjct: 61  ILFLMLNFEFNASKLNKTIIDIAQKTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLIS 120

Query: 121 QFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHV 180
           QFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHV
Sbjct: 121 QFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHV 180

Query: 181 LPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFT 240
           LPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFT
Sbjct: 181 LPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFT 240

Query: 241 KEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDR 300
           KEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDR
Sbjct: 241 KEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDR 300

Query: 301 HAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVP 360
           HAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVP
Sbjct: 301 HAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVP 360

Query: 361 NVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDP 420
           NVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDP
Sbjct: 361 NVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDP 420

Query: 421 QGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLP 480
           QGNP            SILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLP
Sbjct: 421 QGNPDEVVDIDGVGGVSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLP 480

Query: 481 HYTLWHIYEPSDDDLKEMANKEREERR 507
           HYTLWHIYEPSDDDLKEMANKEREERR
Sbjct: 481 HYTLWHIYEPSDDDLKEMANKEREERR 507

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/507 (67%), Positives = 402/507 (79%), Gaps = 12/507 (2%)

Query: 13  KKGSVGGLPRTNSLYETDSEK-KLNFTPKNRKRRLNYAKIIFGFFV-SFLILFLMLNF-- 68
           + GS   +    S + ++S K K  + P++   +      I    + + L L+L ++F  
Sbjct: 26  RNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKFQLTVSITSLIIIAVLSLYLFISFLS 85

Query: 69  --------EFNASKLNKTIIDIAQKTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLIS 120
                   +   S L  +      KTI+L D+EYY++DFEDIDP VI KFD G QHYLIS
Sbjct: 86  GMGIGVSTQNGRSLLGSSKSSENYKTIDLEDEEYYDYDFEDIDPEVISKFDDGVQHYLIS 145

Query: 121 QFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHV 180
           QFG++VLTP+D E Y+RE+NML+DST+E YDL +F G PNG E RDH+LLCIPLR+A+ V
Sbjct: 146 QFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNFEGAPNGLETRDHILLCIPLRNAADV 205

Query: 181 LPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFT 240
           LPLMF+HLMNLTYPHELIDLAFLVSDCSE D TLDALI +S++LQNGTLSQ+  EIDA  
Sbjct: 206 LPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVI 265

Query: 241 KEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDR 300
             +T     L+LKYMD  Y+ RV +AFSPPFHE+YDKPFRSVQIF+K+FGQ+IGQGFSDR
Sbjct: 266 DSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDR 325

Query: 301 HAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVP 360
           HAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDAD+ELCPGSVI+DLM+K+YDVIVP
Sbjct: 326 HAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVP 385

Query: 361 NVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDP 420
           NVWRPLP FL  EQPYDLNSW ES EAL LA+TLDEDDVIVEGYAEYPTWRVHLAYIRD 
Sbjct: 386 NVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDA 445

Query: 421 QGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLP 480
           +G+P            SILAKAK+FR+GVQFPAFTFENHAETEAFGKMAKKMGY+VGGLP
Sbjct: 446 EGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLP 505

Query: 481 HYTLWHIYEPSDDDLKEMANKEREERR 507
           HYT+WHIYEPSDDDLKE+A++ERE+RR
Sbjct: 506 HYTIWHIYEPSDDDLKEIASREREKRR 532

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/504 (67%), Positives = 400/504 (79%), Gaps = 10/504 (1%)

Query: 13  KKGSVGGLPRTNSLYETDSEK-KLNFTPKNRKRRLNYA-KIIFGFFVSFLILFLMLNFEF 70
           + GS        S +E+ S K K  + P++   +   A  +I    +  L L+LM+ F  
Sbjct: 26  RNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKFQLAVNVISLVIIIVLSLYLMILF-L 84

Query: 71  NASKLNKTIIDIAQ-------KTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFG 123
           +  KL  +I +          KTI+L D+EYYN+DFEDIDP V+ KFD G QHYLI+QFG
Sbjct: 85  SEMKLGISIQNGNPLLGSENYKTIDLEDEEYYNYDFEDIDPEVVSKFDDGVQHYLITQFG 144

Query: 124 TDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPL 183
           ++VLTP D E Y+ EM+ML DST+E YDL +F G PNG E RDH+LLCIPLR+A+ VLPL
Sbjct: 145 SEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLETRDHILLCIPLRNAADVLPL 204

Query: 184 MFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEE 243
           MF+HLMNLTYPHELIDLAFLVSDCSE D TLDALI +S+ LQNGTLS++  EIDA    +
Sbjct: 205 MFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTLSEIFQEIDAVIDSQ 264

Query: 244 TSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAV 303
           T     L+LKYMD +Y+ RV +AFSPPFH++YDKPFRSVQ+F+K+FGQ+IGQGFSDRHAV
Sbjct: 265 TKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQVFQKDFGQVIGQGFSDRHAV 324

Query: 304 KVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVW 363
           KVQGIRRKLMGRARNWLTANALKPYHSWVYWRDAD+ELCPGSVI+DLM+K+YDVIVPNVW
Sbjct: 325 KVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVW 384

Query: 364 RPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGN 423
           RPLP FL+ EQPYDLNSW ES EAL LA+TLDEDDVIVEGYAEYPTWRVHLAYIRD  G+
Sbjct: 385 RPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAGGD 444

Query: 424 PXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYT 483
           P            SILAKAK+FR+GVQFPAFTFENHAETEAFGKMAKKMGY+VGGLPHYT
Sbjct: 445 PNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYT 504

Query: 484 LWHIYEPSDDDLKEMANKEREERR 507
           +WHIYEPSDDDLKE+A +ERE+RR
Sbjct: 505 IWHIYEPSDDDLKEIATREREKRR 528

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/489 (68%), Positives = 396/489 (80%), Gaps = 11/489 (2%)

Query: 29  TDSEKKLNFTPKNRKRRLNYAKIIFGFFVSFLIL--FLMLNFEFNASKLNKTIIDIAQ-- 84
           T   K   F PK RKR+     I     V F+ +    +  +    + +NK +  +    
Sbjct: 23  TKDNKTAKFVPK-RKRQTLLRLISLLGLVVFVAVSTVSLSRYLRGPASINKILKKLESGN 81

Query: 85  ---KTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNM 141
              KT+NL + EYYN+DFE +DP VI KFDQG QHYLIS+FG DVLTP+DQE YE E+  
Sbjct: 82  HNYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQ 141

Query: 142 LYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLA 201
           L+DST++ YDL +F G+P+G  NRDHVL+C+PLRDA  VLPLMF+HLMNLTYPHELID+A
Sbjct: 142 LFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVA 201

Query: 202 FLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFT---KEETSTKSNLHLKYMDPE 258
           FLVSDCS++DNTL+ALI +S+ LQNGTLSQ+  E+DA T     +    + L+LKYM  E
Sbjct: 202 FLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQE 261

Query: 259 YLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARN 318
           YL +V+KAF+PP+HE+YDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGR+RN
Sbjct: 262 YLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRN 321

Query: 319 WLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDL 378
           WLTANALKPYHSWVYWRDADIELCPGSVI+D+MAKDYDV+VPNVWRPLP FL+GEQPYDL
Sbjct: 322 WLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDL 381

Query: 379 NSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSI 438
           NSW ES EAL+LA+TLDEDDVIVEGYAEYPTWRVHLAYIRD +G+P            SI
Sbjct: 382 NSWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSI 441

Query: 439 LAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEM 498
           LA+AKLFR+GVQFPAFTFENHAETEAFGKMA+K+G++VGGLPHYTLWHIYEPSDDDL+E+
Sbjct: 442 LARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREI 501

Query: 499 ANKEREERR 507
           ANKERE+RR
Sbjct: 502 ANKEREKRR 510

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/499 (67%), Positives = 395/499 (79%), Gaps = 14/499 (2%)

Query: 22  RTNSLYETDSEKKLNFTPKNRKRRLNYAKI-IFGFFVSFLILFLMLNFEFNASKLNK-TI 79
           R NS Y  + +KK +F PK RK   +  K+ +F   +  + +F   +     SK +  T 
Sbjct: 25  RNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLLIIIVYIFWGSSLTEMTSKYDSVTN 84

Query: 80  IDIAQ-------KTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQ 132
           +   Q       KT  L++ EYY+ DFEDI+P V++KFD G QHYLISQ+GTDVLTP D 
Sbjct: 85  LHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFDNGVQHYLISQYGTDVLTPSDN 144

Query: 133 EIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLT 192
           E+Y +E+ M+ D+++E YDL  F G+ NGA NRDH+LLC+PLRDA HVLPLMF+HLMNLT
Sbjct: 145 EVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLCVPLRDAEHVLPLMFKHLMNLT 204

Query: 193 YPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAF----TKEETSTKS 248
           YPHELIDLAFLVSDCSE D TLDAL+ +SK+LQNGTLSQV  E+D +    +K+   TK 
Sbjct: 205 YPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQVFTEMDQYEMDHSKKSKGTK- 263

Query: 249 NLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGI 308
           NLHLKYM+P+YLK V  +F    H +YDKPFRS+Q+F+K+FGQIIGQGFSDRHAVKVQGI
Sbjct: 264 NLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKDFGQIIGQGFSDRHAVKVQGI 323

Query: 309 RRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPA 368
           RRKLMGRARNWL ANALKPYH+WVYWRDADIELCPGSVIEDLM+KDYDVIVPNVWRPLP 
Sbjct: 324 RRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIEDLMSKDYDVIVPNVWRPLPE 383

Query: 369 FLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXX 428
           FL GEQPYDLNSW ES EALKLA+TLDEDDVIVEGYAEYPTWRVHLAYIRD  G+P    
Sbjct: 384 FLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAAGDPNEVV 443

Query: 429 XXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIY 488
                   SILAKAK+FRSGVQFPAFTFENHAETEAFGKMA+KMG++VGGLPHYT+WHIY
Sbjct: 444 DLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKMARKMGFRVGGLPHYTIWHIY 503

Query: 489 EPSDDDLKEMANKEREERR 507
           EPSDDDL E+ANKER+ +R
Sbjct: 504 EPSDDDLMEIANKERQNKR 522

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/415 (77%), Positives = 364/415 (87%)

Query: 85  KTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYD 144
           KTI+L D+EYYN+DFEDIDP VI KFD G QHYLISQFG++VL PE++E Y++E+NML D
Sbjct: 110 KTIDLEDEEYYNYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLD 169

Query: 145 STIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLV 204
           ST+E YDL DF G PNG E RDH+LLCIPLR+A+ VLPLMF+HLMNLTYPHELIDLAFLV
Sbjct: 170 STVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLV 229

Query: 205 SDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQ 264
           SDCSE D TLDALI +S+ LQNGTLSQ+  +IDA    +T     L+LKYMD +Y+ RV 
Sbjct: 230 SDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVH 289

Query: 265 KAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 324
           +AFSPPFH++YDKPFRSVQIF+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANA
Sbjct: 290 QAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 349

Query: 325 LKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRES 384
           LKPYHSWVYWRDAD+ELCPGSVIEDLM+K+YDV+VPNVWRPLP FL+ EQ YDLNSW ES
Sbjct: 350 LKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMES 409

Query: 385 AEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKL 444
            EAL+LA+TLDEDDVIVEGYAEYPTWRVHLAYIRD +GNP            SILAKAK+
Sbjct: 410 REALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKI 469

Query: 445 FRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMA 499
           FR+GVQFPAFTFENHAETEAFGKMAKKMGY+VGGLPHYT+WHIYEPSDDDLKE+A
Sbjct: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/493 (67%), Positives = 393/493 (79%), Gaps = 18/493 (3%)

Query: 29  TDSEKKLNFTPKNRKRRLNYAKIIFGFFVSFLILFLML---NFEFNAS----KLN----- 76
            D  KK  F PK +    N A    G  VSF+I  L+    ++ FN S    K+N     
Sbjct: 30  ADELKKQRFIPKKKSTAKNVA---IGSVVSFIICALIYCGYSYFFNTSPRLGKINLYANK 86

Query: 77  KTIIDIAQKTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYE 136
              +  + KT  LSD+EYYN+DFE+I+  V+ KF+ G QHYLIS+FGTDVLTP+D+E YE
Sbjct: 87  NNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYE 146

Query: 137 REMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHE 196
           +E+ ML D+++E YDL+ F G+ NGAENRDH+LLC+PLRDA  VLPLMF+HLMN+TYPHE
Sbjct: 147 KELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHE 206

Query: 197 LIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKE---ETSTKSNLHLK 253
           LIDLAFLVSDCS+ DNTL+AL+++S++LQNGTLSQV  ++D +  E   +T    NLHLK
Sbjct: 207 LIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLK 266

Query: 254 YMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLM 313
           YM+ EYLK V+ AF+ P HE+YDKPFRSVQIF K+FGQ+IGQGFSDRHAVKVQGIRRKLM
Sbjct: 267 YMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLM 326

Query: 314 GRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGE 373
           GRARNWL ANALKPYHSWVYWRDADIELCPG+++ED+MA DYDV+VPNVWRPLP FL  E
Sbjct: 327 GRARNWLMANALKPYHSWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSE 386

Query: 374 QPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXX 433
           QPYDLNSW ES EALKLA+TL EDDVIVEGYAEYPTWRVHLAYIR+ QG+P         
Sbjct: 387 QPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDGV 446

Query: 434 XXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDD 493
              SILAKAKLFRSGV FPAFTFENHAETE FGKMAK+MGY+VGGLPHYT+WHIYEPSDD
Sbjct: 447 GGVSILAKAKLFRSGVHFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDD 506

Query: 494 DLKEMANKEREER 506
           DLKE+ANKER+ R
Sbjct: 507 DLKEIANKERQSR 519

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/414 (76%), Positives = 360/414 (86%)

Query: 85  KTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYD 144
           KTI+L D+EYY++DFEDIDP V+ KFD G +HYLISQFG+DVLTP+D E Y+ E++ML D
Sbjct: 110 KTIDLEDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLD 169

Query: 145 STIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLV 204
           ST+E YDL  F G  NG E RDH+LLC+PLR+A+ VLPLMF+HLMNLTYPHELIDLAFLV
Sbjct: 170 STVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLV 229

Query: 205 SDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQ 264
           SDCSE+D TLDALI +S+ LQNGTLSQ+  EIDA    +T     L+L+YMD  Y+ RV+
Sbjct: 230 SDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVR 289

Query: 265 KAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 324
           +AFSPPFHE+YDKPFRSVQIF+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANA
Sbjct: 290 QAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 349

Query: 325 LKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRES 384
           LKPYHSWVYWRDAD+ELCPGS+I+DLM+K+YDVIVPNVWRPLP FL  EQPYDLNSW ES
Sbjct: 350 LKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMES 409

Query: 385 AEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKL 444
            E L+LA+TLDEDDVIVEGYAEYPTWRVHLAYIRD +G+P            SILAKAKL
Sbjct: 410 KEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKL 469

Query: 445 FRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEM 498
           FR+GVQFPAFTFENHAETEAFGKMAKKMGY+VGGLPHYT+WHIYEPSDDDLKE+
Sbjct: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/479 (67%), Positives = 380/479 (79%), Gaps = 8/479 (1%)

Query: 37  FTPKNRKRRLNYAKIIFGFFVSFLILFLMLNFEFNASKLNKTIIDIAQKTIN-----LSD 91
            +PK ++      KI+    ++ ++L L   F        + +  +   T +     L +
Sbjct: 30  LSPKGKRSSWQNRKIVSWVIITVMVLILYKAFSGVVRGGREVMKTVGSNTSSNDGQVLEE 89

Query: 92  QEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIETYD 151
             YY++DFEDIDP VI+KFD G QHYLI+QFG DVLTP+D E++ERE  ML  ST+E+YD
Sbjct: 90  DAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYD 149

Query: 152 LQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSEND 211
           L  F G+ NGA N +HVLLC+PLRDA  VLPLMF+HLMNLTYPHELIDLAFLVSDC+E+D
Sbjct: 150 LSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDD 209

Query: 212 NTLDALIEFSKNLQNGTLSQVLNEIDAFTKEE---TSTKSNLHLKYMDPEYLKRVQKAFS 268
            TLDALI +S+ LQ+GTLSQV  ++D    E    +     L+LKYM+P+YL+ V+++FS
Sbjct: 210 KTLDALIAYSRQLQSGTLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPDYLETVKESFS 269

Query: 269 PPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY 328
           PPFHE+YDKPFRSVQ+F+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY
Sbjct: 270 PPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPY 329

Query: 329 HSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEAL 388
           HSWVYWRDAD+ELCPGSVIEDLM+KDYDV VPNVWRPLP FL GEQPYDLNSW ES EAL
Sbjct: 330 HSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEAL 389

Query: 389 KLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFRSG 448
            LA+TLDEDDVIVEGYAEYPT+RVHLAYIRDP  +P            SILAKA+LFR G
Sbjct: 390 NLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRG 449

Query: 449 VQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREERR 507
           +QFPAFTFENHAETE FGKMAKKMGY+VGGLPHYTLWHIYEPSDDDL+E+ANKERE RR
Sbjct: 450 IQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRR 508

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/450 (70%), Positives = 367/450 (81%), Gaps = 7/450 (1%)

Query: 59  FLILFLMLNFEFNASKLNKTIIDIAQKTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYL 118
            LI+F +LN              +  KT +L D EYYN+DF++ID  +IQK+D+GA+H+L
Sbjct: 3   ILIIFFLLNSILGGDPY------VNYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFL 56

Query: 119 ISQFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDAS 178
           ISQ G +VLTPED E YE+E+ ML  +T++ YDL  + G+ NGAENRDHVLLC+PLR+A 
Sbjct: 57  ISQGGAEVLTPEDNERYEKEVEMLLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAG 116

Query: 179 HVLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDA 238
           +VLPLMF+HLMNLTYPHELIDLAFLVSDCSE+D+TLDALI +SK LQNGTLS++  E D 
Sbjct: 117 NVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDE 176

Query: 239 FTKEETSTKS-NLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGF 297
             ++ +   S +L+LKYM+ +YL  V+ AF PPFH+DYDKPFRSVQ+F+K+FGQ+IGQGF
Sbjct: 177 MRRKASIKGSPDLYLKYMNQDYLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGF 236

Query: 298 SDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDV 357
           SDRHAV VQGIRRKLMGRARNWLTANALKPYHSWVYWRD DIELCPGSVIEDLM+ + DV
Sbjct: 237 SDRHAVTVQGIRRKLMGRARNWLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDV 296

Query: 358 IVPNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYI 417
            VPNVWRPLP FL GEQ YDLNSW ES EALKLA TLDEDDVIVEGYAEYPTWRVHL YI
Sbjct: 297 AVPNVWRPLPEFLGGEQAYDLNSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYI 356

Query: 418 RDPQGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVG 477
           R+P  NP            SILAKAKLFR+GV FPAFTFENHAETEAFGKMAKKM Y+VG
Sbjct: 357 RNPDANPYEILDLDGVGGVSILAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVG 416

Query: 478 GLPHYTLWHIYEPSDDDLKEMANKEREERR 507
           GLPHYT+WHIYEPSDDDLKE+A KERE+RR
Sbjct: 417 GLPHYTVWHIYEPSDDDLKEIAKKEREKRR 446

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/465 (68%), Positives = 375/465 (80%)

Query: 43  KRRLNYAKIIFGFFVSFLILFLMLNFEFNASKLNKTIIDIAQKTINLSDQEYYNFDFEDI 102
           KR  N+A I    F+ F  L  ++     +S    +I   +  TI LSD+ YY++DFE+I
Sbjct: 44  KRIANWALISVICFLMFKFLSTVILGSSESSSPLPSIWTKSYDTITLSDEAYYDYDFENI 103

Query: 103 DPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGA 162
           DP VI+KFD G  +Y I+QFG + +T E+   +E+E++ML DST+E YD++ F G  N A
Sbjct: 104 DPDVIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAA 163

Query: 163 ENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSK 222
           EN++HVLLC+PLRDA +VLPLMF+HLMN+TYPHELIDLAFLVSDCSE D+TLDALI +S+
Sbjct: 164 ENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSR 223

Query: 223 NLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSV 282
            LQNGTLSQV  E++   KE      NL+L+YMD +YL+RV+ +FSPPFHE+YDK FRSV
Sbjct: 224 QLQNGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSV 283

Query: 283 QIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELC 342
           QIF+K+FGQ IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRDAD+ELC
Sbjct: 284 QIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELC 343

Query: 343 PGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVE 402
           PGSVI+DLMAKDYDV+VPNVWRPLP FL G+QPYDLNSW ES EAL LA+TLDEDDVIVE
Sbjct: 344 PGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVE 403

Query: 403 GYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAET 462
           GYAEYPTWR HLAY RD  G+P            SILA+A+LFR G+ FPAFTFENHAET
Sbjct: 404 GYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAET 463

Query: 463 EAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREERR 507
           EAFGKMAKKMG++VGGLPHYTLWHIYEPSDDDLKE+ NKERE+RR
Sbjct: 464 EAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRR 508

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/489 (63%), Positives = 379/489 (77%), Gaps = 18/489 (3%)

Query: 30  DSEKKLN-FTPKN-------RKRRLNYAK--IIFGFFVSFLILFLMLNFEFNASKLNKTI 79
           DS++K N F PK+       +   L YAK  I+F F +  +  FL+L      SKL    
Sbjct: 17  DSKQKGNHFRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTFLLL------SKLVGGN 70

Query: 80  IDIAQKT-INLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYERE 138
           +++ Q    +L +QEYY++DF+ +D   I+K+D+G  HY+IS+ G + L+ ED+E +ERE
Sbjct: 71  VNLMQYIPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFERE 130

Query: 139 MNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELI 198
            +ML  ST + YDL  + G  NGA NRDHVLLC+PLRDA+ +LP++F++LMNLTYPHELI
Sbjct: 131 ADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELI 190

Query: 199 DLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPE 258
           D+AFLVSDC++N  T+ +L++FSK LQNGTLS+ L + +A  K++ ++   L+LKYM  +
Sbjct: 191 DIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFEA-DKDKGNSAEQLYLKYMGKD 249

Query: 259 YLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARN 318
           YLK V+ AF+PPFH+DYDKPFRS+QIFEK+FGQ IGQGFSDRHAVKVQG+RRKLMGRARN
Sbjct: 250 YLKMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARN 309

Query: 319 WLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDL 378
           WLTANALKPYHSWVYWRD D+ELCPG+VIEDLM  DYDVIVPNVWRPLP FL G Q YDL
Sbjct: 310 WLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDL 369

Query: 379 NSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSI 438
           NSW ES EA+KLA+TLDEDDVIVEGYAEYPTWRVHL Y+R   GNP            SI
Sbjct: 370 NSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSI 429

Query: 439 LAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEM 498
           LA+A+LFR G+ FPAFTFENHAETEAFGKMAKKMG+KVGGL HYTLWHIYEPSDDDL+E+
Sbjct: 430 LARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREI 489

Query: 499 ANKEREERR 507
           A  ERE RR
Sbjct: 490 AKLERESRR 498

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/508 (61%), Positives = 392/508 (77%), Gaps = 12/508 (2%)

Query: 1   MEFVRNLKRLSYKKGSVGGLPRTNSLYETDSEKKLNFTPKNRKRRLNYAKIIFGFFVSFL 60
           M+F+ N KR   KK     LP ++S +   S+ +  F P N +  +    II       L
Sbjct: 1   MDFLLNNKRQLKKKDE---LPISDSRWAPKSKYRHKFNPANSENFVKINAIIT------L 51

Query: 61  ILFLMLNFEFNASKLNKTIIDIAQKTIN-LSDQEYYNFDFEDIDPTVIQKFDQGAQHYLI 119
           ILFL+   + + S  +  ++D        L D EYY++DF++ D  +++KFD GA+HYLI
Sbjct: 52  ILFLVFICQNSFSSSSSNVVDSHTNEAKILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLI 111

Query: 120 SQFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASH 179
           S++G++VLTPED+  YE+E+  L  +T++ YDL  + G  NG +NR+HVLLC+PLRDA  
Sbjct: 112 SKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAED 171

Query: 180 VLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAF 239
           VLPLMF+++MNLTYPHELIDLAFLVSDC+E D+TL++LI +S++LQ+GTL+ +  E+D  
Sbjct: 172 VLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMDKD 231

Query: 240 TKEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSD 299
             ++ S K  L+LKYM+ +YLK V+ A+SPPFH DY+KPFRSVQIF+K+FGQ +GQGF++
Sbjct: 232 DSKKDSEK--LYLKYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVGQGFTE 289

Query: 300 RHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIV 359
           RH+VKVQGIRRKLMGRARNWL  NALKPYH+WVYWRDAD+ELCPG+VIEDLM+K++DV+V
Sbjct: 290 RHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKNFDVMV 349

Query: 360 PNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRD 419
           PNVWRPLP FL+ EQPYDLNSW ES EALKLA+ LDEDDVIVEGYAEYPTWRVHLAYIR+
Sbjct: 350 PNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHLAYIRE 409

Query: 420 PQGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGL 479
             GNP            SIL KAKLFRSG+ FPAFTFENHAETEAFGKMAKKMG++VGGL
Sbjct: 410 KNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGFRVGGL 469

Query: 480 PHYTLWHIYEPSDDDLKEMANKEREERR 507
           PHYTLWHIYEPSDDDL E+A+KERE  R
Sbjct: 470 PHYTLWHIYEPSDDDLLEIASKERENNR 497

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/420 (70%), Positives = 339/420 (80%), Gaps = 3/420 (0%)

Query: 89  LSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIE 148
           L D EYY++DF  ID      FDQG QHYLI+Q+G DV+T +D+E Y +EM  L  S+++
Sbjct: 97  LEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVD 156

Query: 149 TYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCS 208
            YDL  F G  NGAENR+H+L   PLRDA HVLP+MF+HLMNLTYPHELID+AFLVSDCS
Sbjct: 157 KYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCS 216

Query: 209 ENDNTLDALIEFSKNLQNGTLSQVLNEIDA--FTKEETSTKSNLH-LKYMDPEYLKRVQK 265
           E D TLD LI F+++LQ+GTL  +  ++DA     E+ +   N H LK+MD  Y+K    
Sbjct: 217 EGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADA 276

Query: 266 AFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 325
           +F+ P H +Y+KPFRSVQIF+K+FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL
Sbjct: 277 SFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 336

Query: 326 KPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESA 385
           KPYHSWVYWRDAD+ELCPGSVI+DLM+K+YDVIVPNVWRPLP FL+ EQPYDLNSW ES 
Sbjct: 337 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESG 396

Query: 386 EALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLF 445
           EAL+LA+TLDEDDVIVEGYAEYPTWRVHLAY+RDP G+P            SILAKAKLF
Sbjct: 397 EALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLF 456

Query: 446 RSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREE 505
           R GV FPAFTFENHAETEAFGKMAKKMGY VGGLP+Y LWHIYEPSDDDLK+MA  ER E
Sbjct: 457 RHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERGE 516

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/406 (72%), Positives = 336/406 (82%), Gaps = 7/406 (1%)

Query: 106 VIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENR 165
           +++KFD GA+HYLIS+ G ++L   D+E YE E+  L DST+E YDL+DF G+  G  NR
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 166 DHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQ 225
           +HVLL +PLR+A  VLPLMF++LMNLTYPHELIDLAFLVSDCSE+D TL+AL+E+ K LQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 226 NGTLSQVLNEIDAFTKEETSTKS----NLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRS 281
           +GTLS V     A + +E   K     +L LKYM P YLK V+ A+SPPFH+ YDKPFRS
Sbjct: 121 SGTLSDVFA---AHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRS 177

Query: 282 VQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIEL 341
           VQIF+K+FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDAD+EL
Sbjct: 178 VQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL 237

Query: 342 CPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIV 401
           CPGSVI+DLM+ D+DV VPNVWRPLP FL GEQPYDLNSW ES  AL+LAQTLDEDDVIV
Sbjct: 238 CPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIV 297

Query: 402 EGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAE 461
           EGYAEYPTWRVHLAY+RDP  NP            SILAKAKLFR+GV FPAFTFENHAE
Sbjct: 298 EGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAE 357

Query: 462 TEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREERR 507
           TEAFGKMAKKMGY+V GLPHYTLWHIYEPSDDDL ++A +ERE++R
Sbjct: 358 TEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/497 (59%), Positives = 364/497 (73%), Gaps = 13/497 (2%)

Query: 13  KKGSVGGLPRTNSLYETDSEKKLNFTPKNRKRRLNYAKIIFG------FFVSFLILFLML 66
           K+G    LP + +  E    K   F  K  K+   + K+  G          FL+ F   
Sbjct: 21  KRGGEYSLPISRTGSEATLSKHDKFIAK--KKNFKFRKLATGAIIVIVIVSIFLVFF--- 75

Query: 67  NFEFNASKLNKTIIDIAQKTINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDV 126
           N E +   L  +            D  Y++FDFEDID  ++ KFDQG  +YLIS++GT+ 
Sbjct: 76  NIEVSPISLPSSFYHKEYLPFEFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTEN 135

Query: 127 LTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFR 186
            +  D   Y   + ML DST+E YDL +F G+ +G E ++H+L+C+PLRDA  VLPLMF+
Sbjct: 136 PSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFK 195

Query: 187 HLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETST 246
           +LMNLTYPHELIDLAFLVSDCSE D TL+AL  +S+ LQ G L  +L ++D + K +++ 
Sbjct: 196 NLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQEGILPDILADMDNYNKGKSN- 254

Query: 247 KSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQ 306
             ++HLKYM+P+YLKRV+ A+ PPFH +Y KPFRSVQIF+K+FGQ+IGQGFSDRHAVKVQ
Sbjct: 255 -ESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQ 313

Query: 307 GIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPL 366
           GIRRKLMGRARNWL +NALKPYHSWVYWRDAD+ELCPGSVIEDLM +DYDVIVPNVWRPL
Sbjct: 314 GIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPL 373

Query: 367 PAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXX 426
           P FL+  QPYDLNSW ES EAL+LA+TLDEDDVIVEGYAEYPT+RVHLAYIR+  G+P  
Sbjct: 374 PKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQ 433

Query: 427 XXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWH 486
                     SILA+A++FR GV F AFTFENHAETEAFGKMAKK+G++VGGLPHYTLWH
Sbjct: 434 VVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWH 493

Query: 487 IYEPSDDDLKEMANKER 503
           IYEPSDDDL  MA  E+
Sbjct: 494 IYEPSDDDLLAMAKLEK 510

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/499 (60%), Positives = 359/499 (71%), Gaps = 20/499 (4%)

Query: 20  LPRTNSLYETDSEKKLNFTPKNRKRRLNYA--KIIFGFFVSFLILFLM---LNFEFNASK 74
           L   NS Y    + K NF       RL+Y    +I        I FL+   ++   +  +
Sbjct: 34  LSPQNSRYHPKVKGKFNF-------RLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPR 86

Query: 75  LNKTIIDIAQK--TINLSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQ 132
               ++ I+    T  L + EYYNF++  +D   ++++D G +H LI Q GT  L    +
Sbjct: 87  SYAGLLSISDSYDTAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LNSNQE 144

Query: 133 EIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLT 192
           E +E  ++ML  +T+ETYDL  + G  NGAENR+HVL+C+PLR+A +VLPLMFRHLMNLT
Sbjct: 145 EGFEEHLDMLLSTTVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLT 204

Query: 193 YPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSN--- 249
           YPHELIDLAFLVSDCS++D+T+D+LI +++ LQ GTLS+ L   DA+   + S   N   
Sbjct: 205 YPHELIDLAFLVSDCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSKNKEG 264

Query: 250 -LHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGI 308
            LHLKYM+ +YL  V+ A   PFH++YDKPFRSVQIF+K+FGQIIGQGFSDRH VKVQG 
Sbjct: 265 DLHLKYMNKDYLNMVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGT 324

Query: 309 RRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPA 368
           RRKLMG+ARNWLTANALKPYHSWVYWRDAD+ELCPGSVIEDLM+  YDVIVPNVWRPLP 
Sbjct: 325 RRKLMGKARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPE 384

Query: 369 FLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXX 428
           FL  EQ YDLNSW ES  AL LA+TLDEDDVIVEGYAEY TWR HLA  RDPQGN     
Sbjct: 385 FLGSEQEYDLNSWIESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVL 444

Query: 429 XXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIY 488
                   SILAKAKLFR+GV F AF FENHAETEAFGKMAKKMGY+VGGL HYTLWHIY
Sbjct: 445 DLDGVGGVSILAKAKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIY 504

Query: 489 EPSDDDLKEMANKEREERR 507
           EPS+DDL E+A KER  RR
Sbjct: 505 EPSNDDLMEIARKERSSRR 523

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/505 (57%), Positives = 367/505 (72%), Gaps = 20/505 (3%)

Query: 20  LPRTNSLYETDSEKKLNFTPKNRKRRL-NYAKIIFGFFVSF----LILFLMLNFEFNAS- 73
           LP +    E    +     PK  K ++ N+   +  F V+     L +F+      N S 
Sbjct: 18  LPLSEKTKEKRKNRDFRLLPKYSKFKVTNFRDKVSNFNVALSVILLCIFIAKTISVNVSI 77

Query: 74  -KLNKTIIDIAQKTINLSDQ-----EYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTD-- 125
            K N  + +   +T+    Q     EYYN+DF D +   I K+D+G + YL+  + TD  
Sbjct: 78  YKYNSFVHEEETETVTFDTQVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDV 137

Query: 126 -VLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLM 184
             L+ + +E Y+ E+  L  S+++ YD++DF G  +G  +R+HVLLCIPLRDA  VLPLM
Sbjct: 138 SQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLM 197

Query: 185 FRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKE-- 242
           F++LMNLTYPHELID+AFLVSDCSEND+TL++L+++++ LQNGTL  V  E+D   +   
Sbjct: 198 FKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTD 257

Query: 243 ---ETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSD 299
              E +  S L+LKYM  EYL+RV++AF  PFHE+YDKPFRS+QI++K+FGQ +GQ FSD
Sbjct: 258 KVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSD 317

Query: 300 RHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIV 359
           RH VKVQGIRRKLMGRARNWL  NALKPYHSWVYWRDAD+ELCPG+VIEDLM+KD+DVIV
Sbjct: 318 RHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIV 377

Query: 360 PNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRD 419
           PNVWRPLP F++ EQPYDLNSW ES EA+ LA+ L ED+VIVEGYAEYPTWRVHLAY+R+
Sbjct: 378 PNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLRE 437

Query: 420 PQGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGL 479
             G+P            SILA+A+LFR+GV FPAFTFENHAETEAFGKMAKKMG++VGGL
Sbjct: 438 KDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGL 497

Query: 480 PHYTLWHIYEPSDDDLKEMANKERE 504
           PHYTLWHIYEPSDDDL  +A KE+E
Sbjct: 498 PHYTLWHIYEPSDDDLMAIATKEKE 522

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/423 (65%), Positives = 332/423 (78%), Gaps = 7/423 (1%)

Query: 89  LSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIE 148
           L D EYY+++F       + K+D+G +HY +++ G   ++ +D E +E +M  L  +T+E
Sbjct: 65  LDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ--ISRDDPE-FEEQMEELVSATVE 121

Query: 149 TYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCS 208
            YDL+++ G PNGAENR+HVL+CIPLR+A  VLP+MF+HLMNLTYPHELID+AFLVSDCS
Sbjct: 122 QYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCS 181

Query: 209 ENDNTLDALIEFSKNLQNGTLSQVLN----EIDAFTKEETSTKSNLHLKYMDPEYLKRVQ 264
           END TL +L+E++  LQ GTL+ VL     EI     +  +   +L+LKYMD EYL+ V+
Sbjct: 182 ENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVR 241

Query: 265 KAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 324
            AFSPP+HE+Y+KPFRSVQ+F+K+FGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANA
Sbjct: 242 DAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANA 301

Query: 325 LKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRES 384
           LKPYHSWVYWRD D+ELCPGSVIEDLM+  YDVIVPNVWRPLP FL G+Q YDLNSW ES
Sbjct: 302 LKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIES 361

Query: 385 AEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKL 444
            +AL LA+ L+EDDVIVEGYAEY TWR HL   R+ +GNP            SILAKAKL
Sbjct: 362 TDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKL 421

Query: 445 FRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKERE 504
           FR G  F AF FENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDD+ ++A +ERE
Sbjct: 422 FRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERE 481

Query: 505 ERR 507
            RR
Sbjct: 482 NRR 484

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/339 (74%), Positives = 283/339 (83%), Gaps = 5/339 (1%)

Query: 172 IPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQ 231
           +PLR+A  VLPLMF++LMNLTYPHELIDLAFLVSDCSE+D T +AL+E++K LQ+GTLSQ
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 232 VL---NEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKN 288
           V    N  +   +EE S  S+L LKYM P YLK V+ AF+PPFH++YDKPFRSVQIF+KN
Sbjct: 62  VFASHNSGENVLREEGS--SDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKN 119

Query: 289 FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIE 348
           FGQ+IGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDAD+ELCPGSVIE
Sbjct: 120 FGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIE 179

Query: 349 DLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYP 408
           DLMA  YDV VPNVWRPLP FLSGEQ YDLNSW ES  AL LA+ LDEDDVIVEGYAEYP
Sbjct: 180 DLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYP 239

Query: 409 TWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKM 468
           TWRVHL YIR+  G+P            SILAKA+LFR+GV FPAFTFENHAETEAFGKM
Sbjct: 240 TWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKM 299

Query: 469 AKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREERR 507
           AKKMGY V GLPHYTLWHIYEPSDDDL ++  +ERE +R
Sbjct: 300 AKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  388 bits (997), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/361 (53%), Positives = 233/361 (64%), Gaps = 47/361 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E YDL ++ GN +G +  D +L C+PLRDA+  LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S  DNT+  L+    NLQN    Q                                   
Sbjct: 142 SS--DNTMGVLL---SNLQNAQSQQ----------------------------------- 161

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                  D  K F +++IFEK+FGQIIGQ FSDRH  K QG RRKLM RARNWL + A+K
Sbjct: 162 -------DRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSVAIK 214

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 215 PYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 274

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            L+LA +LDED VIVEGY EY TWR HLAY+RDP GNP            SIL+KAK+FR
Sbjct: 275 GLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAKVFR 334

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREER 506
           SG  FPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS +DLK MA    EE+
Sbjct: 335 SGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMAEEEK 394

Query: 507 R 507
           R
Sbjct: 395 R 395

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  385 bits (990), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 192/361 (53%), Positives = 234/361 (64%), Gaps = 49/361 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E YDL D+ G P+G +  D +L C+PLRDA+  LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S  DNT+  L+                                        +L++ QK 
Sbjct: 114 SS--DNTMGVLMH---------------------------------------HLQQAQK- 131

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                  D +K F +++IFEK+FGQIIGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 132 -------DKNKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 184

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D+E+ P S++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 185 PYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEG 244

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            L+LA TL ED VIVEGY EY TWR HLAY+RDP GNP            SIL+KA++FR
Sbjct: 245 GLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKARVFR 304

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREER 506
           +G  FPAF+F+ HAETEAFGK++++MG+ V GLPHY +WHIYEPS DDLK MA    EE+
Sbjct: 305 AGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMAEEEK 364

Query: 507 R 507
           R
Sbjct: 365 R 365

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  384 bits (987), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 193/353 (54%), Positives = 231/353 (65%), Gaps = 47/353 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E YDL+++ GN +G +  D +L C+PLRDAS  LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S  DNT+  L+                             SNLH             KA
Sbjct: 122 SS--DNTMGVLL-----------------------------SNLH-------------KA 137

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
            S    +D  K F +++I+EK+FGQIIGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 138 QS---QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 195 PYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            L+LA  L+ED VIVEGY EY TWR HLAY+RDP GNP            SILAKAK+FR
Sbjct: 255 GLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMA 499
           +G  FPAF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS DDLK MA
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  384 bits (985), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 189/361 (52%), Positives = 234/361 (64%), Gaps = 47/361 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E YDL+++ GN +G +  D VL  +PLRDA+  LP+ F H+  ++YPH LIDL+FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S  D+T+  L++  K  Q+ T                                      
Sbjct: 113 SS--DDTMGVLLDHLKKAQSKT-------------------------------------- 132

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                  D  K F +++IFEK+FGQ IGQ FSDRH    QG RRKLMGRARNWL + ALK
Sbjct: 133 -------DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALK 185

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 186 PYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 245

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            ++LA++LDED VIVEGY EY TWR HLAY+RDP GNP            SIL+KAK+FR
Sbjct: 246 GMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAKVFR 305

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREER 506
           +G  FPAF+FE HAETEAFGK+++++GY V GLPHY +WHIYEPS DDLK MA    EE+
Sbjct: 306 AGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMAEEEK 365

Query: 507 R 507
           R
Sbjct: 366 R 366

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  384 bits (986), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 189/361 (52%), Positives = 238/361 (65%), Gaps = 47/361 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           ++ YDL+++ G+ +G +  DHVL  +PLRDA+  LP+ F H+  ++YPH LIDL+FLVSD
Sbjct: 53  VQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVSD 112

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S  D+T+  L+E+                                          +QKA
Sbjct: 113 SS--DDTMGVLLEY------------------------------------------LQKA 128

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
            S P   D  + F +++I+EK+FGQ IGQ FSDRH    QG RRKLMGRARNWL + ALK
Sbjct: 129 QSKP---DRTQRFGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALK 185

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 186 PYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 245

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            L+LA++LDED VIVEGY EY TWR HLAY+RDP G+P            SIL+KAK+FR
Sbjct: 246 GLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKAKVFR 305

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREER 506
           +G  FPAF+FE HAETEAFGK+++++GY V GLPHY +WHIYEPS DDLK MA    EE+
Sbjct: 306 AGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEK 365

Query: 507 R 507
           R
Sbjct: 366 R 366

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  384 bits (987), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 191/354 (53%), Positives = 229/354 (64%), Gaps = 47/354 (13%)

Query: 146 TIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVS 205
           ++E YDL+++ GN +G +  D +L C+PLRDAS  LP+ F HL  +TYPH LIDL+FLVS
Sbjct: 61  SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS 120

Query: 206 DCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQK 265
           D S  DNT+  L+    NLQ     Q                                  
Sbjct: 121 DSS--DNTMGVLL---SNLQMAQSQQ---------------------------------- 141

Query: 266 AFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 325
                   D  K F +++I+EK+FGQIIGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 142 --------DKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 326 KPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESA 385
           KPYHSWVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW+ES 
Sbjct: 194 KPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 386 EALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLF 445
             L+LA +LDED VIVEGY EY TWR HLAY+RDP GNP            SILAKAK+F
Sbjct: 254 GGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 446 RSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMA 499
           R+G  FPAF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS DDLK MA
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  381 bits (979), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 186/361 (51%), Positives = 234/361 (64%), Gaps = 47/361 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           ++ YDL ++ GN +G +  D VL C+PLRDA++ LP+ F+HL ++TYPH LIDL+FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            +  D+T+  L+    +LQ+                                        
Sbjct: 110 ST--DDTMGVLLNSLHDLQS---------------------------------------- 127

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                  D  K F  ++IF+K+FGQIIGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 128 -----QADGTKRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSAAIK 182

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D+E  P +++EDLM  D D+IVPNVWRPLP +L+  QPYDLNSW ES  
Sbjct: 183 PYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVESEG 242

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            L+LA +L EDDVIVEGY EY TWRVHLAY+RDP G+P            SIL+KAK+FR
Sbjct: 243 GLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAKVFR 302

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREER 506
           +G  FPAF+FE HAETEAFGK++++M Y V GLPHY +WH+YEPS DDLK MA    EE+
Sbjct: 303 TGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEQ 362

Query: 507 R 507
           R
Sbjct: 363 R 363

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 189/353 (53%), Positives = 228/353 (64%), Gaps = 47/353 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E YDL+++ GN +G +  D +L C+PLRDAS  LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S  DNT+  L                                          L  +Q A
Sbjct: 122 SS--DNTMGVL------------------------------------------LSSLQTA 137

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
            S    +D  K F +++I+EK+FGQIIGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 138 QS---QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D++  P +++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 195 PYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            L+LA  LDED VIVEGY EY TWR HLAY+RDP GNP            SILAKAK+FR
Sbjct: 255 GLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMA 499
           +G  FPAF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS DDLK MA
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 190/353 (53%), Positives = 229/353 (64%), Gaps = 47/353 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E YDL+++ GN +G +  D +L C+PLRDAS  LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S  DNT+  L                                          L ++Q A
Sbjct: 122 SS--DNTMGVL------------------------------------------LSKLQMA 137

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
            S    +D  K F +++I+EK+FGQIIGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 138 QS---QQDKTKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 195 PYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            L+LA  LDED VIVEGY EY TWR HLAY+RDP GNP            SILAKAK+FR
Sbjct: 255 GLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMA 499
           +G  FPAF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS DDLK MA
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 190/360 (52%), Positives = 229/360 (63%), Gaps = 47/360 (13%)

Query: 140 NMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELID 199
           N   +  +E YDL ++ GN +G +  D +L C+PLRDA+  LP+ F HL  ++YPH  ID
Sbjct: 80  NFRNNPGVEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSID 139

Query: 200 LAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEY 259
           L+FLVSD S  D+T+  L+    NLQN    Q                            
Sbjct: 140 LSFLVSDSS--DDTMGVLL---SNLQNAQSQQ---------------------------- 166

Query: 260 LKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNW 319
                         D  K F +++IFEK+FGQ+IGQ FSDRH    QG RRKLM RARNW
Sbjct: 167 --------------DKSKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNW 212

Query: 320 LTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLN 379
           L + A+KPYHSWVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP +L   QPYDLN
Sbjct: 213 LGSVAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLN 272

Query: 380 SWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSIL 439
           SW+ES   L+LA TL EDDVIVEGY EY TWR HLAY+RDP GNP            SIL
Sbjct: 273 SWKESEGGLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSIL 332

Query: 440 AKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMA 499
           AKAK+FR+G  FPAF+FE HAETEAFGK+++KM Y V GLPHY +WHIYEPS +DLK MA
Sbjct: 333 AKAKVFRTGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  380 bits (976), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 184/361 (50%), Positives = 233/361 (64%), Gaps = 47/361 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E YDL ++ GN +G +  D VL C+PLRDA+  LP+ F+H+  ++YPH LIDL+FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S  D+T+  L+   K  Q+                                        
Sbjct: 142 SS--DDTMGVLLSSLKKAQS---------------------------------------- 159

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                ++D  + F +++IFEK+FGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 160 -----NQDKSQRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 214

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D+E  P +++EDLM  + DVIVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 215 PYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 274

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            L+LA +L+ED VIVEGY EY TWR HLAY+RDP G+P            SIL+KAK+FR
Sbjct: 275 GLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKAKVFR 334

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREER 506
           +G  FPAF+FE HAETEAFGK++++M Y V GLPHY +WH+YEPS DDLK MA    EE+
Sbjct: 335 TGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEEK 394

Query: 507 R 507
           R
Sbjct: 395 R 395

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  377 bits (967), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 188/363 (51%), Positives = 233/363 (64%), Gaps = 47/363 (12%)

Query: 145 STIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLV 204
           +  E YDL+++ GN NG +  D +L C+PLRDA+  LP+ F+HL  +TYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 205 SDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQ 264
           SD    D+T+  L+    NLQ                                    + Q
Sbjct: 125 SDS--KDDTMGVLL---SNLQTA----------------------------------QSQ 145

Query: 265 KAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 324
           K        D  K F +++ FEK+FGQIIGQ FSDRH    QG RRKLM RARNWL + A
Sbjct: 146 K--------DRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVA 197

Query: 325 LKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRES 384
           +KPYHSWVYWRD D+E  P +++EDLM    DVIVPNVWRPLP +L   QPYDLNSW+ES
Sbjct: 198 IKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQES 257

Query: 385 AEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKL 444
              L+LA +LD+D VIVEGY EY TWR HLAY+RDP G+P            SIL+KA++
Sbjct: 258 DAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKARV 317

Query: 445 FRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKERE 504
           FRSG  FPAF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +DLK MA    E
Sbjct: 318 FRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWMAEE 377

Query: 505 ERR 507
           E+R
Sbjct: 378 EQR 380

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  375 bits (962), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 186/361 (51%), Positives = 233/361 (64%), Gaps = 47/361 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E YDL+++ GN +G +  D +L C+PLRDA+  LP+ F HL  +TYPH  IDL+FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S  D+T+  L+   ++ Q    SQ+                                  
Sbjct: 122 SS--DDTMGVLLSHLQSAQ----SQM---------------------------------- 141

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                  D  K F +++I+EK+FGQIIGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 142 -------DKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 194

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D+E  P +++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 195 PYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 254

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            L+LA+ L+ED VIVEGY EY TWR HLAY+RDP G+P            SIL+KAK+FR
Sbjct: 255 GLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFR 314

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREER 506
           +G  FPAF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS +DLK MA    EE+
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEEK 374

Query: 507 R 507
           R
Sbjct: 375 R 375

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  375 bits (962), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 189/361 (52%), Positives = 229/361 (63%), Gaps = 47/361 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +  YDL ++ GN +G +  D +L C+PLRDA+  LP  F HL  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
               D+T+  L+    +LQ     Q                            LKR    
Sbjct: 132 SK--DDTMGVLL---SHLQTAQSQQ--------------------------NKLKR---- 156

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                       F +++I+EK+FGQIIGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 157 ------------FGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 204

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D+E CP +++EDLM    DVIVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 205 PYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 264

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            L+LA +LDED VIVEGY EY TWR HLAY+RDP G+P            SIL+KAK+FR
Sbjct: 265 GLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFR 324

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREER 506
           SG  FPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DLK MA    EE+
Sbjct: 325 SGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMAEEEK 384

Query: 507 R 507
           R
Sbjct: 385 R 385

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  370 bits (950), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 183/361 (50%), Positives = 233/361 (64%), Gaps = 47/361 (13%)

Query: 146 TIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVS 205
           ++E YD+ ++ G+ +G    + +L+C+PL+DAS+ LPL F+ L  +TYPHELIDL+FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 206 DCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQK 265
           D S  DNT+  L+   K LQ          ID  T  +                      
Sbjct: 114 DSS--DNTMYNLLNMLKRLQ----------IDGGTSGK---------------------- 139

Query: 266 AFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 325
                        F +++I+EK+FGQ+IGQGFSDRH    QG RRKLMG+ARNWL   A+
Sbjct: 140 -------------FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLNTVAI 186

Query: 326 KPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESA 385
           KPYHSWVYWRD D+E+ P +++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW+ES 
Sbjct: 187 KPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 246

Query: 386 EALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLF 445
             L L+ +L ED VIVEGY EY TWR HLAY+RDP G+P            SIL+KA +F
Sbjct: 247 AGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSKANVF 306

Query: 446 RSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREE 505
           RSG  FPAF+F+ HAETEAFGK++K M + V GLP+Y +WHIYEPS +DL+ MA  E +E
Sbjct: 307 RSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAKLEEKE 366

Query: 506 R 506
           R
Sbjct: 367 R 367

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  376 bits (965), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 184/353 (52%), Positives = 228/353 (64%), Gaps = 47/353 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E YDL ++ GN +G +  D +L CIPLRDA+  LP+ F H+  +TYPH L+DL+FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S  D+T+  L+                                        +L+ VQ  
Sbjct: 126 SS--DDTMGVLLS---------------------------------------HLQTVQS- 143

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                 +D  K F +++I+EK+FGQIIGQ FSDRH    QG RRKLM +ARNWL + ALK
Sbjct: 144 -----QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSVALK 198

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD DIE  P +++EDLM  D D+IVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 199 PYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEG 258

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            L+LA  LDE+ VIVEGY EY TWR HLAY+RDP G+P            SIL+KAK+FR
Sbjct: 259 GLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAKVFR 318

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMA 499
           SG  FPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DLK MA
Sbjct: 319 SGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  372 bits (956), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 227/353 (64%), Gaps = 47/353 (13%)

Query: 146 TIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVS 205
            +E YDL+++ GN +G +  D ++ C+PLRDA+  LP  F HL  ++YPH LIDL+FLVS
Sbjct: 64  NVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVS 123

Query: 206 DCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQK 265
           D S  D+T+  L+                             SNL             Q 
Sbjct: 124 DSS--DDTMGVLL-----------------------------SNL-------------QT 139

Query: 266 AFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 325
           A S     D  K F +++I+EK+FGQ+IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 140 AQS---QRDKSKRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVAL 196

Query: 326 KPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESA 385
           KPYHSWVYWRD DIE  P +++EDLM  D D+IVPNVWRPLP +L   QPYDLNSW+ES 
Sbjct: 197 KPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESE 256

Query: 386 EALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLF 445
             L+LA  L+ED VIVEGY EY TWR HLAY+RDP G+P            SIL+KA +F
Sbjct: 257 GGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKANVF 316

Query: 446 RSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEM 498
           RSG  FPAF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +DLK M
Sbjct: 317 RSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDLKHM 369

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  367 bits (941), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 184/361 (50%), Positives = 228/361 (63%), Gaps = 47/361 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E YDL ++ GN NG +  D V+ C+PLRDA+  L + F  L  LTYPH LIDL+FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S  D+T+  L+                                        +L+R Q  
Sbjct: 117 SS--DDTMKTLLS---------------------------------------HLRRAQS- 134

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                ++D  + F +++IFEK+FGQ +GQ FSDRH    QG RRK M RARNWL + ALK
Sbjct: 135 -----NQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGSAALK 189

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHS+VYWRD D++  P +++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 190 PYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEG 249

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
            L+LA +LDED  IVEGY EY TWR HLAY+RDP G+P            SIL+KAK+FR
Sbjct: 250 GLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKAKVFR 309

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREER 506
           +G  FPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS DDLK MA    EE+
Sbjct: 310 TGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEEK 369

Query: 507 R 507
           R
Sbjct: 370 R 370

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  367 bits (941), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 235/362 (64%), Gaps = 48/362 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E YDL+++ G+ +G +  + +L  +PLRDA+  LP  F H+  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S++                 T+ ++L+                HL+      + + QK 
Sbjct: 117 SSDD-----------------TMGELLH----------------HLQ------IAQSQK- 136

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                  D +K F +++IFEK+FGQ IGQ FSDRH    QG RRKLM RARNWL +  LK
Sbjct: 137 -------DRNKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVTLK 189

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D+E+ P S++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 190 PYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEA 249

Query: 387 ALKLAQTL-DEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLF 445
            ++LA TL DED VIVEGY E+ TWR HLAY+RDP GNP            SILAKAK+F
Sbjct: 250 GIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 309

Query: 446 RSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREE 505
           R+G  FPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DLK MA    EE
Sbjct: 310 RTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEE 369

Query: 506 RR 507
           +R
Sbjct: 370 KR 371

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  363 bits (931), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 184/362 (50%), Positives = 223/362 (61%), Gaps = 48/362 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E +DL    G  +G    D VL C+PLRDA+  LP+ F+HL  +TYPH L+DL+FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
               D T+  L +  + LQ+                                        
Sbjct: 102 S--KDETMSVLRQHVRELQS---------------------------------------- 119

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                  D  + F +++IF+K+FGQ IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 120 -----QPDNARQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 174

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PYHSWVYWRD D+E  P ++IEDLM  D DVIVPNVWRPLP +L   QPYDLNSW ES  
Sbjct: 175 PYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVESEG 234

Query: 387 ALKL-AQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLF 445
            L+L A T DED VIVEGY EY TWRVHLAY+RDP G+P            SIL++A++F
Sbjct: 235 GLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRARVF 294

Query: 446 RSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREE 505
           RSG  FPAF+F+ HAETE FGK+++ MGY V GLPHY +WHIYEPS DDLK MA    EE
Sbjct: 295 RSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEE 354

Query: 506 RR 507
           +R
Sbjct: 355 QR 356

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  362 bits (930), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 181/354 (51%), Positives = 229/354 (64%), Gaps = 48/354 (13%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +E YDL+++ G+P+G +  + +L  +PLRDA+  LP  F H+  +TYPH LID +FLVSD
Sbjct: 63  VEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVSD 122

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            S  D+T+ AL                                          L  ++KA
Sbjct: 123 SS--DDTMGAL------------------------------------------LSHLEKA 138

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
            S   ++D  + F +++I+EK+FGQ IGQ FSDRH    QG RRKLM RARNWL   ALK
Sbjct: 139 QS---NKDKTRRFGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTVALK 195

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
            YHSWVYWRD D+ELCP S++EDLM  D DVIVPNVWRPLP +L   QPYDLNSW+ES  
Sbjct: 196 AYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEV 255

Query: 387 ALKLAQTLDEDD-VIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLF 445
            ++LA +L +DD VIVEGY +Y TWR HLAY+RDP GNP            SIL+K K+F
Sbjct: 256 GVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGKVF 315

Query: 446 RSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMA 499
           R+G  FPAF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +DL+ MA
Sbjct: 316 RTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  168 bits (426), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 110/356 (30%), Positives = 162/356 (45%), Gaps = 58/356 (16%)

Query: 140 NMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELID 199
           +++ +  I  YDL       N   N++ VL+  P++         + +L++LTYP  LI+
Sbjct: 89  DLIPEGHIAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIE 145

Query: 200 LAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEY 259
           L F++   +  D  L  L    + +Q G                                
Sbjct: 146 LGFIIPRTASGDAALQKLESAVREVQTG-------------------------------- 173

Query: 260 LKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNW 319
                           DK F  + I  +        G  DRHA++VQ  RR  M  ARN 
Sbjct: 174 --------------KQDKRFAKITILRQASQSFDRLGEKDRHALEVQKERRAAMALARNE 219

Query: 320 LTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQ----- 374
           L  + + P+ SW+ W DADI   P +VI+DL + +  V+  NV++    F   +Q     
Sbjct: 220 LLFSTIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQK---FYDKDQKKESI 276

Query: 375 -PYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXX 433
            PYD N+W ES   LKLAQ L ++++IVEGY+E  T+R  +A+  D  G           
Sbjct: 277 RPYDFNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGV 336

Query: 434 XXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 489
                L KA++ R G  F  F F +  ETEAF KMAK++GY V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  168 bits (425), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/367 (30%), Positives = 174/367 (47%), Gaps = 61/367 (16%)

Query: 135 YEREMNMLYDSTIET---------YDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMF 185
           Y+++ N L+  T+E          YDL           N++ VL+  P++         +
Sbjct: 75  YKKKSNWLFSDTVEDNIPAGHISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---W 131

Query: 186 RHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETS 245
            +L+ LTYP +LI+L F++   +  D  L  L    K  Q G   Q  ++I    ++  S
Sbjct: 132 DNLLQLTYPRDLIELGFIIPRTATGDTALRKLEAAVKRTQLGKKDQRFSKITILRQDSQS 191

Query: 246 TKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKV 305
                                            F S+Q  EK           +RHA+KV
Sbjct: 192 ---------------------------------FDSLQ--EK-----------ERHALKV 205

Query: 306 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRP 365
           Q  RR  M  ARN L  + + P+ SW+ W DADI   P S+I+D+ A +  V+  NV++ 
Sbjct: 206 QKERRAAMALARNELLFSTIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQK 265

Query: 366 L---PAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQG 422
                     E+PYD N+W +S +AL++A  + +D+V+ EGYAE PT+R  +A++ D  G
Sbjct: 266 YMNEETKKIAERPYDFNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASG 325

Query: 423 NPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHY 482
           +               L KA++ R G  FP+F F +  ETE F KMA+++ Y++ GLP+Y
Sbjct: 326 SQAAEMSLDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNY 385

Query: 483 TLWHIYE 489
            ++HI E
Sbjct: 386 LVYHIEE 392

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  166 bits (420), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 109/370 (29%), Positives = 174/370 (47%), Gaps = 67/370 (18%)

Query: 135 YEREMNMLYDSTIET---------YDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMF 185
           Y+++ N L++  +E          YDL       + A N++ VL+  P++         +
Sbjct: 73  YKKKTNWLFNRHVEDIIPENHIAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---W 129

Query: 186 RHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETS 245
           ++L+ LTYP ELI+L F++      D  L AL    K +Q    +Q  ++I    ++   
Sbjct: 130 QNLLQLTYPRELIELGFILPRSDSGDAALKALEAAVKKVQTDKKNQRFSKITILRQDS-- 187

Query: 246 TKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKV 305
                                                    + FGQ++ +   +RHA+ V
Sbjct: 188 -----------------------------------------QGFGQLMEK---ERHALHV 203

Query: 306 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRP 365
           Q  RR  M  ARN L  + + P+ SWV W DADI   P +VI+D+ A D  V+  NV++ 
Sbjct: 204 QKERRAAMALARNELLFSTIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQ- 262

Query: 366 LPAFLSGEQ------PYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRD 419
              +   E+       YD N+W+ES   L++A  +++D++IVEGY+E  T+R  +A+  D
Sbjct: 263 --RYFDEEKKEKSIRAYDFNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYD 320

Query: 420 PQGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGL 479
           P  +               L KA + R G  FP F F +  ETE F KMAK++ Y+V GL
Sbjct: 321 PTASVNSEMMLDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGL 380

Query: 480 PHYTLWHIYE 489
           P+Y ++H+ E
Sbjct: 381 PNYLVYHMEE 390

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  166 bits (419), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 116/370 (31%), Positives = 173/370 (46%), Gaps = 67/370 (18%)

Query: 135 YEREMNMLYDSTIET---------YDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMF 185
           Y+++ N L++  IE          YDL       N A N++ VL+  P+++        +
Sbjct: 74  YKKKSNWLFNDKIEDVIPAGHIAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YW 130

Query: 186 RHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETS 245
            +L+ LTYP ELI+L F+V      +  L+ L    K +Q G             KE+  
Sbjct: 131 DNLLQLTYPRELIELGFIVPRTGSGNVALEQLEAAVKKVQTGK------------KEDRF 178

Query: 246 TKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKV 305
            K  +         L++  ++F               ++ EK           +RHA++V
Sbjct: 179 GKITI---------LRQASQSFD--------------KLLEK-----------ERHALEV 204

Query: 306 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRP 365
           Q  RR  M  ARN L  + + PY SW+ W DADI   P SVIED+ A +  V+  NV++ 
Sbjct: 205 QKERRAAMALARNELLFSTIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ- 263

Query: 366 LPAFLSGEQ------PYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRD 419
              +   EQ      PYD N+W ES   L+LA  +  D+++VEGY E  T+R  +A+  +
Sbjct: 264 --RYYDQEQKKESIRPYDYNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYE 321

Query: 420 PQGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGL 479
                              L KA + R G  FP F F +  ETE F KMAK++GY+V GL
Sbjct: 322 DSAPATVEMELDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGL 381

Query: 480 PHYTLWHIYE 489
           P+Y ++HI E
Sbjct: 382 PNYLVYHIDE 391

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  166 bits (419), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 114/356 (32%), Positives = 168/356 (47%), Gaps = 58/356 (16%)

Query: 140 NMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELID 199
           +++ ++ I  YDL         A N++ VL+  P++         + +++++TYP ELI+
Sbjct: 90  DIIPENHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTYPRELIE 146

Query: 200 LAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEY 259
           L F+       D  L  L    K +Q+G  ++   +I    +E  S              
Sbjct: 147 LGFIAPRTPTGDAALKKLEAAIKKIQSGKKNERFAKIIILRQESQS-------------- 192

Query: 260 LKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNW 319
                          +D       + EK           DRHA+ VQ  RR  M  ARN 
Sbjct: 193 ---------------FD------MLAEK-----------DRHALAVQKQRRSAMALARNE 220

Query: 320 LTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGE------ 373
           L  + L P+ SWV W DADI   P +VI+DL A D  V+  NV++    F + E      
Sbjct: 221 LLFSTLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKADI 277

Query: 374 QPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXX 433
           +PYD N+W+ES   L+LA +L  D++IVEGYAE  T+R  +A+  D              
Sbjct: 278 RPYDFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGV 337

Query: 434 XXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 489
                L KA++ R G  FP F F +  ETE F KMAK++GY+V GLP+Y ++HI E
Sbjct: 338 GGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  165 bits (418), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/353 (30%), Positives = 166/353 (47%), Gaps = 52/353 (14%)

Query: 140 NMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELID 199
           +++ +  I  YDL      P+ A N++HVL+  P++         + +L+ LTYP ELI+
Sbjct: 89  DIIPEGHIAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---WDNLLQLTYPRELIE 145

Query: 200 LAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEY 259
           L F+    +  D  L  L    K +Q    +Q  ++I    +   S              
Sbjct: 146 LGFITPRTATGDLALKKLENAVKKVQADKKAQRFSKITIMRQNSQS-------------- 191

Query: 260 LKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNW 319
                          +DK      + EK           +RHA+ VQ  RR  M  ARN 
Sbjct: 192 ---------------FDK------LMEK-----------ERHALDVQKERRAAMALARNE 219

Query: 320 LTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPL---PAFLSGEQPY 376
           L  + + P+ SWV W DADI   P ++I+D+   +  V+  N+++         S  +PY
Sbjct: 220 LLFSTIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQRFYDQEKKQSSIRPY 279

Query: 377 DLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXX 436
           D N+W+ES   L++A  +D+D++IVEGYAE  T+R  +A+       P            
Sbjct: 280 DFNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGVGGG 339

Query: 437 SILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 489
             L KA++ R G  FP F F +  ETE F KMAK++ Y+V GLP+Y ++HI E
Sbjct: 340 CTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  164 bits (415), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 123/454 (27%), Positives = 198/454 (43%), Gaps = 76/454 (16%)

Query: 42  RKRRLNYAKIIFGFFVSFLILFLMLNFEFNASKLNKTIIDIAQKTINLSDQEYYNFDFED 101
           R +RL  A +IF     FLI  +      +   ++++ I   +    +    Y+ F  + 
Sbjct: 9   RLKRLPLASLIFPSISIFLIYMIFFANNVSILGIDQSAIKNHKWAHEIEGTWYFPFSSKF 68

Query: 102 IDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNG 161
             P    K      ++L + F  D++ PE                I  YDL       + 
Sbjct: 69  KMPKYSYK---KKSNWLSNDFVEDII-PEGH--------------IAHYDLNKLHSTKDA 110

Query: 162 AENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFS 221
            + ++HVL+  P++         + +L+ ++YP  L++L F++      D TL  L    
Sbjct: 111 MKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLELGFIIPRTPTGDETLKKLEAAV 167

Query: 222 KNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRS 281
           KN+Q G +     +I    ++  S                             +DK    
Sbjct: 168 KNVQTGKVEDRFAKITILRQDSQS-----------------------------FDK---- 194

Query: 282 VQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIEL 341
                         G  +RH++ VQ  RR  M  ARN L  +++ P  SWV W DADI  
Sbjct: 195 -------------LGEKERHSLAVQKERRSAMALARNELLFSSIGPSTSWVLWLDADIVE 241

Query: 342 CPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQ------PYDLNSWRESAEALKLAQTLD 395
            P +VI+D+   +  V+  NV++    F   E+      PYD N+W ES + L++A+ ++
Sbjct: 242 TPATVIQDMTNHNKPVLAANVYQ---RFFDKEKNENSIRPYDFNNWAESEKGLEIAKNMN 298

Query: 396 EDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFT 455
           ED++IVEGYAE  T+R  +A+  D  G                L KA++ R G  FP F 
Sbjct: 299 EDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVGGGCTLVKAEVHRDGAMFPNFP 358

Query: 456 FENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 489
           F +  ETE F KMAK++ Y++ GLP+Y ++HI E
Sbjct: 359 FYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  164 bits (414), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 112/367 (30%), Positives = 166/367 (45%), Gaps = 61/367 (16%)

Query: 135 YEREMNMLYDSTIET---------YDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMF 185
           Y+ E N ++D  ++          YDL       + A N++ +L+  P++         +
Sbjct: 73  YKNEHNWMFDDHVDEIIPEGHIAHYDLNKLHSTSDAAINKEKILILTPIQKFHQE---YW 129

Query: 186 RHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETS 245
            +L+ LTYP ELI+L F+       D  L AL                   +A   +  S
Sbjct: 130 ENLLQLTYPRELIELGFIAPRTPTGDQALAAL-------------------EAAVDKVQS 170

Query: 246 TKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKV 305
            K N                           + F  V I  ++          +RHA++V
Sbjct: 171 DKKN---------------------------QRFSKVTILRQDSVGFNKLTEKERHALEV 203

Query: 306 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRP 365
           Q  RR  M  ARN L  + + P+ SWV W DADI   P S+I+D+ A D  V+  NV++ 
Sbjct: 204 QKERRASMALARNELLFSTIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQR 263

Query: 366 L---PAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQG 422
                      +PYD N+W+ES   L+LA  + +D++IVEGYAE  T+R  +AY  DP  
Sbjct: 264 YYDEEKKQKAIRPYDFNNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDN 323

Query: 423 NPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHY 482
           +               L KA++ R G  FP F F +  ETE F KMAK++ Y+V GLP+Y
Sbjct: 324 SVAEEMRLDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNY 383

Query: 483 TLWHIYE 489
            ++HI E
Sbjct: 384 LVYHIEE 390

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  164 bits (414), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 104/352 (29%), Positives = 165/352 (46%), Gaps = 52/352 (14%)

Query: 141 MLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDL 200
           ++ +  I  +DL       + + N++ VL+  PL+         + +++ L+YP ELI+L
Sbjct: 91  IISEGHIAEFDLNKLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSYPRELIEL 147

Query: 201 AFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYL 260
            F+V                    Q G L+                             L
Sbjct: 148 GFIVPRT-----------------QTGDLA-----------------------------L 161

Query: 261 KRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWL 320
           + ++KA      +  ++ F  V I  ++          +RHA+ VQ  RR  M  ARN L
Sbjct: 162 QSLEKAVEKTQTDKKNQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALARNEL 221

Query: 321 TANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPL---PAFLSGEQPYD 377
             + + P+ SWV W DADI   P ++I+D+ A D  V+  NV++         S  +PYD
Sbjct: 222 LFSTIGPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASATRPYD 281

Query: 378 LNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXS 437
            N+W+ES   L+LA  +++D++IVEGY+E  T+R  +AY  D                  
Sbjct: 282 FNNWQESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVGGGC 341

Query: 438 ILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 489
            L KA++ R G  FP+F F +  ETE F KMAK++GY++ GLP+Y ++HI E
Sbjct: 342 TLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  163 bits (413), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/346 (30%), Positives = 161/346 (46%), Gaps = 52/346 (15%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           I  YDL       N A N++ VL+  P++         + +L+ LTYP EL++L F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPR 211

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            +  DN L  L                        E    K+ L  K             
Sbjct: 212 TTSGDNALRKL------------------------EAAVKKTQLSKK------------- 234

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                    D+ F  + I  ++          DRHA++VQ  RR  M  ARN L  + + 
Sbjct: 235 ---------DQRFLKITILRQDSQSFDLLKEKDRHALEVQKKRRSAMALARNELLFSTIG 285

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQ---PYDLNSWRE 383
           PY SWV W DADI   P ++I+D+ A D  V+  NV++      +G++   PYD N+W +
Sbjct: 286 PYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNNWAD 345

Query: 384 SAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAK 443
           S  AL++A ++ +D V+ EGY E  T+R  +A+      +P              L KA+
Sbjct: 346 SDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLVKAE 405

Query: 444 LFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 489
           + R G  FP+F F +  ETE F KMA+++ Y++ GLP+Y ++HI E
Sbjct: 406 VHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  162 bits (409), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 111/369 (30%), Positives = 173/369 (46%), Gaps = 65/369 (17%)

Query: 135 YEREMNMLYDSTIET---------YDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMF 185
           Y+++ N L++  +E          YDL       +   +++HVL+  P++         +
Sbjct: 75  YKKKFNWLFNDRVEDIIPEGHIAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YW 131

Query: 186 RHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETS 245
            +L+ L+YP ELI+L F++      D  L  L    KN+Q+   +   ++I    +E  S
Sbjct: 132 ENLLKLSYPRELIELGFIIPRSDAGDAALKKLETAVKNVQSDKKNNRFSKITILRQESQS 191

Query: 246 TKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKV 305
                                        +DK      + EK           +RH++ V
Sbjct: 192 -----------------------------FDK------LEEK-----------ERHSLAV 205

Query: 306 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRP 365
           Q  RR  M  ARN L  + L P+ SWV W D+DI   P +VIE +   D  V+  NV++ 
Sbjct: 206 QKERRAAMALARNELLFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQR 265

Query: 366 LPAFLSGEQ-----PYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDP 420
              F + +Q     PYD N+W ES   L+LA  + +D++IVEGYAE  T+R  +A+  +P
Sbjct: 266 F--FDNDKQQDSIRPYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNP 323

Query: 421 QGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLP 480
            G+               L KA++ R G  FP F F +  ETE F KMAK++ Y+V GLP
Sbjct: 324 SGDVGEEMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLP 383

Query: 481 HYTLWHIYE 489
           ++ ++HI E
Sbjct: 384 NFLVYHIEE 392

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  161 bits (408), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 109/356 (30%), Positives = 165/356 (46%), Gaps = 58/356 (16%)

Query: 140 NMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELID 199
           +++ +  I  YDL       + A N++HVL+  P++         + +L+ L+YP ELI+
Sbjct: 89  DIIPEGHIAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSYPRELIE 145

Query: 200 LAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEY 259
           L F+    +  D  L       KNL+N           A  K +T  K+           
Sbjct: 146 LGFITPRTATGDLAL-------KNLEN-----------AIKKVQTDKKT----------- 176

Query: 260 LKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNW 319
                            + F  + I  +N          +RHA+ VQ  RR  M  ARN 
Sbjct: 177 -----------------QRFSKITILRQNSQSFDKLMEKERHALDVQKERRAAMALARNE 219

Query: 320 LTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQ----- 374
           L  + + P+ SW+ W DADI   P S+I+D+   D  V+  N+++    F   E+     
Sbjct: 220 LLFSTIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ---RFYDQEKKQPSI 276

Query: 375 -PYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXX 433
            PYD N+W+ES   L++A  + +D++IVEGYAE  T+R  +A+  +  G P         
Sbjct: 277 RPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGV 336

Query: 434 XXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 489
                L KA + R G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  161 bits (408), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 113/370 (30%), Positives = 173/370 (46%), Gaps = 61/370 (16%)

Query: 135 YEREMNMLYDSTIET---------YDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMF 185
           Y+++ N L++  +E          YDL         A N++ VL+  P++         +
Sbjct: 76  YKKKSNWLFNDRVEDIIPEGHIAHYDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YW 132

Query: 186 RHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETS 245
            +L+ LTYP ELI+L F+V      D  L  L E  K +Q    +Q              
Sbjct: 133 DNLLQLTYPRELIELGFIVPRTQSGDVALAKLEEAVKKVQTDKKNQ-------------- 178

Query: 246 TKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKV 305
                  +++    L++  K+F               ++ EK           +RHA+ V
Sbjct: 179 -------RFVKVTILRQDSKSFD--------------KLQEK-----------ERHALAV 206

Query: 306 QGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRP 365
           Q  RR  M  ARN L  + + P+ SWV W DADI   P ++I+D+ A +  V+  NV++ 
Sbjct: 207 QKERRAAMALARNELLFSTIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQR 266

Query: 366 L---PAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQG 422
                   S  + YD N+W ES   L+LA  + ED++IVEGY+E  T+R  +AY  D  G
Sbjct: 267 YYDEEKKESSIRAYDFNNWAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANG 326

Query: 423 NPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHY 482
           +P              L +A + R G  FP F F +  ETE F KMAK++ ++V GLP+Y
Sbjct: 327 SPGAEMALDGVGGGCTLVQADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNY 386

Query: 483 TLWHIYEPSD 492
            ++HI E +D
Sbjct: 387 LVYHIEEWND 396

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  161 bits (407), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 110/355 (30%), Positives = 167/355 (47%), Gaps = 56/355 (15%)

Query: 140 NMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELID 199
           +++ +  I  YDL         A N++ VL+  P++         + +L+ LTYP ELI+
Sbjct: 92  DIIPEGHIAHYDLNKLRSTAYAAVNKERVLILTPMQTFH---KQYWENLLQLTYPRELIE 148

Query: 200 LAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEY 259
           L F++      +N L  L    K +Q+   +Q   +I    ++  S              
Sbjct: 149 LGFIIPRTKTGENALKELEIAIKKVQSDKKNQRFAKITILRQDSQS-------------- 194

Query: 260 LKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNW 319
                          +D      Q+ EK           DRH++ VQ  RR  M  ARN 
Sbjct: 195 ---------------FD------QLAEK-----------DRHSILVQKERRAAMALARNE 222

Query: 320 LTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQ----- 374
           L  + L P+ +WV W DADI   P +VI+D+ + D  V+  NV++    F + E+     
Sbjct: 223 LLFSTLGPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKY--FDNDEKKMAIR 280

Query: 375 PYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXX 434
           PYD N+WRES   L++A  +DE+++IVEGY+E  T+R  +A+  +  G            
Sbjct: 281 PYDFNNWRESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVG 340

Query: 435 XXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 489
               L KA + R G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 341 GGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  160 bits (406), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 107/356 (30%), Positives = 164/356 (46%), Gaps = 58/356 (16%)

Query: 140 NMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELID 199
           +++ +  I  YDL         A N++H+L+  P++         + +L+ L YP ELI+
Sbjct: 89  DIIPEGHIAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIE 145

Query: 200 LAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEY 259
           L F+    +  D  L  L    K +Q    +Q  ++I    +   S              
Sbjct: 146 LGFITPRTATGDLALKKLENAIKKVQTDKKTQRFSKITILRQNSQS-------------- 191

Query: 260 LKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNW 319
                          +DK      + EK           +RHA+ VQ  RR  M  ARN 
Sbjct: 192 ---------------FDK------LMEK-----------ERHALDVQKERRAAMALARNE 219

Query: 320 LTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQ----- 374
           L  + + P+ SWV W DADI   P S+I+D+   +  ++  N+++    F   E+     
Sbjct: 220 LLFSTIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RFYDEEKKQPSI 276

Query: 375 -PYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXX 433
            PYD N+W+ES   L++A  + +D++IVEGYAE  T+R  +A+  D  G P         
Sbjct: 277 RPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGV 336

Query: 434 XXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 489
                L KA++ R G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  160 bits (405), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 107/356 (30%), Positives = 165/356 (46%), Gaps = 58/356 (16%)

Query: 140 NMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELID 199
           +++ +  I  YDL      P+ A N++H+L+  P++         + +L+ L YP ELI+
Sbjct: 89  DIIPEGHIAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIE 145

Query: 200 LAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEY 259
           L F+    +  D+ L  L    K +Q    +Q  ++I    +   S              
Sbjct: 146 LGFITPRTATGDSALKKLESAIKKVQTDKKTQRFSKITILRQNSQS-------------- 191

Query: 260 LKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNW 319
                          +DK      + EK           +RHA++VQ  RR  M  ARN 
Sbjct: 192 ---------------FDK------LMEK-----------ERHALEVQKERRAAMALARNE 219

Query: 320 LTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQ----- 374
           L  + + P+ SWV W DADI   P S+I+D+   +  V+  N+++    F   E+     
Sbjct: 220 LLFSTIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ---RFYDQEKKQASI 276

Query: 375 -PYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXX 433
            PYD N+W+ES   L +A  + +D++IVEGYAE  T+R  +A+  D              
Sbjct: 277 RPYDFNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGV 336

Query: 434 XXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 489
                L KA++ R G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  159 bits (401), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 106/357 (29%), Positives = 166/357 (46%), Gaps = 52/357 (14%)

Query: 136 EREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPH 195
           +R  +++ ++ I  YDL         A N++HVL+  P++         + +L+ LTYP 
Sbjct: 86  DRVEDIIPENHIAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQEY---WDNLLQLTYPR 142

Query: 196 ELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYM 255
           E  +L F++   S  D  L  L    K +Q    +Q  ++I    +              
Sbjct: 143 EFTELGFILPRTSSGDIALSKLEAAVKKVQTDKKNQRFSKITILRQNSAG---------- 192

Query: 256 DPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGR 315
                              +DK      + EK           +RHA++VQ  RR  M  
Sbjct: 193 -------------------FDK------LMEK-----------ERHALEVQKERRSAMAS 216

Query: 316 ARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPL---PAFLSG 372
           ARN L  ++L P  SWV W DADI   P ++I+D+ + +  V+  NV++      A    
Sbjct: 217 ARNELLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQKYYDDQAKKVQ 276

Query: 373 EQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXX 432
            +PYD N+W+ES  AL+LA+ + +D+++VEGY +  T+R  +AY  D  G          
Sbjct: 277 IRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNLDG 336

Query: 433 XXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 489
                 L KA + R G  FP F F +  ETE F KMA+++ Y + GLP+Y ++HI E
Sbjct: 337 VGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEE 393

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  156 bits (394), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 107/351 (30%), Positives = 165/351 (47%), Gaps = 56/351 (15%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           +  YDL       + A N++ VL+  P++         + +L+ LTYP +L++L F++  
Sbjct: 94  VAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELGFIIPK 150

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
            +  D  L  L                    A  + +T  K+N   ++     L++  K 
Sbjct: 151 SASGDAALKQLEA------------------AVKRAQTDKKNN---RFGKVTILRQDSKG 189

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
           F               ++ EK           +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 190 FD--------------KLQEK-----------ERHALAVQKERRSAMALARNELLFSTIG 224

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGE-----QPYDLNSW 381
           P+ SWV W DADI     S+I+D+ A +  V+  NV++    F   E     +PYD N+W
Sbjct: 225 PHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRY--FDEAENKPSIRPYDFNNW 282

Query: 382 RESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAK 441
            +S  A +L   + +D++IVEGYAE  T+R  +A+   P G P              L K
Sbjct: 283 ADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGGGCTLVK 342

Query: 442 AKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSD 492
           A++ R G  FP F F +  ETE F KMAK++ Y+V GLP+Y ++HI E +D
Sbjct: 343 AEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  153 bits (387), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 100/348 (28%), Positives = 165/348 (47%), Gaps = 51/348 (14%)

Query: 144 DSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFL 203
           +  I  YD+       +   N++ VL+  P++         + +L++LTYP +L  L F+
Sbjct: 92  EGRIMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFI 148

Query: 204 VSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRV 263
           +      D  +  L +  K +Q+G  +Q                     +++    L++ 
Sbjct: 149 IPRTPTGDVAMKRLEDAVKKVQSGKENQ---------------------RFLKITILRQD 187

Query: 264 QKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 323
            ++F+              ++ EK           +RHA  VQ  RR  M  ARN L  +
Sbjct: 188 SQSFN--------------KLDEK-----------ERHAFNVQKERRAAMALARNELVFS 222

Query: 324 ALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGE--QPYDLNSW 381
            + P  SW+ W DADI   P +VI+D+ A D  ++  NV++      + E  +PYD N+W
Sbjct: 223 TIGPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNW 282

Query: 382 RESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAK 441
           +ES   L++A ++ +D++IVE Y E  T+R  +A + DP G+P              L K
Sbjct: 283 QESQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVK 342

Query: 442 AKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYE 489
           A++ R G  FP F F +  ETE F  MAK++ Y+V GLP+Y ++H  E
Sbjct: 343 AQVHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  149 bits (375), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/360 (29%), Positives = 167/360 (46%), Gaps = 63/360 (17%)

Query: 136 EREMNMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPH 195
           +R  + + +  I  YDL     + N AEN++HVL+  PL+         + +L+ L+YP 
Sbjct: 92  DRAEDTIPEGHIAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPR 148

Query: 196 ELIDLAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYM 255
           + I+L F++    + D++L       K L++                             
Sbjct: 149 DAIELGFIIPRTKKGDHSL-------KKLESA---------------------------- 173

Query: 256 DPEYLKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGF------SDRHAVKVQGIR 309
               +K+VQ A      +  DK F  + I  +N      +GF       +   ++ +   
Sbjct: 174 ----IKKVQTA------KQGDK-FSKITILRQN-----SKGFETVPEKKEVSEIEYEKQI 217

Query: 310 RKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAF 369
           R  M  ARN L A+ L P  +W+ W D+DI   P S+I+D+   D  V+  NV+      
Sbjct: 218 RAEMALARNELLASTLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDR 277

Query: 370 LSGE---QPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXX 426
            SGE   +PYD  +W ES EAL+LA  + ED++IVEG A   T R  + +     G+P  
Sbjct: 278 ESGELSIRPYDFRNWIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSS 337

Query: 427 XXXXXXXXXXSILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWH 486
                      +L K+++ R G  FP F F +  E+E F KMAK++ Y+V GLP+Y ++H
Sbjct: 338 EISLDGVGASCLLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  144 bits (363), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 102/348 (29%), Positives = 153/348 (43%), Gaps = 57/348 (16%)

Query: 144 DSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFL 203
           D  +  YDL         A N + VL+  P++         + +L+ LTYP + I L FL
Sbjct: 91  DDRLREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFL 147

Query: 204 VSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRV 263
           +   S  +  L  L +                  A  K +T  K                
Sbjct: 148 LPRTSSGNTALRKLEK------------------AVRKVQTGPK---------------- 173

Query: 264 QKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 323
                       D+ F  + I  ++F        S RH   VQ  RR  M  ARN L  +
Sbjct: 174 ------------DQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFS 221

Query: 324 ALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQP----YDLN 379
            + PY SWV W D+DI   P ++IED+ + +  ++  NV++    ++   +P    YDLN
Sbjct: 222 TIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQ---RYVENGEPAIRAYDLN 278

Query: 380 SWRESAEALKLAQTLDEDDVIVEGYA-EYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSI 438
           +W ES   LK+A  L ED +IVEGY  E+ T+R  +A++   +                 
Sbjct: 279 NWAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCT 338

Query: 439 LAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWH 486
           L KA++ R G  FP F F +  ETE F KMAK++ Y++ GLP+Y ++H
Sbjct: 339 LVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  134 bits (336), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 97/348 (27%), Positives = 162/348 (46%), Gaps = 44/348 (12%)

Query: 140 NMLYDSTIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELID 199
           +++ +  I  YDL     + N  EN++HVL+  PL+         + +L+NL+YP +LI+
Sbjct: 95  DIIPEGHIAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIE 151

Query: 200 LAFLVSDCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEY 259
           L F+V +  + D  L  L    KN+Q          ID          SN   K+     
Sbjct: 152 LGFMVPNTKKGDQILKQLENAVKNVQG---------IDK------KLGSN---KFAKITI 193

Query: 260 LKRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNW 319
           L++    F   F++  DK                     + + ++++  +R  M  ARN 
Sbjct: 194 LRQKDSGFHK-FNDRKDK--------------------KEMNDIELEKEKRAEMALARNE 232

Query: 320 LTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLP--AFLSGEQPYD 377
           L ++ L    +W+ W D+++   P ++I+D+   D  V+  NV+         +  +PYD
Sbjct: 233 LLSSTLSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYD 292

Query: 378 LNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXS 437
             +W ES  AL+LA  + ED++IVEG A   T R  +    +  G+P             
Sbjct: 293 FRNWIESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAAC 352

Query: 438 ILAKAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLW 485
            L K+++ R G  FP F F +  E+E F KMAK++ Y+V GLP+Y ++
Sbjct: 353 TLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/338 (24%), Positives = 131/338 (38%), Gaps = 62/338 (18%)

Query: 147 IETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSD 206
           I  Y+L +   +P+   + +H+L+ IPL + +      F +L  LTYP +LID       
Sbjct: 79  ISYYNLNELAASPDAEGHSEHILVLIPLINFN---SRFFENLFALTYPKQLID------- 128

Query: 207 CSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKA 266
                  L  ++  SKN   G L Q L E  A  +   ST+      Y     LK   K 
Sbjct: 129 -------LGVIVPDSKN-ATGIL-QALQETLAKVQANDSTR------YNKITVLKDDNK- 172

Query: 267 FSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 326
                  + D P                               RK +   +N L  + L 
Sbjct: 173 -----WGNTDDPVA----------------------------YRKQLAALKNQLLFSTLP 199

Query: 327 PYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAE 386
           PY SWV W D+ I   P ++++DL      ++  +++         E    LN+W  S  
Sbjct: 200 PYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHIFNNSDGSPDSET---LNNWVASDT 256

Query: 387 ALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPXXXXXXXXXXXXSILAKAKLFR 446
              LA  +    V++EG +   T R  +    D   +               L KA++ R
Sbjct: 257 WRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLTEMELDSVSTACTLVKAEVHR 316

Query: 447 SGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTL 484
            G  FP F F +  ETE F +MA+ + ++  GLP+Y +
Sbjct: 317 DGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 81/208 (38%), Gaps = 31/208 (14%)

Query: 299 DRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVI 358
           DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  ++E  +    ++I
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 359 VPNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIR 418
           VP + R     +  ++ YD N+W    E  K   T  +++   E Y   P       +++
Sbjct: 427 VPRILR-----VGSDREYDKNTW--IGERTKPEDTSKQNN--YESYVPRPV-NGKTKFLQ 476

Query: 419 D----------PQGNPXXXXXXXXXXXXSILAKAKLFRSGVQFPAFTF----------EN 458
           D          P+                +    K+F  G+QFP F             +
Sbjct: 477 DCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEGYD 536

Query: 459 HAETEAFGKMAKKMGYKVGGLPHYTLWH 486
             ETE     AK +GYK  G+P+    H
Sbjct: 537 GVETEGLCYQAKTLGYKCYGVPNVICRH 564

>NDAI0B04435 Chr2 complement(1112119..1112835) [717 bp, 238 aa] {ON}
          Length = 238

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 47/109 (43%), Gaps = 13/109 (11%)

Query: 170 LCIPLRDASHVLP-LMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALI-------EFS 221
           LC  +   + + P  M  HL N     E ID     SDC   D T D +I         +
Sbjct: 26  LCHKIYQITGIEPNEMKLHLNNGIKDVETIDRPLATSDCLILDGTFDTIIVEDTNSESIT 85

Query: 222 KNLQNGTLSQV---LNEIDAFTKEETSTKSNLHLKY--MDPEYLKRVQK 265
             L+N T   V   L+E D   + +T+ +     KY   +PEY+ R++K
Sbjct: 86  NQLKNKTTDDVEFKLSEDDYKRRSDTALQWKRENKYGRFNPEYVGRLKK 134

>KAFR0C05260 Chr3 complement(1053681..1056653) [2973 bp, 990 aa]
           {ON} Anc_5.503 YOR160W
          Length = 990

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 35  LNFTPKNRKRRLNYAKIIFGFF--VSFLILFLMLNFEFNASKLNKTIIDIAQKTIN-LSD 91
           +NF+  N+ +  NY +II  FF  VS L++F    F   +++L  ++ID+A ++IN L +
Sbjct: 779 VNFSKMNKIQLNNYYEIIMDFFAMVSDLVMFFPKEFIL-STELLGSVIDVAIESINKLEN 837

Query: 92  QEYYNFDFEDIDPTV 106
            + Y +    +D TV
Sbjct: 838 YDAYVYILRCLDDTV 852

>TPHA0J02450 Chr10 (539862..544334) [4473 bp, 1490 aa] {ON}
           Anc_6.229 YGL131C
          Length = 1490

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 348 EDLMAKDYDVIVPNVWRPLPAFLSGEQP-------YDLNSWRESAEALKLAQTLDEDDV 399
           EDL+    DV+ P+++ P P  LS   P        D+N+W ++  ++  AQTL+ + +
Sbjct: 430 EDLINNIQDVLDPDIFLPYPFKLSRVGPRYQWSKCLDMNTWEKTPYSISDAQTLNGETI 488

>KNAG0E02350 Chr5 (468554..470152) [1599 bp, 532 aa] {ON} Anc_2.439
           YMR110C
          Length = 532

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 12/69 (17%)

Query: 1   MEFVRNLKRLSYKKGSVGGLPRTNSLYETDSEKKLNFTPKNRKRRLNYAKIIFGFFVSFL 60
           M+F+ +++ L Y K       R   L +  +E K +F  K +K+   ++ +    FVSFL
Sbjct: 471 MDFMTSMRYLPYSK-------RKTQLVQMATEAKPDFDRKGKKK---WSFVKLATFVSFL 520

Query: 61  ILFL--MLN 67
           +LF+  MLN
Sbjct: 521 VLFISYMLN 529

>KLLA0D16093g Chr4 complement(1356056..1356424) [369 bp, 122 aa]
           {ON} weakly similar to uniprot|P00127 Saccharomyces
           cerevisiae YFR033C QCR6 ubiquinol-cytochrome c
           oxidoreductase subunit 6 (17 kDa)
          Length = 122

 Score = 30.4 bits (67), Expect = 4.7,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 234 NEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHED 274
           +++DA  +E  ST+   HL +   E ++RVQKA   P +ED
Sbjct: 51  DQLDALREECKSTEEGKHLVHHYLECVERVQKAQEEPGYED 91

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,927,331
Number of extensions: 2671232
Number of successful extensions: 8006
Number of sequences better than 10.0: 89
Number of HSP's gapped: 8138
Number of HSP's successfully gapped: 134
Length of query: 507
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 393
Effective length of database: 40,409,475
Effective search space: 15880923675
Effective search space used: 15880923675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)