Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A028208.838ON45345322840.0
TDEL0B005908.838ON5413464914e-55
ZYRO0G14146g8.838ON5074384422e-48
TPHA0I002308.838ON6143764234e-45
NCAS0B003108.838ON5643493995e-42
Kpol_1068.108.838ON6173193892e-40
NDAI0E003008.838ON6644633514e-35
Kwal_27.102728.838ON5514703389e-34
SAKL0D01518g8.838ON5743593222e-31
TBLA0D032508.838ON6833313214e-31
YML114C (TAF8)8.838ON5103853159e-31
Ecym_46098.838ON5203903123e-30
Suva_13.298.838ON5093883061e-29
Smik_13.208.838ON5103453017e-29
ABL128W8.838ON4743422953e-28
Skud_13.278.838ON5143452947e-28
KLTH0C03916g8.838ON5703582885e-27
KNAG0G034108.838ON5263032691e-24
KLLA0D01617g8.838ON5623602391e-20
CAGL0B02299g8.838ON6432401929e-15
TPHA0B016104.341aON117070751.5
TBLA0D054401.274ON117278689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A02820
         (453 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   884   0.0  
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   193   4e-55
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   174   2e-48
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   167   4e-45
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   158   5e-42
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   154   2e-40
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   139   4e-35
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   134   9e-34
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   128   2e-31
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   128   4e-31
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   125   9e-31
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   124   3e-30
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   122   1e-29
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   120   7e-29
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   118   3e-28
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   117   7e-28
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   115   5e-27
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...   108   1e-24
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...    97   1e-20
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...    79   9e-15
TPHA0B01610 Chr2 complement(361146..364658) [3513 bp, 1170 aa] {...    33   1.5  
TBLA0D05440 Chr4 complement(1340416..1343934) [3519 bp, 1172 aa]...    31   9.4  

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/453 (96%), Positives = 438/453 (96%)

Query: 1   MTISIEDDMNVEPLEIRRQITGNPQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMD 60
           MTISIEDDMNVEPLEIRRQITGNPQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMD
Sbjct: 1   MTISIEDDMNVEPLEIRRQITGNPQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMD 60

Query: 61  VQLNDLIKQLGRLSLLQRRNSNATKSDILLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDE 120
           VQLNDLIKQLGRLSLLQRRNSNATKSDILLLLKGF               HIKRLYSEDE
Sbjct: 61  VQLNDLIKQLGRLSLLQRRNSNATKSDILLLLKGFNLSESELNTELEISNHIKRLYSEDE 120

Query: 121 KKLSEDSIHYNQHTDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNF 180
           KKLSEDSIHYNQHTDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNF
Sbjct: 121 KKLSEDSIHYNQHTDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNF 180

Query: 181 INDPKIIKQKRFDESKTVKTALFNLINKIESNEERNDLHYDETLAKLESQALFGTVEEKM 240
           INDPKIIKQKRFDESKTVKTALFNLINKIESNEERNDLHYDETLAKLESQALFGTVEEKM
Sbjct: 181 INDPKIIKQKRFDESKTVKTALFNLINKIESNEERNDLHYDETLAKLESQALFGTVEEKM 240

Query: 241 NTNKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLINDQT 300
           NTNKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLINDQT
Sbjct: 241 NTNKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLINDQT 300

Query: 301 DVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLREDHQTKLKQIDTISHDI 360
           DVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLREDHQTKLKQIDTISHDI
Sbjct: 301 DVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLREDHQTKLKQIDTISHDI 360

Query: 361 LGTAADEMDEKTMDDIDLFSALELDAVTKGEEDFKSTEEEHPTAASNDQPRPAAVSSEQE 420
           LGTAADEMDEKTMDDIDLFSALELDAVTKGEEDFKSTEEEHPTAASNDQPRPAAVSSEQE
Sbjct: 361 LGTAADEMDEKTMDDIDLFSALELDAVTKGEEDFKSTEEEHPTAASNDQPRPAAVSSEQE 420

Query: 421 ETKQTHAAEEEDEKEGPADFLFEDVDMQEDIEI 453
           ETKQTHAAEEEDEKEGPADFLFEDVDMQEDIEI
Sbjct: 421 ETKQTHAAEEEDEKEGPADFLFEDVDMQEDIEI 453

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  193 bits (491), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 127/346 (36%), Positives = 186/346 (53%), Gaps = 32/346 (9%)

Query: 29  LLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDI 88
           +L K+VA++LKP  +   +   AF++L+ L+D QLND+I QL R S +QRR S A K D+
Sbjct: 33  ILSKAVALQLKP--MKADISKFAFEHLMILIDDQLNDMIGQLHRFSNVQRRESIA-KGDV 89

Query: 89  LLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDEKKLSEDSIHY--NQHTDFVGPVETSSFQ 146
            L L+G+               +  + Y ++      DS+H      TD V   +  S  
Sbjct: 90  HLFLQGYNLTPADLDKQHQASQYYSKTYGKEF-----DSLHSLKETFTDAVVDEDNGSED 144

Query: 147 LLN----PTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVKTAL 202
           ++N    P NPL   IP W P+ PPDHTYKFTP+YN  I D  II+++  DE K  + AL
Sbjct: 145 VINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQSEVAL 204

Query: 203 FNLI---NKIESNEERNDLHYDETLAKLESQALFGTVEEKMNTNKKVYKSLNSIIVPITK 259
            +L+   N    + + +   YDE L + E+ A++G  ++K   N     S     +P T 
Sbjct: 205 LHLLKNMNPPTPSSDADGASYDEALVREETAAIYGNEQKKRKKNASS-SSDLLSKLPQTN 263

Query: 260 FDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINL----INDQTD----------VKSY 305
           F IEEY+  RV IAR KV ++E + + L+ NPFI      +++ +D          + S 
Sbjct: 264 FSIEEYARSRVEIARKKVVEYEERQMKLQRNPFIKYSKIALSNSSDKSGRRQATREIHSM 323

Query: 306 LNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLREDHQTKLK 351
           L RS Q +I SIPEL + K+ A R+AE +RDER+  LR+    KLK
Sbjct: 324 LQRSLQHLIKSIPELQMTKQDARRKAEQKRDERLQELRDKKAQKLK 369

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  174 bits (442), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 138/438 (31%), Positives = 216/438 (49%), Gaps = 61/438 (13%)

Query: 24  PQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNA 83
           P +  +L KSVA++LKP+N   Q+   AFD L+ L+D QLND+I QL R+S LQRR + A
Sbjct: 23  PNVVKVLAKSVALQLKPMN--AQITQFAFDRLLQLVDGQLNDMISQLHRMSNLQRRETIA 80

Query: 84  TKSDILLLLKGFXXXXXXXXXXXXXXXHIKRLYSED----------EKKLSEDSIHYNQH 133
            K DI +L++GF                  + Y ++          +  L+ + + +   
Sbjct: 81  -KGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSLRDLQSSLAHEMVPFEDQ 139

Query: 134 TDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFD 193
                 V T    L+ PTNPL+D +P W P  PPDHTYKFTP+Y++ I D   I+++  +
Sbjct: 140 EAVRQNVSTV---LVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYSHPITDETTIRRQIVE 196

Query: 194 ESKTVKTALFNLINKIESNEE-RNDLHYDETLAKLESQALFGTVEEKMNTNKKVYKSLNS 252
           E+K  + AL +L  K    ++  N   YD  LA+ E+ A++G+  +K  T      S + 
Sbjct: 197 EAKQSELALSHLSQKKNPTDDIVNRSQYDSELAEQETLAIYGSQLKKRKTQHPQANSADL 256

Query: 253 II-VPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINL-------INDQTDVKS 304
           +  +P T F +EEY+H R+ +AR KV +FE + L  + +PF+ L        ND+   K 
Sbjct: 257 LSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFLKLSRIAFTQCNDKFTKKQ 316

Query: 305 Y-------LNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLREDHQTKLKQIDTIS 357
                   L RSF  ++ SIPEL   K +   +A+ ER +R+  LR              
Sbjct: 317 VHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEERSKRLQELR-------------- 362

Query: 358 HDILGTAADEMDEKTMDDIDLFSALELDAVTKGEEDF---KSTEEE--HPTAASNDQPRP 412
                   +E ++K   D+     L+LD + + +EDF   +S++EE   PT       +P
Sbjct: 363 -----AQREEQEKKGERDV-----LDLDELDQNQEDFFAMESSDEEVMEPTVDKPPLEQP 412

Query: 413 AAVSSEQEETKQTHAAEE 430
               + Q E +Q    +E
Sbjct: 413 QQTETAQNEPQQPELIQE 430

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  167 bits (423), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 124/376 (32%), Positives = 199/376 (52%), Gaps = 41/376 (10%)

Query: 15  EIRRQITGNPQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLS 74
           E + + T  P ++ +L K++A++LK +N  T +   AF +L  L+D QL+D++ Q+ +L+
Sbjct: 56  EFKYEDTKGP-MEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQLSDMVNQMEKLA 114

Query: 75  LLQRRNSNATKSDILLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDEKKLSEDSIHYNQHT 134
            LQRR   A K DI L L+GF               +IK  Y  +   L+  +   N+  
Sbjct: 115 ALQRRKEVA-KKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLNRLATDTNEVL 173

Query: 135 DFVGPVETS--------SFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKI 186
                 + +        + +L+  TN L++ IP W PS PPD+TYKFTP++N  I D  +
Sbjct: 174 TVFKKTDKTLKDDSTLETLKLVPITNTLENIIPDWLPSFPPDYTYKFTPQFNKHITDATV 233

Query: 187 IKQKRFDESKTVKTALFNLI--NKIESNEERNDLHYDE---TLAKLESQALF--GTVEEK 239
           I++K   E K  + AL +L+   KI +++  N   +D      AKLE  AL+  G+ + K
Sbjct: 234 IRKKVAAEGKKSEKALLHLLESEKITTSKLLNLDKFDSDDMDTAKLEMDALYSGGSCDRK 293

Query: 240 MNT-------NKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPF 292
             T       ++ V +  NS      KFDIE+Y HKR+NI RNKV ++E+K L L+ +PF
Sbjct: 294 KRTAFFEDEEDRMVDEHGNST---SNKFDIEKYVHKRINIVRNKVKQYEDKQLRLQNDPF 350

Query: 293 IN---LINDQTD-----------VKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDER 338
           +    L+++QTD           +++ L RSF  +INSIP L   KK    +A +E+  R
Sbjct: 351 LKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQNKKDTRERAMVEKKRR 410

Query: 339 INRLREDHQTKLKQID 354
            +   +  + KLK+++
Sbjct: 411 HDEWLKRREEKLKKLE 426

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  158 bits (399), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 117/349 (33%), Positives = 186/349 (53%), Gaps = 35/349 (10%)

Query: 25  QLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNAT 84
           Q+  LL KS+A++LKP+NL  +L   AF+ L  L++ QL+ LI +L R+S++QRRN+ A 
Sbjct: 47  QVRKLLNKSIALQLKPLNL--ELSQLAFNELSLLVNDQLDFLISELHRMSVIQRRNA-AA 103

Query: 85  KSDILLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDEKKLSEDSIHYNQHTDFVGP----- 139
           K+DI LLL+G                 +K    +D   L +DS      +D +       
Sbjct: 104 KTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSSTIFDSSDTMANPGHDS 163

Query: 140 -VETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTV 198
            V   S  L+ P NP + +IP+W P+ PPDHTYKFTP++N  I D  +IKQK  +E K  
Sbjct: 164 MVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPITDQVLIKQKLIEEGKKS 223

Query: 199 KTALFNLINKI---ESNEERNDLHYDETLAKLESQALFGTVEEKMNTNKKVYKSLNSI-- 253
           + +L NL+N I    S E     ++D  LA+ E+ A++G   + M+  K+    L SI  
Sbjct: 224 EKSLLNLLNDITEQSSIENEETSNFDSELAREENIAIYGY--DAMSRKKRKPPHLISIHD 281

Query: 254 --------IVPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINL---INDQT-- 300
                         F++  Y+H RV + R +V +FE + L  + NPF+ L   IND+   
Sbjct: 282 TEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEKNPFLRLSRMINDKKVS 341

Query: 301 ------DVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLR 343
                 ++K+ L RS++ +  + P+L  E+ + +  A  +R+E+I +L+
Sbjct: 342 RSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQKREEKIEKLK 390

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  154 bits (389), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 104/319 (32%), Positives = 166/319 (52%), Gaps = 28/319 (8%)

Query: 24  PQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNA 83
           P ++ +L K+VA++LK +N  T +   AF++L+ L+  Q++D++ +L RLS LQRRN+ A
Sbjct: 27  PAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQIDDMVLELHRLSSLQRRNTVA 86

Query: 84  TKSDILLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDEKKLSEDSIHYN------QHTDFV 137
            K+DI + L+GF               ++ +LY +D + L++ +          Q  D  
Sbjct: 87  -KADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKDYESLTKIATTTTRTLSTYQKLDLT 145

Query: 138 GPVETSSFQ---LLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDE 194
              +TS+ Q   L+  +NPL+  IPSW P  PPD+TYKFTP+YN  I D  II++K  +E
Sbjct: 146 HK-DTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYTYKFTPQYNTPITDETIIRRKVVEE 204

Query: 195 SKTVKTALFNLINKIESNEERNDLHYDETLAKLESQALFGTVEEKMNTNKKVYKSLNSII 254
            K  + AL NL+   + +    DL +  +  +L ++    T       NK +        
Sbjct: 205 GKQSEKALLNLLRGGQEDRISRDLKFSSSEMELATEETLATYSAITLRNKHLTSFFEK-- 262

Query: 255 VPI-TKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLI------ND--------Q 299
            PI    ++EEY+  RV I R KV  +E + L ++ NPF+ +       ND         
Sbjct: 263 EPIQNSLNVEEYARTRVEIERKKVLGYEERQLQIQRNPFLKISRLISANNDNKVSKSVAN 322

Query: 300 TDVKSYLNRSFQLMINSIP 318
           T+++ YL RS    I+SIP
Sbjct: 323 TEIRKYLKRSLLNFIHSIP 341

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  139 bits (351), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 137/463 (29%), Positives = 195/463 (42%), Gaps = 134/463 (28%)

Query: 8   DMN-VEPLEIRRQITGNP---QLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQL 63
           DMN V+P    R+I  N    Q++ LL KS+A++LK   +       AF+ L  L+D QL
Sbjct: 11  DMNEVQP---PREIAHNHMDMQIEKLLQKSIAIQLKAFKV--DFSKLAFNQLTLLVDDQL 65

Query: 64  NDLIKQLGRLSLLQRRNSNATKSDILLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDEKKL 123
           N LI +L RLSLLQRRNS A K D+ L ++GF               +I+   S  E ++
Sbjct: 66  NSLITELHRLSLLQRRNSMA-KVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRI 124

Query: 124 --------------------SEDSIHYNQHTDFVGPVETSSFQLLNPTNPLKDA-IPSWF 162
                               S+D+    +    +     SS  L+ PTNP K   I SW 
Sbjct: 125 LRDLNEEVVKQRTHIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWL 184

Query: 163 PSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVKTALFNLINKI------------- 209
           PS PPDHTYKFTP++NN I D K+IKQK  +E    + AL N +  I             
Sbjct: 185 PSFPPDHTYKFTPQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMT 244

Query: 210 -------------------------ESNEERNDL-----HYDETLAKLESQALFGT---- 235
                                    E  +E+ D        D  LA  E+ A++GT    
Sbjct: 245 IPPSPSLSNEGPITDTDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQS 304

Query: 236 --VEEKMNTNKKVYKSLNSIIVPI-------TKFDIEEYSHKRVNIARNKVSKFENKMLA 286
             +E   ++   +    +  IV          KFD+ +YSH RV + R KV  FENK L 
Sbjct: 305 YEIERDSSSKPNIISIHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLR 364

Query: 287 LKYNPFINL---------------------------------------------INDQTD 301
           L+ NPF+ L                                             IN++  
Sbjct: 365 LEKNPFLKLSKLVCLEKEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRKRAQINNE-- 422

Query: 302 VKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLRE 344
           + S L RSF  ++N+ P+L   KK+ ++ A  +RD+R+  LR+
Sbjct: 423 IISNLKRSFYSILNNYPKLKKAKKQRVKLAIEKRDQRLQELRK 465

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  134 bits (338), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 126/470 (26%), Positives = 228/470 (48%), Gaps = 75/470 (15%)

Query: 26  LDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATK 85
           L  LL K++A++LK +N    +   AF+ LI L++  L++++  L +++ +QRR+   +K
Sbjct: 39  LKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSNMLMDLHKMANIQRRHC-ISK 97

Query: 86  SDILLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDEKKLSEDS--IHYNQHTDFVGPVETS 143
            D+LL+++G+               +++  + E  KK+ EDS  +   +HT        +
Sbjct: 98  KDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEEDSKYVEKQEHTPL------T 151

Query: 144 SFQLLNPTNP----------------LKDA--IPSWFPSLPPDHTYKFTPKYNNFINDPK 185
             +LL+ T+P                +KD   +P W P  PPDHTY+FT +YN  I D +
Sbjct: 152 QNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTYRFTAQYNKPITDER 211

Query: 186 IIKQKRFDESKTVKTALFNLINKIESNEER------NDLHYDETLAKLESQALFGTVEEK 239
           ++K+K  +E+   + AL +L   + S+EE       +D  Y+E  A+ E+Q LFG V++K
Sbjct: 212 LMKRKLAEEANLSEKALIHL--SMLSHEEASSGPIDSDTIYEE--AQQETQLLFGPVKKK 267

Query: 240 MNTNKKVYKSLNSII--VPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFI---- 293
                     +N ++  +P   F +EEY+  RV IAR +V+++E   L L+   FI    
Sbjct: 268 KTA---AINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQLQLQKGAFIKAAH 324

Query: 294 ----------NLINDQTDVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLR 343
                     +    + ++++ L+RS   ++ S P L   +K+ I  AE  R  R  +LR
Sbjct: 325 LLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALAEENRRLRDEKLR 384

Query: 344 EDHQTKLKQ--------IDTISHDI----LGTAADEMDEKTMDD--IDLFSALELDAVTK 389
           ++ + + K         ++ ++ D     LG+ +D  DE+  ++   D  S  E   +T+
Sbjct: 385 KEREARSKSSNEFDVLDLNNLNEDPFFGGLGS-SDSEDEQQQEEKATDGVSESEKQQITQ 443

Query: 390 GEEDFKSTEEEHPT----AASNDQPRPAAVSSEQEETKQTHAAEEEDEKE 435
            E    + +   PT    + +NDQ   A+V+   +      A +E D K+
Sbjct: 444 DEAALDTVKASPPTEPHVSNTNDQAPEASVADSPKPESNMPALQEGDTKQ 493

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  128 bits (322), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 108/359 (30%), Positives = 176/359 (49%), Gaps = 43/359 (11%)

Query: 26  LDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATK 85
           +  +L ++VA+RLKP+N    +   AF+ L+ L+   L+ ++  L R   +QRR    +K
Sbjct: 39  MHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSFMLTTLHRFVDIQRRR-EISK 97

Query: 86  SDILLLLKGFXXXXXXXXXXXXXXXHI---------------KRLYSEDEKKLSEDSIHY 130
            D+LLLLKG+               +I               K L S+  K ++E  +  
Sbjct: 98  KDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQKSKELKSKLLKPMTEKELLN 157

Query: 131 NQHTDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQK 190
           + H++F    +     L+ PTN     IP W P  PPDHTY+FT +YN  + D + +++K
Sbjct: 158 SAHSEFFFK-DMDILDLVPPTNKNNQYIPKWLPEFPPDHTYRFTSQYNKPVVDERQLRRK 216

Query: 191 RFDESKTVKTALFNLI------NKIESNEERNDLH--YDETLAKLESQALFGTVEEKMNT 242
             +E K  + AL NL+      N+   N ER +    Y+ET  + E+  +FG   +K +T
Sbjct: 217 LVEEGKQSERALVNLLKHHDSTNQDLGNNERVEKRSLYEET--QEETFLIFGPERKKSHT 274

Query: 243 NKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLINDQT-- 300
            +  ++ L ++  P+  F +EEY+  RV IAR KV ++E   L L+ NPFI   N  +  
Sbjct: 275 TENSHELLRTL--PLKNFSVEEYARNRVEIARRKVLEYEQYQLRLQKNPFIKAANLCSPL 332

Query: 301 ------------DVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLREDHQ 347
                       ++KS L RS+  ++ S+P+L   K +    A   R E + +L E+ Q
Sbjct: 333 KKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVKARERELANERRREMLEKLNEERQ 391

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  128 bits (321), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 103/331 (31%), Positives = 156/331 (47%), Gaps = 66/331 (19%)

Query: 26  LDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATK 85
           +  LL KS+A++LKP+N +T +   AF+ L+ L+D+QLND+I QL RLS+ QRR + A+ 
Sbjct: 60  IGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMIYQLARLSITQRRLTIAS- 118

Query: 86  SDILLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDEKKLSEDSIHYNQHTD--FVGPVETS 143
           +D+ L L+ F                IK  +++D   L E    YN  T+  F  P  ++
Sbjct: 119 NDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLRDYNTETNHNFKNPNYST 178

Query: 144 SFQLLN-------------PTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQK 190
           S  LLN             P+N +  ++P W PSLPPDHTYKFTP YN  I D  ++K+ 
Sbjct: 179 S-DLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDHTYKFTPLYNEPITDETVMKKI 237

Query: 191 RFDESKTVKTALFNLINKIESNE----------ERNDLHY-------------------- 220
             +E K  ++AL  L+    ++E            NDL                      
Sbjct: 238 LVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINIDTNTNGNSMTLKSVSE 297

Query: 221 -----------DETLAKLESQALFGTVEEKMNTNK--------KVYKSLNSIIVPITKFD 261
                      DE LA+ E++A++G+  +     K        K    L+   V  + F+
Sbjct: 298 NEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRFELMIDPKAETQLSEEFVYPSTFN 357

Query: 262 IEEYSHKRVNIARNKVSKFENKMLALKYNPF 292
           +EEY+ K+V   R +V  +E K L  + NPF
Sbjct: 358 VEEYARKQVQKIREQVLFYEEKQLQAQKNPF 388

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 8/123 (6%)

Query: 301 DVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLREDHQTKLKQIDTISHDI 360
           D++   NRS   +INS+P L  EK  A   AE ER++++  + +  Q +L +  +     
Sbjct: 447 DIQQMFNRSLNNLINSLPNLAKEKASAREIAENEREKKVQEMLKKKQKELNEKQSS---- 502

Query: 361 LGTAADEMDEKTMDD---IDLFSALELDAVTKGEEDFKSTEEEHPTAASNDQPRPAAVSS 417
              A D  D +  +D    DL S+ + ++ T+ +     T+E H    S ++ + A  + 
Sbjct: 503 -AGALDLHDLQKENDGLFADLGSSDDDESSTRHQNTSDKTQETHSPKLSQNEDQHANNNE 561

Query: 418 EQE 420
            QE
Sbjct: 562 TQE 564

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  125 bits (315), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 117/385 (30%), Positives = 189/385 (49%), Gaps = 45/385 (11%)

Query: 29  LLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDI 88
           +L K+V  +L  +N+   + N A D L+ L+ VQ++ + + L  L+LLQRR S A+++D+
Sbjct: 40  ILKKTVLFQLNSLNIC--ISNFALDELVNLVTVQMDGMFRNLHNLTLLQRR-SQASQADL 96

Query: 89  LLLLKGFXXXXXXXXXXXXXXXHIKRLYS-EDEKKLSEDSIHYNQHTDFVGPVETSSFQ- 146
            LLL+ F                IK  +S E EK +S  S+    H +     E ++ + 
Sbjct: 97  KLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSWSSLAALPHNEEDEEDELNNIEE 156

Query: 147 -------LLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVK 199
                  LL P+NPL+  IPSW P+ PPDHTYKFTP++N+ I D K IK++   ES+  +
Sbjct: 157 QQNEINVLLPPSNPLEKQIPSWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESE 216

Query: 200 TALFNLINKIE-----SNEERNDLHYDETLAKLESQALFGTVEEKMNTNKKVYKSLNSII 254
            AL NL   +      SN  +     DE   + + +     +EE+  T     KS N   
Sbjct: 217 KALLNLNKSLSHISSASNTPQPPGLDDEDAIEQQLEIWGNALEERKPT--ITEKSFN--- 271

Query: 255 VPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLIND--------------QT 300
               + +IE+Y+  RV +AR +V+KFE   L    NPF+ +                 Q 
Sbjct: 272 ----ENNIEQYAKYRVELARERVTKFEVNQLKRTKNPFLKISETLYLPESPHQSHKTIQK 327

Query: 301 DVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLRED---HQTKLKQIDTIS 357
            ++    +S  L ++++P++   KK+ IR A+ ER + + R +E+    +TK +Q +   
Sbjct: 328 TIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKEERAKSLKRRQEELISQRTKREQDE--G 385

Query: 358 HDILGTAADEMDEKTMDDIDLFSAL 382
           HD+     +E      DD    +AL
Sbjct: 386 HDLELLLNNEHARDAADDTTTPNAL 410

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  124 bits (312), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 108/390 (27%), Positives = 182/390 (46%), Gaps = 54/390 (13%)

Query: 29  LLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDI 88
           LL +SVA++LK +     +    F+ ++  +++Q+ND+ + L R + +QRRN  + K D+
Sbjct: 39  LLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMNDMFQILHRFANIQRRNEISIK-DL 97

Query: 89  LLLLKGFXXXXXXXXXXXXXXXHIKRLYSED---------------EKKLSEDSIHYNQH 133
            L LKG                +IK+ Y  +               +K L ++ +  + H
Sbjct: 98  KLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIERQSLDLVEKWQKPLRDEELLSSNH 157

Query: 134 TDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFD 193
            +F    +     L+ PTN     +P+W P  PPDHTYKFT  YN  I+D + +K+  F+
Sbjct: 158 AEFFFK-DVDILNLVPPTNINNSYVPTWLPEFPPDHTYKFTAIYNKPISDERQMKRMLFE 216

Query: 194 ESKTVKTALFNLINKIESNEERNDLHYDETLAKL------ESQALFGTVEEKMNTNKKVY 247
           E K  + AL N++   ++   +  +  +ET+A+       E+Q ++G VE++    +  Y
Sbjct: 217 EGKLSEKALLNMLGSAQAKMLK--VEDEETIAQTYKESQEETQLIYG-VEKQRPRRENAY 273

Query: 248 KSLNSII---VPITK-----FDIEEYSHKRVNIARNKVSKFENKMLALKYNPFIN----- 294
              NS     +P+       F+I+EY+  R+ +AR KV +FEN  L  + NPFI      
Sbjct: 274 VGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGLARRKVEEFENHKLQAQKNPFIRASSIC 333

Query: 295 --LINDQTDVKS--------YLNRSFQLMINSIPELTL----EKKKAIRQAEIERDERIN 340
               N Q   +          L RS+  ++ SIP+L      E   AI +  I++ ER  
Sbjct: 334 SPYGNAQKTTRKAAEREFNILLRRSYVGVLKSIPKLRQLKANEMAAAIERERIKQKEREM 393

Query: 341 RLREDH-QTKLKQIDTISHDILGTAADEMD 369
            L + H Q  +  ++ +  D L    D  D
Sbjct: 394 ELEKKHLQQGVVDLNALHEDALLADLDSTD 423

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  122 bits (306), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 112/388 (28%), Positives = 188/388 (48%), Gaps = 42/388 (10%)

Query: 29  LLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDI 88
           +L KSV  +L  +N+   + N A D ++ L+ VQ++ + + L  L+LLQRR S  +++D+
Sbjct: 40  ILKKSVLFQLNSLNIC--ISNFALDEMVNLVAVQMDGMFRNLHNLALLQRR-SQVSQADL 96

Query: 89  LLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDEKKLSEDS----IHYNQHTDFVGPVETSS 144
            LL + F               HIK  +S + +KL + S    + + +  +         
Sbjct: 97  KLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKLVKSSSFTAVSHIEDDEEDEINNIEE 156

Query: 145 FQ-----LLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVK 199
            Q     LL P+NPL+  IPSW P+ PPDHTYKFTP++N+ I D K IK++   ES   +
Sbjct: 157 QQNEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESE 216

Query: 200 TALFNL---INKIESNEERNDLHYDETLAKLESQALFG-TVEEKMNTNKKVYKSLNSIIV 255
            AL NL   + +I S          +     E   ++G T+ E+      + KS N    
Sbjct: 217 RALLNLNKRLFRISSASHTPSPRLPDASDASERLEIWGNTLHERKPA--IIAKSFN---- 270

Query: 256 PITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLIND--------------QTD 301
              + +IE+Y+  R+ +AR +VSKFE   L    NPF+ +                 Q  
Sbjct: 271 ---EKNIEQYAKYRIELARERVSKFEVNQLKRTKNPFLKISESLYSFKNPHQSHKVIQRS 327

Query: 302 VKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLRED--HQTKLKQIDTISHD 359
           +   L +S  L ++++P++   KK+ I+ A+ ER + + R +E+   Q K K+ D   HD
Sbjct: 328 IDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKEERQKSLKRRQEELISQRKKKEQDE-GHD 386

Query: 360 ILGTAADEMDEKTMDDIDLFSALELDAV 387
           +     +E   ++ D+    +AL +  +
Sbjct: 387 LELLLNNEQARESTDNNTNLNALNVSTI 414

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  120 bits (301), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 103/345 (29%), Positives = 174/345 (50%), Gaps = 40/345 (11%)

Query: 29  LLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDI 88
           +L K+V  +L  +N+   + N A D L+ L+ VQ++ + + L  L+LLQRR S A+++D+
Sbjct: 40  ILKKTVLFQLNSLNI--CISNFALDELVNLVAVQMDGMFRNLHNLTLLQRR-SEASQADL 96

Query: 89  LLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDEKKL----SEDSIHYNQH--TDFVGPVET 142
            LL + F                IK  ++ +  KL    S  ++ +N+    D +  +E 
Sbjct: 97  KLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRLSSFPALAHNEEDEEDELSNIEE 156

Query: 143 SSFQ---LLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVK 199
              +   LL P+NPL+  IPSW P+ PPDHTYKFTP++N+ I D K IK++   ES+  +
Sbjct: 157 QQSEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEFNHPITDLKTIKKEIVKESEESE 216

Query: 200 TALFNLINKIESNEERNDLH----YDETLAKLESQALFG-TVEEKMNTNKKVYKSLNSII 254
            AL NL  ++      +        D+  A  +   ++G  ++E+  T      SLN   
Sbjct: 217 KALLNLNKRLSHLSSASHTSPPPVLDDADATEQQLEIWGNALQERKPT--ITATSLN--- 271

Query: 255 VPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLIND--------------QT 300
               + +IE+Y+  RV +AR +V+KFE   L    NPF+ L                 Q+
Sbjct: 272 ----ESNIEQYAKYRVELARERVAKFELNQLKRTKNPFLKLSETLYFSEGPHQSHKTIQS 327

Query: 301 DVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLRED 345
            +     +S  L ++++P++   KK+ IR A+ ER + + R +E+
Sbjct: 328 AIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKEERAKSLRRRQEE 372

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  118 bits (295), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 85/342 (24%), Positives = 156/342 (45%), Gaps = 39/342 (11%)

Query: 19  QITGNPQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQR 78
           ++T +  +  LL ++V + LK +     +    F+ L+  +++QL+D+++ L R + +QR
Sbjct: 29  EVTKSNPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQLDDMLQILHRFANVQR 88

Query: 79  RNSNATKSDILLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDEKKLSEDSI----HYNQ-- 132
           RN  + K D+ L L G                ++++ ++   + + E S     H++Q  
Sbjct: 89  RNEVSLK-DVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIEEQSASLMGHWHQPM 147

Query: 133 ---------HTDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFIND 183
                    H +F    +     L+ PTN     +P W P  PPDHTYKFT  YN  I D
Sbjct: 148 SEEELLSSSHAEFFF-KDVDILNLVPPTNNNNHYVPKWLPEFPPDHTYKFTSIYNQPITD 206

Query: 184 PKIIKQKRFDESKTVKTALFNLINKIESNEERNDLHYDETLAKLESQALFGTVEEKMNTN 243
            + +K+K F+ESK  + AL +++         +D    + ++  + + L     E+    
Sbjct: 207 ERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQLPQIISDGQQENLLIYGPER---- 262

Query: 244 KKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLINDQTDVK 303
               + L     P   F+IE+Y+  RV +AR +V +FE + L ++ NPFI      +   
Sbjct: 263 ----RRLAPEPAPTRGFNIEDYARCRVELARRRVEEFEQQKLQVQKNPFIRAAAACSPYA 318

Query: 304 S--------------YLNRSFQLMINSIPELTLEKKKAIRQA 331
           +               L+RS+  ++++IP L   K + +  A
Sbjct: 319 TTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTKARELAAA 360

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  117 bits (294), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 106/345 (30%), Positives = 169/345 (48%), Gaps = 40/345 (11%)

Query: 29  LLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDI 88
           +L K+V  +L  +++   + N A D L+ L+ VQ++ + + L  L+LLQRR S AT++D+
Sbjct: 40  ILRKTVLFQLNSLDI--CISNFALDELVNLVAVQMDGMFRNLHNLALLQRR-SRATQADL 96

Query: 89  LLLLKGFXXXXXXXXXXXXXXXHIKRLYS-EDEKKLSEDSIHYNQHTDFVGPVETSSFQ- 146
            LL K F                IK  +S E EK +S  S   + H +     E ++ + 
Sbjct: 97  KLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVSSSSFSASSHNEEDEEDELNNIEE 156

Query: 147 -------LLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVK 199
                  LL P+NPL+  +PSW P+ PPDHTY+FTP++N+ I D K IK++   ESK  +
Sbjct: 157 QQNEISVLLPPSNPLEKLMPSWLPNFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESE 216

Query: 200 TALFNLINK-----IESNEERNDLHYDETLAKLESQALFGTVEEKMNTNKKVYKSLNSII 254
            AL NL  +     + S+     L  D    + + +     ++E+  T   + KS N   
Sbjct: 217 KALLNLNKRLLHISLASHAPPPRLPDDADAGEQQLEIWGNALQEEKRT--AISKSFN--- 271

Query: 255 VPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLINDQTDVKS---------- 304
               + +IE+Y+  RV +AR +VSKFE   L    NPF+ +       KS          
Sbjct: 272 ----ENNIEQYAKYRVELARERVSKFEVNQLKRTKNPFLRISETLYSSKSPHQPHRAIQR 327

Query: 305 ----YLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLRED 345
                  +S  L  +++P++   KK+ IR A  ER   + R +E+
Sbjct: 328 AIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIEERSRSLKRRQEE 372

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  115 bits (288), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 96/358 (26%), Positives = 176/358 (49%), Gaps = 48/358 (13%)

Query: 15  EIRRQITGNPQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLS 74
           EI R    +P L  LL K+VA++LK VN +  +   AF+ LI L++  L++++  L ++ 
Sbjct: 29  EIPRTALDDP-LRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSNMLVDLHKMV 87

Query: 75  LLQRRNSNATKSDILLLLKGFXXXXXXXXXXXXXXXHIKR---------------LYSED 119
            +QRR+   +K D+LL++ G+               +++                + +++
Sbjct: 88  NIQRRHC-ISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLERVRKVREESEVVEAKE 146

Query: 120 EKKLSEDSIHYNQHTDFVGPVETSSFQLLNPTNPLKDA-IPSWFPSLPPDHTYKFTPKYN 178
           +  LSE  +  ++H +F   ++      L P  P     +P W P  PPDHTY+FT ++N
Sbjct: 147 KTPLSEKELLESKHLEFF--IQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYRFTSQFN 204

Query: 179 NFINDPKIIKQKRFDESKTVKTALFNL--INKIESNEERNDLHYDETL--AKLESQALFG 234
             I D +++K+K  +E+   + AL +L  ++  ES  E  D   DE    ++ ++Q +FG
Sbjct: 205 RPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGAD--SDEIFKESQQDTQLIFG 262

Query: 235 TVEE----KMNTNKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYN 290
             ++     +N    + ++L     P   +++EEY+  RV IAR KV ++E   L L+  
Sbjct: 263 PAKKTKIAAINGASDLLRTL-----PQQNYNVEEYARNRVEIARRKVEEYERHQLLLQKG 317

Query: 291 PFI-------------NLINDQTDVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIER 335
            FI             N    + +V++ L+RS+  ++ S P L  ++K+ +  AE  R
Sbjct: 318 AFIKAAHLLSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQRKREVELAEENR 375

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score =  108 bits (269), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 142/303 (46%), Gaps = 28/303 (9%)

Query: 64  NDLIKQLGRLSLLQRRNSNATKSDILLLLKGFXXXXXXXXXXXXXXXHIK----RLYSED 119
           + ++ +L R++ +QRR  +AT  D+ LLL+GF                I     ++  E 
Sbjct: 79  SGMVTELHRIATVQRRQ-HATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRMQVPREQ 137

Query: 120 EKKLSEDSIHY-------NQHTDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYK 172
             +L + +  Y       NQ     G   +   Q L    P+ + IP+W P LPP+HTYK
Sbjct: 138 TVQLQDATGSYDRFKLVENQQLIASGLSGSDMSQEL----PIAEKIPAWLPKLPPNHTYK 193

Query: 173 FTPKYNNFINDPKIIKQKRFDESKTVKTALFNLINKIESN-----EERNDLHYDETLAKL 227
           FT +YN  +ND K++K+K   ES  ++ +L NL+   + +     +ER      E L ++
Sbjct: 194 FTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDRDADTKVDERARETPPEELKRI 253

Query: 228 ESQ--ALFGTVEEKMNTNKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKML 285
           + +  AL+G +EE    ++       + +     FD++ YS  RV +ARN V +FE +  
Sbjct: 254 DDEIVALYGPLEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLGRVKLARNAVQRFEWETK 313

Query: 286 ALKYNPFIN----LINDQTDVKSYLNRSFQLMIN-SIPELTLEKKKAIRQAEIERDERIN 340
               NPF+     +  +   V S L  S   ++   +P L   K  AI  A  +RD ++ 
Sbjct: 314 YRPRNPFLCSHRAVPENSKKVYSMLENSLNELVQVDLPRLESRKAAAIAHAVEQRDAKLA 373

Query: 341 RLR 343
            LR
Sbjct: 374 ELR 376

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 90/360 (25%), Positives = 174/360 (48%), Gaps = 53/360 (14%)

Query: 22  GNPQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNS 81
            NP ++ L  ++V ++LK +N +  +   AFD L Y+  +QL+DL++ L +++ +QRR +
Sbjct: 35  ANP-MERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQLDDLLQSLKKITQVQRR-T 92

Query: 82  NATKSDILLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDE---------------KKLSED 126
             +K D+ L  KG                 +   + ++                K+L E 
Sbjct: 93  KISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNETVLKVKQQFMKELEEK 152

Query: 127 SIHYNQHTDF-VGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPK 185
            +  ++H++F V  V+     LL  +N     +PSW P LPPDHTYKFT  Y   I D +
Sbjct: 153 ELLSSKHSEFFVQDVDI--LNLLPSSNKSNKYVPSWLPELPPDHTYKFTSLYKRPITDER 210

Query: 186 IIKQKRFDESKTVKTALFNLINKI-----------ESNEERNDLHYDETL--AKLESQAL 232
           ++K+K  +E +  + AL N+++++           +S++  N+    E +  ++LE+  +
Sbjct: 211 LMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALSEHIKESQLETDLI 270

Query: 233 FG-----TVEEKMNTNKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKMLAL 287
           F        +++  T   ++   +  + P+  F++ EY  KR  I + +  + EN++   
Sbjct: 271 FDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKRDAIVKRRAERAENQVSNK 330

Query: 288 KYNPFIN--LIND-------------QTDVKSYLNRSFQLMINSIPELTLEKKKAIRQAE 332
           + NPFI   +I               +  +K+ L RS+  +I+SIP +   +++A ++AE
Sbjct: 331 RRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGLIDSIPRVKEVRERARKEAE 390

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score = 78.6 bits (192), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 103/240 (42%), Gaps = 33/240 (13%)

Query: 4   SIEDDMNVEPLEIRRQITGNPQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQL 63
            ++++ +V+  EI      + Q+  LL ++V ++L+ ++    +   A D L+   + QL
Sbjct: 12  GVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQL 71

Query: 64  NDLIKQLGRLSLLQRRNSNATKSDILLLLKGFXXXXXXXXXXXXXXXHIKRLYSEDEKKL 123
           N L+  L R+SLLQRR S A  SD+ + ++G+                I+  Y  D   +
Sbjct: 72  NALVDGLHRISLLQRRQSIAV-SDLEIWMRGYNLLPSDLYMTAEESKFIRENYRNDTSVV 130

Query: 124 SEDSIHYNQHTDFVGPVETSSFQLLNPTNPLKDAI------------------------- 158
            +D    N     +G +   + + + PT+   D                           
Sbjct: 131 FKDINIDNPMESALGRINIQNKENIEPTDNDVDIDEDDDYELIELQQHAMEQLFKTDTGR 190

Query: 159 -------PSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVKTALFNLINKIES 211
                  P W P  PPDHTYK+TP Y N +     I+QK  +E +  + AL  L++ ++S
Sbjct: 191 GRNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKLMSNLDS 250

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 80/156 (51%), Gaps = 27/156 (17%)

Query: 221 DETLAKLESQALFGTVE-------EKMNTN--KKVYKSLNSIIVPITK---FDIEEYSHK 268
           +E LA LE +AL   +E       E M  +  K V K L+S   P +K   FD+E Y+ +
Sbjct: 349 EEELADLEIKALLYRIENNKEYLIEPMRVSLLKGVLKDLDS--NPTSKLKDFDVEAYARQ 406

Query: 269 RVNIARNKVSKFENKMLALKYNPFINLI----------NDQTDVKSYLNRSFQLMINSIP 318
           R+ IAR KV  FE + L LKYNP + L           + +T+ +  + R+      +IP
Sbjct: 407 RIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFETEYQKCIKRTMDRFKRNIP 466

Query: 319 ELTLEKKKAIRQAEIER-DERI-NRLREDHQTKLKQ 352
            +  EK+K +R+  I+R DE I  RL    + K+K+
Sbjct: 467 -IIKEKRKMVRKESIKRKDELIAKRLATIKEAKMKK 501

>TPHA0B01610 Chr2 complement(361146..364658) [3513 bp, 1170 aa] {ON}
           
          Length = 1170

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 5/70 (7%)

Query: 315 NSIPELTLEKKKAIRQAEIERDERINRLREDHQTKLKQIDTISHDIL-----GTAADEMD 369
           N IP   L  K+ +  AE+  +    + RED+ TK  ++D +++ +L      T  D   
Sbjct: 131 NGIPTFDLTPKEVVEPAEVSSNPYQIQGREDYGTKGTKVDVLTNQMLLSLGNDTVVDAKT 190

Query: 370 EKTMDDIDLF 379
           EK    ID++
Sbjct: 191 EKLKTPIDVW 200

>TBLA0D05440 Chr4 complement(1340416..1343934) [3519 bp, 1172 aa]
           {ON} Anc_1.274 YJL092W
          Length = 1172

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 6/78 (7%)

Query: 185 KIIKQKRFDESKTVKTALFNLINKIESNEERNDL-----HYDETLAKLESQALFGTVEEK 239
           KII+   F E K V T L NL+  + SNEE+N +     +  + L  +  + +    +E 
Sbjct: 418 KIIRGHAFWELKEVSTML-NLLKCVNSNEEKNAILSCLTYPSKGLGPVSIEKISKIFDEH 476

Query: 240 MNTNKKVYKSLNSIIVPI 257
              + ++ KS+N+ I+P+
Sbjct: 477 DGPSFEILKSINNRIIPV 494

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,582,405
Number of extensions: 2437444
Number of successful extensions: 16091
Number of sequences better than 10.0: 620
Number of HSP's gapped: 15549
Number of HSP's successfully gapped: 767
Length of query: 453
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 340
Effective length of database: 40,524,141
Effective search space: 13778207940
Effective search space used: 13778207940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)