Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A026507.194ON31231216800.0
YIL021W (RPB3)7.194ON31831914320.0
Suva_9.1787.194ON31931914290.0
Skud_9.1487.194ON31831914260.0
Smik_9.1697.194ON31831914170.0
NCAS0E018307.194ON31832114020.0
NDAI0G020007.194ON31131713960.0
CAGL0J02420g7.194ON31231513830.0
TDEL0H025307.194ON31131613790.0
ZYRO0D15796g7.194ON30831313560.0
Kpol_1063.117.194ON31631613530.0
TPHA0C045107.194ON31031513320.0
TBLA0J015207.194ON33531013340.0
KNAG0H027007.194ON32632613320.0
SAKL0F07458g7.194ON31531612950.0
ADL120C7.194ON31131712701e-177
KLTH0E04598g7.194ON32829712651e-176
Kwal_55.203807.194ON32332512551e-175
KLLA0D16170g7.194ON30731212481e-174
Ecym_43827.194ON31131212331e-171
CAGL0B04125g3.428ON3342942412e-22
Kpol_1018.1393.428ON3352952367e-22
KAFR0A055203.428ON3343022281e-20
ZYRO0C12364g3.428ON3352952272e-20
Kpol_473.33.428ON3202992252e-20
NDAI0A047703.428ON3352932244e-20
TPHA0D039203.428ON3353002182e-19
KLLA0D14861g3.428ON3342892173e-19
KNAG0A076003.428ON3342902149e-19
TDEL0F031003.428ON3351962121e-18
NCAS0A115203.428ON3352952112e-18
Suva_16.4383.428ON3352922112e-18
SAKL0F06028g3.428ON3342942112e-18
ADR031C3.428ON3641962103e-18
YPR110C (RPC40)3.428ON3352962094e-18
TBLA0F017003.428ON3331952085e-18
KLTH0F12056g3.428ON3501822085e-18
Ecym_44503.428ON3342922069e-18
Smik_16.3533.428ON3352962069e-18
Kwal_23.39983.428ON3341932051e-17
Skud_16.3973.428ON3352852042e-17
Kpol_1075.58.238ON217569703.3
KNAG0B004103.544ON77181676.2
NDAI0D021005.167ON56080669.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A02650
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.19...   651   0.0  
YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA pol...   556   0.0  
Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W (...   555   0.0  
Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W (...   553   0.0  
Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W (...   550   0.0  
NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.19...   544   0.0  
NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.19...   542   0.0  
CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {...   537   0.0  
TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.19...   535   0.0  
ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa] ...   526   0.0  
Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa] ...   525   0.0  
TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON...   517   0.0  
TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7....   518   0.0  
KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.19...   517   0.0  
SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {O...   503   0.0  
ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON} Sy...   493   e-177
KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar...   491   e-176
Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W...   488   e-175
KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa] ...   485   e-174
Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to...   479   e-171
CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {...    97   2e-22
Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON} (370...    96   7e-22
KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON} Anc_3...    92   1e-20
ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {...    92   2e-20
Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON} com...    91   2e-20
NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON} Anc_3...    91   4e-20
TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {O...    89   2e-19
KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]...    88   3e-19
KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa] ...    87   9e-19
TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {O...    86   1e-18
NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa] ...    86   2e-18
Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {...    86   2e-18
SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {...    86   2e-18
ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON} S...    86   3e-18
YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON} ...    85   4e-18
TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.4...    85   5e-18
KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} high...    85   5e-18
Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar t...    84   9e-18
Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {...    84   9e-18
Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C...    84   1e-17
Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {...    83   2e-17
Kpol_1075.5 s1075 complement(13967..20494) [6528 bp, 2175 aa] {O...    32   3.3  
KNAG0B00410 Chr2 (69475..71790) [2316 bp, 771 aa] {ON} Anc_3.544...    30   6.2  
NDAI0D02100 Chr4 complement(488629..490311) [1683 bp, 560 aa] {O...    30   9.4  

>KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.194
           YIL021W
          Length = 312

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/312 (100%), Positives = 312/312 (100%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV
Sbjct: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQDAFYSNMP 300
           DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQDAFYSNMP
Sbjct: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQDAFYSNMP 300

Query: 301 NSNANGIYDNAW 312
           NSNANGIYDNAW
Sbjct: 301 NSNANGIYDNAW 312

>YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA
           polymerase II third largest subunit B44, part of central
           core; similar to prokaryotic alpha subunit
          Length = 318

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/319 (85%), Positives = 288/319 (90%), Gaps = 8/319 (2%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQELKLTC+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YWYEQD  KEWP SKNCEYEDPPNE DPFDYKA+ADTFYMNVE+VGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASG--ATADMNQG---DIAMGGAEQDAF 295
           DQVVVRG+DTLQKKVASILLAL QMDQ+KVN+ASG   TA    G   D+ M GAEQD +
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300

Query: 296 Y--SNMPNSNANGIYDNAW 312
              S M N+ + G YDNAW
Sbjct: 301 SNASQMGNTGSGG-YDNAW 318

>Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W
           (REAL)
          Length = 319

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/319 (84%), Positives = 289/319 (90%), Gaps = 7/319 (2%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFIL++VDLAMANSLRR+MIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNLLGRNIGHP+IQDKEGNGVLICKLRKGQELKLTC+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YWYEQD  KEWP SKNCEYEDPPNE D FDYKA+ADTFYMNVE+VGSI+V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASG---ATADM--NQGDIAMGGAEQDAF 295
           DQVVVRG+DTLQKKVASILLAL QMDQ+KVN+ASG     ++M     D+ M GAEQD +
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300

Query: 296 --YSNMPNSNANGIYDNAW 312
              S M N+ ++G YDNAW
Sbjct: 301 ANASQMGNTGSSGGYDNAW 319

>Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/319 (84%), Positives = 288/319 (90%), Gaps = 8/319 (2%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KD VDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDGVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQELKLTC+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YWYEQD  KEWP SKNCEYEDPPNE DPFDYKA+ADTFYMNVE+VGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASG---ATADM--NQGDIAMGGAEQDAF 295
           DQVVVRG+DTLQKKVASILLAL QMDQ+KVN+ASG   A  +M     D+ M GAEQD +
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNAAPNMLGTNEDVVMTGAEQDPY 300

Query: 296 Y--SNMPNSNANGIYDNAW 312
              S M N+ ++G YDNAW
Sbjct: 301 SNASQMGNTGSSG-YDNAW 318

>Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/319 (84%), Positives = 285/319 (89%), Gaps = 8/319 (2%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREA+KDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQELKLTC+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YWYEQD  KEWP SKNCEYED PNE DPFDYKA+ADTFYMNVE+VGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDAPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASG-----ATADMNQGDIAMGGAEQDAF 295
           DQVVVRG+DTLQKKVASILLAL QMDQ+KVN+ASG     +       D+ M GAEQD +
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNPSSNILGTNEDVMMAGAEQDPY 300

Query: 296 Y--SNMPNSNANGIYDNAW 312
              S M NS + G YD+AW
Sbjct: 301 SNASQMGNSGSGG-YDSAW 318

>NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.194
           YIL021W
          Length = 318

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/321 (84%), Positives = 287/321 (89%), Gaps = 12/321 (3%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILSNVDLA+ANS RRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNLLGRNIGHPIIQD+EGNGVLICKLRKGQELK+TCIAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YWYEQD  KEWPNSKNCEYEDPPNE + FDYKAKA+TFYMNVETVGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYA------SGATADMNQG--DIAM-GGAE 291
           DQVVVRGVDTLQKKVASILLAL QMDQEKVN+A      SG    MN G  D+ M GG E
Sbjct: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREGMMNGGDNDVNMDGGME 300

Query: 292 QDAFYSNMPNSNANGIYDNAW 312
           Q++ Y+N+  +N  G YDNAW
Sbjct: 301 QNS-YANV--ANPGGAYDNAW 318

>NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/317 (84%), Positives = 286/317 (90%), Gaps = 11/317 (3%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREATKDNVDFILSN+DLA+ANS RRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNIDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNLLGRNIGHPIIQDKE NGVLICKLRKGQELKLTC+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKENNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YWYEQDP+KEWPNSKNCEYEDPPNE +PFDYKAKA+TFYMNVETVGSISV
Sbjct: 181 DPWNKLKHTDYWYEQDPQKEWPNSKNCEYEDPPNEGEPFDYKAKAETFYMNVETVGSISV 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATAD-----MNQGDIAMGGAEQDAF 295
           DQVVVRG++TLQ+KVASILLAL QMDQEK+ YA+          MNQ D+ M G   DA 
Sbjct: 241 DQVVVRGINTLQQKVASILLALTQMDQEKMQYATVTEGQQGNNMMNQ-DVDMDG---DA- 295

Query: 296 YSNMPNSNANGIYDNAW 312
           Y+N  N N  G Y++AW
Sbjct: 296 YANGAN-NQPGAYNDAW 311

>CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021w RPB3
          Length = 312

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/315 (82%), Positives = 282/315 (89%), Gaps = 6/315 (1%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREAT+DNVDFILSNVDLA+ANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EF+AHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKL+HT+YWYE+D  KEWP SKNCEYEDPPN+++PFDYKAKADTFYMNVE VGSI+V
Sbjct: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASG---ATADMNQGDIAMGGAEQDAFYS 297
           DQVV+RG+DTLQKKVASI+LALNQMDQEKVN+A+G          GD  M     D  Y 
Sbjct: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMMMNG-HDGPYG 299

Query: 298 NMPNSNANGIYDNAW 312
           +  N  ++  Y +AW
Sbjct: 300 D--NGRSSDTYGSAW 312

>TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/316 (81%), Positives = 277/316 (87%), Gaps = 9/316 (2%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILS VDLAMANSLRR+M+AEIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQSTDIEQLEY RDCFCEDHCDKCSVVLTLQA+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQEL + C+AKKGISKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YWYEQD  KEWP SKN EYEDPPN++D FDYKAKA+TFYMNVETVGSI+ 
Sbjct: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYA----SGATADMNQGDIAMGGAEQDAFY 296
           DQVV+RG+DTLQKKVASILLALNQMDQE+VN+     +GA  D    D+AM G +     
Sbjct: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQ----- 295

Query: 297 SNMPNSNANGIYDNAW 312
              P SN  G YD AW
Sbjct: 296 DQNPYSNGGGAYDEAW 311

>ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 308

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/313 (80%), Positives = 279/313 (89%), Gaps = 6/313 (1%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREAT++NVDFILS+V+LAMANSLRRVMIAEIPTLAIDSVEVETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATRENVDFILSHVELAMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQSTDIEQLEY RDCFCEDHCDKCSVVLTLQA+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNL+GRN+GHPIIQDKEGNGVLICKLRKGQEL L C+AKKGI+KEHAKW P+AAIEFEY
Sbjct: 121 VSNLMGRNLGHPIIQDKEGNGVLICKLRKGQELTLKCVAKKGIAKEHAKWGPSAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT YW+EQDP KEWP SKN EYEDPPNE +PFDY+A A+TFYMNVE+VGS+S 
Sbjct: 181 DPWNKLKHTEYWHEQDPAKEWPLSKNSEYEDPPNEGEPFDYRATANTFYMNVESVGSLST 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGA-TADMNQGDIAMGGAEQDAFYSNM 299
           DQVV+RG+DTLQKKVASILLAL QMDQ+KVN+ASGA    +  GD  M G   D  Y   
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVNFASGAPMGAVGDGDTMMNG--DDYPYG-- 296

Query: 300 PNSNANGIYDNAW 312
             +  +G+YD++W
Sbjct: 297 -ATGGSGVYDDSW 308

>Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa]
           {ON} (29092..29787,29789..30043) [951 nt, 317 aa]
          Length = 316

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/316 (81%), Positives = 277/316 (87%), Gaps = 4/316 (1%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREATKDNVDFILS+VD+A+ANSLRRVMIAEIPTLAIDSVEV TNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSHVDMALANSLRRVMIAEIPTLAIDSVEVITNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGL+PLQSTDIEQLEY RDCFCEDHCDKCSVVLTLQAVGESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYSKDLDI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT++W+EQDP KEWP SKNCEYEDPP+E + FDYKA+AD F    ETVG+IS 
Sbjct: 181 DPWNKLKHTDFWFEQDPAKEWPQSKNCEYEDPPHEGEVFDYKAQADAFLYECETVGTISS 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYAS----GATADMNQGDIAMGGAEQDAFY 296
           DQVV+RG+DTLQKKVASILLAL QMDQ+KV YA     GA      GDI MGG   D + 
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVKYAGNTNIGAGGMEGNGDINMGGTGNDPYS 300

Query: 297 SNMPNSNANGIYDNAW 312
           +N      NG+YD+AW
Sbjct: 301 NNGGEMGGNGVYDDAW 316

>TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON}
           Anc_7.194 YIL021W
          Length = 310

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/315 (79%), Positives = 272/315 (86%), Gaps = 8/315 (2%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MS+EGPQVKIREATKDNVDFI+SNVDLAMAN+ RRVMIAEIPTLAIDSVEV +NTTVLAD
Sbjct: 1   MSDEGPQVKIREATKDNVDFIVSNVDLAMANAFRRVMIAEIPTLAIDSVEVISNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGL+PLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA+GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSADIEQLEYSRDCFCEDHCDKCSVVLTLQALGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VS+LLGRNIGHPIIQDKEGNGVLICKLRKGQELK TCIAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSDLLGRNIGHPIIQDKEGNGVLICKLRKGQELKFTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT YWYEQD  KEWP SKNCEYEDPPNE   FDYKAKADTFYMNVET+G+++ 
Sbjct: 181 DPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSEFDYKAKADTFYMNVETIGTVTS 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEK---VNYASGATADMNQGDIAMGGAEQDAFYS 297
           DQV+VRG+D LQKKVASILLALN++DQ+K       +    +M+  DI M G E D + S
Sbjct: 241 DQVIVRGIDILQKKVASILLALNRLDQDKVNYAGNNNVNNGEMDGEDITMNGTENDPYAS 300

Query: 298 NMPNSNANGIYDNAW 312
              NS     YD AW
Sbjct: 301 GNNNS-----YDGAW 310

>TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7.194
           YIL021W
          Length = 335

 Score =  518 bits (1334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/310 (79%), Positives = 275/310 (88%), Gaps = 3/310 (0%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQ+KIREATKDNVDFILSN+D+A+ANSLRRVMIAEIPTLAIDSVEVE NTTVLAD
Sbjct: 1   MSEEGPQIKIREATKDNVDFILSNIDMALANSLRRVMIAEIPTLAIDSVEVEMNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFI+HRLGLIPLQS DI+QLEY RDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSADIDQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELK+TC+AKKGI+KEHAKW   AAIE+EY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKMTCVAKKGIAKEHAKWGATAAIEYEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YWYE DP KEWP+SKNC+YEDPP E + FDYKAKA+TFYMNVE VGSI+ 
Sbjct: 181 DPWNKLKHTDYWYENDPLKEWPHSKNCQYEDPPTEGELFDYKAKANTFYMNVEAVGSITT 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGA--TADMNQGDIAMGGAE-QDAFYS 297
           DQV++RG+DTLQKK A ILLAL+QM+QEKVN+ +G     D++Q D  MG +   DA Y 
Sbjct: 241 DQVIIRGIDTLQKKTAGILLALSQMEQEKVNFGTGTQDNNDLHQQDDHMGMSNGNDASYG 300

Query: 298 NMPNSNANGI 307
           N   SN +G+
Sbjct: 301 NYMGSNNDGM 310

>KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.194
           YIL021W
          Length = 326

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/326 (77%), Positives = 282/326 (86%), Gaps = 14/326 (4%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA +DNVDFILSNV+LAMANSLRRVM+AEIPTLAIDSV+VETNTTVLAD
Sbjct: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DIE+LEY RDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI
Sbjct: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKE NGVLICKLRKGQELK+TCIAKKGI+KEHAKW P +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YWYE D  +EWPNS+NCEYEDPP E +PFDYK+KA+TFYMNVET+GSISV
Sbjct: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGA--------EQ 292
           DQVVVRG+DTLQKKVASILL+L QM+QEK N+A G    +    I  GGA        +Q
Sbjct: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGNDQ 300

Query: 293 DAFYSN------MPNSNANGIYDNAW 312
           D +  N      + + + +G+YD+AW
Sbjct: 301 DMYVPNAGTGGNIGSGSGSGVYDDAW 326

>SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 315

 Score =  503 bits (1295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/316 (76%), Positives = 271/316 (85%), Gaps = 5/316 (1%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREATKD+VDFILSNVD+A+ANS RRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQELKL CIAKKGISKEHAKW PA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YWYEQD   EWP SKNCEYEDPPNE+D FDY AK +TFYM+VETVGS++ 
Sbjct: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQ--DAFYSN 298
           DQVV+RG+ TLQ KVA IL +L +MDQE+VN+  GA  + +  D+AM G  +  D + SN
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFG-GAGGNADNVDVAMDGENEMSDPYTSN 299

Query: 299 MP--NSNANGIYDNAW 312
               N   +  +D+AW
Sbjct: 300 QDQYNGGPSAGFDDAW 315

>ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL021W
           (RPB3)
          Length = 311

 Score =  493 bits (1270), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 236/317 (74%), Positives = 271/317 (85%), Gaps = 11/317 (3%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREATKDNVDFILSNVDL++ANSLRR+MIAEIPTLAIDSVE+E+NT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFI+HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL AVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL+L C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKL+HT+YW+EQDPE EWP+SKNCE+EDPPNE+D FDY AK +TFYMNVE+VGSI  
Sbjct: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQDAFYS--- 297
           DQVV+RG+ TLQ KVA IL +L +MDQ+KV +  G T     GD A    +QD + +   
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-GPT-----GDAAPMEVDQDPYSATSG 294

Query: 298 --NMPNSNANGIYDNAW 312
             N  N NA+  YD+AW
Sbjct: 295 RFNEYNDNAHAAYDDAW 311

>KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar to
           uniprot|P16370 Saccharomyces cerevisiae YIL021W
          Length = 328

 Score =  491 bits (1265), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 235/297 (79%), Positives = 260/297 (87%), Gaps = 2/297 (0%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREATKDNVDFILSNVD+ MANSLRRVMIAEIPTLAIDSVEVETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFI+HRLGLIPLQS+DI  L Y RDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNL+GRNIGHPIIQDK+GNGVLICKLRKGQELKL C+AKKGISKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YW+E D   EWP SKNCEYEDPPNE++ FDY AK  TFYMNVETVGS++V
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYNAKPTTFYMNVETVGSLTV 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQDAFYS 297
           DQVV+RG+ TLQ KVA IL +L +MDQ+KVN+  G TA M   D      E D+ ++
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNF--GGTAGMVDQDGGAMPVEPDSGFA 295

>Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W
           (RPB3) - 45 kDa subunit of RNA polymerase II [contig
           149] FULL
          Length = 323

 Score =  488 bits (1255), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 235/325 (72%), Positives = 269/325 (82%), Gaps = 15/325 (4%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREATKDNVDFILSNVD+AMANSLRRVMIAEIPT+AIDSVEVETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFI+HRLGL+PLQS+DI  L Y RDC+CED+CD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VSNLLGRNIGHPIIQDK+ NGVLICKLRKGQELKL C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YW+E D   EWP SKNCEYEDPPNE+D FDY+AK  TFYMNVE+VGS++V
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQDA------ 294
           DQVV+RG+ TLQ KVA IL +L +MDQ+KVN+  G  A + + D     AE ++      
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNF--GGAAGLAEQDGGAMAAEPESGFGYGN 298

Query: 295 -------FYSNMPNSNANGIYDNAW 312
                     +  NS  +  +D+AW
Sbjct: 299 GGAGGGPGAGDFHNSGPSSGFDDAW 323

>KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 307

 Score =  485 bits (1248), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/312 (74%), Positives = 265/312 (84%), Gaps = 5/312 (1%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREATKDNVDFILSNVDLA+ANSLRRVMI+EIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLALANSLRRVMISEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DI+Q+ Y RDC+CEDHCD+CSV L L A+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSADIDQVVYCRDCYCEDHCDRCSVELILHAIGESESTTNVYAKDLQI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
            S+L GRNIGHPIIQD+E NGVLICKLRKGQE+++ CIAKKGISKEHAKW P+AAIEFEY
Sbjct: 121 TSDLKGRNIGHPIIQDREANGVLICKLRKGQEIRVKCIAKKGISKEHAKWSPSAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YWYEQD   EWP SKNCE+EDPPNE++ FDY+AK +TFY+NVE+VGSI+ 
Sbjct: 181 DPWNKLKHTDYWYEQDARDEWPQSKNCEFEDPPNEDEDFDYRAKPNTFYINVESVGSITS 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQDAFYSNMP 300
           +QVVVRG+ TLQ KVA IL +L +MDQEKVN+A+GA +      + M   E+D      P
Sbjct: 241 EQVVVRGIKTLQDKVADILFSLKKMDQEKVNFAAGAVSTHVSQQVPM---EEDMDPYGGP 297

Query: 301 NSNANGIYDNAW 312
              +   YD+AW
Sbjct: 298 VGGSG--YDDAW 307

>Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADL120C
          Length = 311

 Score =  479 bits (1233), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/312 (73%), Positives = 264/312 (84%), Gaps = 1/312 (0%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MSEEGPQVKIREATKDNVDFILSNVDL++ANSLRR+MIAEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFI+HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120

Query: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL+L C+AKKGISKEHAKW PAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240
           DPWNKLKHT+YW+EQD   EWP+SKNCE+EDP N++D FDY AK + FY+NVE+VGSI+ 
Sbjct: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240

Query: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQDAFYSNMP 300
           DQVV+RG+ TLQ KVA IL +L +MDQ+KV +  G T++    ++            N  
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-GPTSENAPMEVDHDPYSGTNGQYNEY 299

Query: 301 NSNANGIYDNAW 312
           N N N  YD+AW
Sbjct: 300 NDNTNTAYDDAW 311

>CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110c RPC40 DNA-directed RNA polymerase I
           III
          Length = 334

 Score = 97.4 bits (241), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 83/294 (28%), Positives = 138/294 (46%), Gaps = 59/294 (20%)

Query: 7   QVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           QV   E  + N D I   +D ++AN+ RR+MIAE+P +A + V ++ NT+V+ DE +AHR
Sbjct: 43  QVSSHEERELNFDMI--GIDTSLANAFRRIMIAEVPAVAPEYVYIQNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQ--STDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESE--------------ST 110
           +GL+PL+     +E+L+ S     E H DK ++V+TL                     + 
Sbjct: 101 IGLVPLKVDPEKLERLDTSDPDNLEFH-DKNTIVMTLNVKCTRNPDAPKDCTDPTILYNN 159

Query: 111 TNVYAKDLTI--VSNLLGRNIGHPIIQ-DKEGNGVLICKLRKGQELKLTCIAKKGISKEH 167
            +VYA+DL     S+ +      P++  D +   +L+ KLR GQE+ L+     G  K+H
Sbjct: 160 AHVYARDLKFEPHSSQVETFADCPVVPCDPD---ILLAKLRPGQEISLSTHCILGEGKDH 216

Query: 168 AKWCPAAAIEFEYDPWNK-----------------------LKHTNYWYEQDPEKEWPNS 204
           AK+ P A   +   P  +                       +      Y  DP K+  + 
Sbjct: 217 AKFSPVATASYRLLPHIEILEPITGDSAKRFQACFPKGVIGINENGEAYVLDPRKDTVSR 276

Query: 205 KNCEYEDPPNENDPFDYKAK----ADTFYMNVETVGSISVDQVVVRGVDTLQKK 254
           +   +E+       F+ K K     D F  NVE+ G++  + +V++ +D L+KK
Sbjct: 277 EVLRHEE-------FEGKVKLGRVRDHFVFNVESTGAMQPEDIVLKSIDILKKK 323

>Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON}
           (370051..371058) [1008 nt, 336 aa]
          Length = 335

 Score = 95.5 bits (236), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 135/295 (45%), Gaps = 59/295 (20%)

Query: 7   QVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           ++ I        +F L N+D ++AN+ RR+MI+E+P++A++ V    NT+VL DE +AHR
Sbjct: 41  EINISSINSREANFDLINIDTSIANAFRRIMISEVPSVAVEYVYFLNNTSVLQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQAVGESE--------------ST 110
           +GL+PL+  D + L +      E+    D+ ++VL+L                       
Sbjct: 101 IGLVPLK-VDPDMLSWIDSELPEEEKFTDENTIVLSLNVKCTMNPDAPKDCTDPKILYKN 159

Query: 111 TNVYAKDLTIVSNLLGRNI----GHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKE 166
           +NVYA+DL       G+ +     +P++       +L+CKLR GQE+ L      GI  +
Sbjct: 160 SNVYARDLKFEPQ--GKQVESFANYPVV--PANPDILLCKLRPGQEISLKAHCILGIGSD 215

Query: 167 HAKWCPAAAIEFEYDPWNKL----------KHTNYW-------------YEQDPEKEWPN 203
           HAK+ P A   +   P   +          K   Y+             Y +D  K+  +
Sbjct: 216 HAKFSPVATASYRLMPHINITQPITGEDAKKFQKYFMPGVIGINDNGEAYVKDARKDTVS 275

Query: 204 SKNCEYEDPPNENDPFDYKAK----ADTFYMNVETVGSISVDQVVVRGVDTLQKK 254
            +   + +       F+ K K     + F +NVE+ G+++ +++  + V  L+ K
Sbjct: 276 REVFRHPE-------FEGKVKLGRVRNHFIVNVESTGAMTPEEIFFKSVRILRNK 323

>KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON}
           Anc_3.428 YPR110C
          Length = 334

 Score = 92.4 bits (228), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 132/302 (43%), Gaps = 65/302 (21%)

Query: 3   EEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEF 62
            E   VKI    +   +F L ++D ++AN+ RR+MI+E+P +A++ V    NT+V+ DE 
Sbjct: 37  RESFDVKISSMNEREANFDLVHIDTSVANAFRRIMISEVPAVAVEYVYFLNNTSVIQDEV 96

Query: 63  IAHRLGLIPLQSTDIEQLEYSRDCFCEDH--CDKCSVVLTLQAVGESE------------ 108
           +AHR+GL+PL+  D + L +      +D    D+ ++VLTL                   
Sbjct: 97  LAHRIGLVPLK-VDPDMLTWIDSSLPDDEKFTDENTIVLTLNVKCTRNPDAPRDCTDPNI 155

Query: 109 --STTNVYAKDLTIVSNLLGRNIGHPIIQDKEGNGVLIC-------KLRKGQELKLTCIA 159
               +NVYA DL       G+      ++    N V+ C       KLR GQE+ L    
Sbjct: 156 LYRNSNVYASDLKFEPQ--GKQ-----VETFANNAVVPCDPKILLAKLRPGQEISLRAHC 208

Query: 160 KKGISKEHAKWCPAAAIEFEYDP---------------WNK--------LKHTNYWYEQD 196
             GI  +HAK+ P A   +   P               + K        +K     Y QD
Sbjct: 209 ILGIGSDHAKFSPVATASYRLLPHIEITEPITGESAKRFQKCFPAGVIGIKENGDAYVQD 268

Query: 197 PEKEWPNSKNCEYEDPPNENDPFDYKAK----ADTFYMNVETVGSISVDQVVVRGVDTLQ 252
             K+  + +   +E+       F+ K K     D F  NVE+ G+++ +++  + V  L+
Sbjct: 269 SRKDTVSREVYRHEE-------FNGKVKLGRIRDHFVFNVESTGAMTPEEIFFKSVRILK 321

Query: 253 KK 254
            K
Sbjct: 322 NK 323

>ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 335

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 132/295 (44%), Gaps = 60/295 (20%)

Query: 8   VKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I   T+   +F L +VD ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRIGSLTEREANFDLVHVDTSIANAFRRIMISEVPSVATEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCFCEDH--CDKCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D + L +      E+    D+ ++V+TL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDHSLPEEEKFTDENTIVMTLNVKCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLTIVSNLLGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEH 167
           ++YA+DL       G  +      P+I       +L+ KLR GQE+ L      G+  +H
Sbjct: 161 HIYARDLKFEPQ--GSQVETFAKCPVIPTDP--DILLAKLRPGQEISLRAHCILGVGSDH 216

Query: 168 AKWCPAAAIEFEYDPWNKLKH------------------------TNYWYEQDPEKEWPN 203
           AK+ P A   +   P   ++                         T+  Y QD  K+  +
Sbjct: 217 AKFSPVATASYRLLPHIDIREPIKGELAQKFQKCFPPGVIGINESTDEAYVQDARKDTVS 276

Query: 204 SKNCEYEDPPNENDPFDYKAK----ADTFYMNVETVGSISVDQVVVRGVDTLQKK 254
            +   +E+       F  K K     D F  NVE+ G+++ +++  + V  L+ K
Sbjct: 277 REVLRHEE-------FSNKVKLGRVRDHFVFNVESTGAMTPEEIFFKSVRVLKNK 324

>Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON}
           complement(6708..7670) [963 nt, 321 aa]
          Length = 320

 Score = 91.3 bits (225), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 134/299 (44%), Gaps = 59/299 (19%)

Query: 3   EEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEF 62
            E  ++ I +  +   +  L NVD ++AN+LRR+MI+E+P++A + + +  NT+V+ DE 
Sbjct: 23  RENLEINISKVGERETNLDLINVDTSIANALRRIMISEVPSVAAEYIYILNNTSVIQDEV 82

Query: 63  IAHRLGLIPLQSTDIEQLEYSRDCFCEDH--CDKCSVVLTLQAVGESE------------ 108
           IA R+GLIPL+  D ++L +  +   ED    D+ ++VL+L                   
Sbjct: 83  IAQRIGLIPLK-VDPDRLTWLNNDLPEDEKFTDENTIVLSLNVKCTRNLDAPKDCTDPSI 141

Query: 109 --STTNVYAKDLTIVSNLLGRN----IGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKG 162
                ++YA+DL       G+        P++       +LI KLR GQE+ L      G
Sbjct: 142 LYHNAHIYARDLKFEPQ--GKQEETFADSPVVS--ADPDILIAKLRPGQEISLRAHCILG 197

Query: 163 ISKEHAKWCPAAAIEFEYDP----WNKLK-------------------HTNYWYEQDPEK 199
           I  +HAK+ P     +   P      K+K                     +  Y +D  K
Sbjct: 198 IGADHAKFSPVCTASYRLMPKIIITEKIKGESAKRFQKCFPPGVIDINENDEAYVKDARK 257

Query: 200 EWPNSKNCEYEDPPNENDPFDYKAKADT----FYMNVETVGSISVDQVVVRGVDTLQKK 254
           +    +   +E+       F  K K D     F  N+ETVG++S +++ ++ V  L+ K
Sbjct: 258 DTMTREVLRHEE-------FQDKVKLDRVRNHFIFNIETVGAMSAEEIFLKSVKILKNK 309

>NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 90.9 bits (224), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 132/293 (45%), Gaps = 52/293 (17%)

Query: 8   VKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I   ++   +F L N+D +MAN+ RR+MI+E+P++A + V   TNT+V+ DE +AHR+
Sbjct: 42  VQITSLSEREANFDLINIDTSMANAFRRIMISEVPSVAAEYVYFLTNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCFCED--HCDKCSVVLTLQAVGESE--------------STT 111
           G+IPL+  D + L +      E+    D  +VV++L                       +
Sbjct: 102 GMIPLK-VDPDMLSWIDTSLSEEEKFTDDNTVVMSLNIKCTRNLNAPKDCTDPKILYHNS 160

Query: 112 NVYAKDLTIVSNLLGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEH 167
           +VYAKDL       G+ +      P++       +L+ KLR  QE+ L      G+  +H
Sbjct: 161 SVYAKDLKFEPQ--GKQVETFAKCPVVPSDP--DILLAKLRPDQEISLRVHCILGVGGDH 216

Query: 168 AKWCPAAAIEFEYDPW-NKLK-----------------------HTNYWYEQDPEKEWPN 203
           AK+ P +   +   P  N LK                        T   Y +D  K+  +
Sbjct: 217 AKFSPVSTASYRLLPHINILKPITGEQAIKFQKCFLPGVIGINEETGEAYVKDARKDTVS 276

Query: 204 SKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISVDQVVVRGVDTLQKKVA 256
            +   +E+    ND        D F  NVE+ G+++ +++  + V  L+ K +
Sbjct: 277 REVLRHEE---FNDKVKLGRIRDHFIFNVESTGAMTPEEIFFKSVRILKNKAS 326

>TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 88.6 bits (218), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 134/300 (44%), Gaps = 61/300 (20%)

Query: 3   EEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEF 62
            E   + I   T+   +F L ++D ++AN+ RR+MIAE+P++A + V    NT+V+ DE 
Sbjct: 37  RESFDIHISSLTEKEANFDLVHIDTSIANAFRRIMIAEVPSVAAEYVYFMNNTSVIQDEV 96

Query: 63  IAHRLGLIPLQSTDIEQLEYSRDCFC--EDHCDKCSVVLTLQAV------GESEST---- 110
           +AHR+GLIPL+  D ++L +        E   D+ ++V+TL A          ++T    
Sbjct: 97  LAHRIGLIPLR-VDPDKLSWIDSELPDEEKFTDENTIVITLDAKCTRNPDAPKDATDPKV 155

Query: 111 ----TNVYAKDLTI-----VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKK 161
                +VYA+DL        + L        I  D     +LI KLR GQE+ L      
Sbjct: 156 LYRNAHVYARDLKFEPQGKQAELFADQPVEAIDPD-----ILIAKLRPGQEISLRAHCIL 210

Query: 162 GISKEHAKWCPAAAIEFEYDP---------------WNK--------LKHTNYWYEQDPE 198
           GI  +HAK+ P A   +   P               + K        +   +  + +D  
Sbjct: 211 GIGGDHAKFSPVATASYRLLPHINITSPISGESAKRFQKCFPSGVIGINDKDEAFVKDAR 270

Query: 199 KEWPNSKNCEYEDPPNENDPFDYKAK----ADTFYMNVETVGSISVDQVVVRGVDTLQKK 254
           K+  + +   +E+       F  K K     D F  NVE+ G+++ +++  + V  L+ K
Sbjct: 271 KDTVSREVLRHEE-------FQNKVKLGRVRDHFVFNVESTGAMTPEEIFFKSVRILKNK 323

>KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]
           {ON} highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 88.2 bits (217), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 137/289 (47%), Gaps = 49/289 (16%)

Query: 8   VKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I    +  V+F L +VD ++AN+ RR+MI+E+P++A + V    NT+VL DE +AHR+
Sbjct: 42  VQIESLDEREVNFDLVHVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVLQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCF--CEDHCDKCSVVLTLQ--------AVGESE------STT 111
           GL+PL+  D + L +        E   D+ ++V++L         A  + E         
Sbjct: 102 GLVPLK-VDPDMLSWVDTSLPESERFTDENTIVMSLNVKCTRNPDAPKDCEDPKVLYRNA 160

Query: 112 NVYAKDLTIVSNLLGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEH 167
           ++YA+DL       G+ +      P++       +L+ KLR GQE+ L      GI  +H
Sbjct: 161 HIYARDLKFEPQ--GKQVEQFAKCPVVA--ADPDILLAKLRPGQEISLRAHCILGIGADH 216

Query: 168 AKWCPAAAIEFEYDPWNKLKHTNYWYEQDPEKE---WP------NSKNCEY-EDPPNE-- 215
           AK+ P +   +   P   ++ T      D +K    +P      N K   Y +DP  +  
Sbjct: 217 AKFSPVSTASYRLLP--HIQITQPITGDDAKKFVKCFPKGVADVNEKGEAYIKDPRKDTV 274

Query: 216 ------NDPFDYKAK----ADTFYMNVETVGSISVDQVVVRGVDTLQKK 254
                 +D F  K K     D F  NVE+ G+++ +++  + V  L+ K
Sbjct: 275 SREVLRHDEFQGKVKLGRVRDHFIFNVESSGAMTPEEIFFKSVRILKNK 323

>KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa]
           {ON} Anc_3.428 YPR110C
          Length = 334

 Score = 87.0 bits (214), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 129/290 (44%), Gaps = 51/290 (17%)

Query: 8   VKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           +KI   ++   +F L ++D ++AN+ RR+MI+E+P++A + V V  NT+V+ DE +AHR+
Sbjct: 42  IKISSMSEREANFDLVHIDTSVANAFRRIMISEVPSVAAEYVYVMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCFCEDH--CDKCSVVLTLQAVGESE--------------STT 111
           G+IPL+  D + L +      E+    D+ +VVLTL                       +
Sbjct: 102 GMIPLK-VDPDMLTWIDQSLSEEEKFTDENTVVLTLNVKCTRNLNAPKDCTDPKILYKNS 160

Query: 112 NVYAKDLTIVSNLLGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEH 167
           +VYA+DL       G+ +      P++       +L+ KLR  QE+ L      GI  +H
Sbjct: 161 SVYARDLRFEPQ--GKQLETFADCPVVPSDP--DILLAKLRPNQEISLRVHCILGIGSDH 216

Query: 168 AKWCPAAAIEFEYDPWNKL---------KHTNYWYEQ--------------DPEKEWPNS 204
           AK+ P A   +   P   +         K     + Q              +  K+  + 
Sbjct: 217 AKFSPVATASYRLLPHINILEPITGESAKRFQACFPQGVIGIDSEGKAVVENARKDTVSR 276

Query: 205 KNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISVDQVVVRGVDTLQKK 254
           +   YE+     D        D F  NVE+ G+++ +++  + V  L+ K
Sbjct: 277 EVLRYEE---FKDKVKLGRVRDHFIFNVESTGAMTPEEIFFKSVRILKNK 323

>TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 86.3 bits (212), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 96/196 (48%), Gaps = 27/196 (13%)

Query: 8   VKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I   T+   +F L ++D ++AN+ RR+MI+E+P+LA + V    NT+V+ DE +AHR+
Sbjct: 42  VQIESLTEREANFDLIHIDTSIANAFRRIMISEVPSLAPEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCFCEDH--CDKCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D + L +      E+    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDSTLPEEERFTDENTIVLTLNVTCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLTI-----VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKE 166
           +VYA DL        + L  +    P   D     +L+ KLR GQE+ L      G+  +
Sbjct: 161 SVYAHDLKFEPQGRQAELFAKCPVVPADPD-----ILLAKLRPGQEISLRAHCILGVGGD 215

Query: 167 HAKWCPAAAIEFEYDP 182
           HAK+ P A   +   P
Sbjct: 216 HAKFSPVATASYRLLP 231

>NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa]
           {ON} Anc_3.428 YPR110C
          Length = 335

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/295 (26%), Positives = 132/295 (44%), Gaps = 58/295 (19%)

Query: 7   QVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V+I    +   +F L N+D ++AN+ RR+MI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVEISSLNEREANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFLNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYSRDCFC--EDHCDKCSVVLTLQAV------GESEST-------- 110
           +GLIPL+  D + L +  +     E   D  ++VLTL            ++T        
Sbjct: 101 IGLIPLK-VDPDLLTWVDNELPDEEKFNDTNTIVLTLNVKCTRNPDAPKDATDPKILYRN 159

Query: 111 TNVYAKDLTIVSNLLGRNI----GHPII---QDKEGNGVLICKLRKGQELKLTCIAKKGI 163
           ++VYA DL       G+ I    G P++   QD     +L+ KLR GQE+ L      G 
Sbjct: 160 SSVYASDLKFEPQ--GKQIETFAGTPVVPCDQD-----ILLAKLRPGQEISLRAHCILGT 212

Query: 164 SKEHAKWCPAAAIEFEYDPWNKLKH------------------------TNYWYEQDPEK 199
             +HAK+ P +   +   P   +                          +   + +D  K
Sbjct: 213 GGDHAKFSPVSTASYRLLPHINITKPIKGELAEKFQKCFLPGVIGIDNASGEAFVKDARK 272

Query: 200 EWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISVDQVVVRGVDTLQKK 254
           +  + +   +E+    ND        D F  NVE+ G+++ +++  + V  L+ K
Sbjct: 273 DTVSREVLRHEE---FNDKVKLGRIRDHFIFNVESTGAMTPEEIFFKSVRILKNK 324

>Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 130/292 (44%), Gaps = 52/292 (17%)

Query: 7   QVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I      + +F L N+D ++AN+ RR+MI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDARDANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYSRDCFCEDH--CDKCSVVLTLQAV------GESEST-------- 110
           +GL+PL+  D + L +      +D    D+ +VVL+L            +ST        
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTVVLSLNVKCTRNLDAPKDSTDPKQLYNN 159

Query: 111 TNVYAKDLTIVSNLLGRN----IGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKE 166
            +VYA+DL       GR        P++       +L+ KLR GQE+ L      G+  +
Sbjct: 160 AHVYARDLKFEPQ--GRQSTTFANCPVLP--ADPDILLAKLRPGQEISLKAHCILGVGGD 215

Query: 167 HAKWCPAAAIEFEYDPWNKL------------------------KHTNYWYEQDPEKEWP 202
           HAK+ P +   +   P   +                        + ++  Y +D  K+  
Sbjct: 216 HAKFSPVSTASYRLLPQIDILQPIKGESAKRFEKCFPPGVIGIDESSDEAYVKDARKDTV 275

Query: 203 NSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISVDQVVVRGVDTLQKK 254
           + +   YE+     D        + F  NVE+ G+++ +++  + V  L+ K
Sbjct: 276 SREVLRYEE---FTDKVKLGRVRNHFVFNVESAGAMTPEEIFFKSVRILKNK 324

>SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 129/294 (43%), Gaps = 59/294 (20%)

Query: 8   VKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           VKI    +   +F L ++D ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VKISSLDEREANFDLIHIDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCFCEDH--CDKCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D + L +  +   E+    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLSWIDNSLTEEEKFTDENTIVLTLNVKCTRNPDAPKDCTDPKVLYRNS 160

Query: 112 NVYAKDLTIVSNLLGRNI----GHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEH 167
           N+YA+ L       G+ +      P++       +L+ KLR GQE+ L      GI  +H
Sbjct: 161 NIYARHLKFEPQ--GKQLETFAKSPVV--PADPDILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWCPAAAIEFEYDPWNKLKHT-----------------------NYWYEQDPEKEWPNS 204
           AK+ P     +   P   +                             Y +D  K+  + 
Sbjct: 217 AKFSPVCTASYRLMPQINITEPITGESAKNLVRCFPPGVIGINEQGEAYVEDARKDTVSR 276

Query: 205 KNCEYEDPPNENDPFDYKAK----ADTFYMNVETVGSISVDQVVVRGVDTLQKK 254
           +   +E+       F+ K K     D F  NVE+ G+++ +++  + V  L+ K
Sbjct: 277 EVLRHEE-------FEGKVKLGRVRDHFVFNVESAGAMTPEEIFFKSVRILKNK 323

>ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR110C
           (RPC40)
          Length = 364

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 97/196 (49%), Gaps = 25/196 (12%)

Query: 8   VKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I+   +   +F L  VD ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 72  VQIKSLDEREANFDLLRVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 131

Query: 68  GLIPLQSTDIEQLEYSRDCF--CEDHCDKCSVVLTLQA--------------VGESESTT 111
           GL+PL+  D + L +        E   D+ +VVL+L                  E     
Sbjct: 132 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVLSLNVKCTHNPDAPKGSTDPKELYRNA 190

Query: 112 NVYAKDLTIVSNLLGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEH 167
           ++YA+DL       G+ +      P++       +L+ KLR GQE+ L      GI  +H
Sbjct: 191 HIYARDLKFEPQ--GKQLETFAKCPVV--PADPDILLAKLRPGQEISLRVHCILGIGSDH 246

Query: 168 AKWCPAAAIEFEYDPW 183
           AK+ P A   +   P+
Sbjct: 247 AKFSPVATASYRLMPY 262

>YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON}
           RPC40RNA polymerase subunit AC40, common to RNA
           polymerase I and III
          Length = 335

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 131/296 (44%), Gaps = 60/296 (20%)

Query: 7   QVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I        +F L N+D ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYSRDCFCEDH--CDKCSVVLTLQA--------------VGESEST 110
           +GL+PL+  D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLTIVSNLLGRNIGH----PIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKE 166
            +VYA+DL       GR        P++       +L+ KLR GQE+ L      GI  +
Sbjct: 160 AHVYARDLKFEPQ--GRQSTTFADCPVV--PADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWCPAAAIEFEYDPWNKL------------------------KHTNYWYEQDPEKEWP 202
           HAK+ P +   +   P   +                        + ++  Y +D  K+  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTV 275

Query: 203 NSKNCEYEDPPNENDPFDYKAK----ADTFYMNVETVGSISVDQVVVRGVDTLQKK 254
           + +   YE+       F  K K     + F  NVE+ G+++ +++  + V  L+ K
Sbjct: 276 SREVLRYEE-------FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.428
           YPR110C
          Length = 333

 Score = 84.7 bits (208), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 96/195 (49%), Gaps = 25/195 (12%)

Query: 8   VKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           +KI    + +  F L N+D ++AN+ RR+M+AE+P +A + V    NT+V+ DE +AHR+
Sbjct: 42  IKISNLDERDATFDLINIDTSIANAFRRIMMAEVPAVAAEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCFCEDH--CDKCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D + L +      E+    D+ ++VL+L                     +  
Sbjct: 102 GLVPLK-VDPDMLTWVDQTLPEEERFTDENTIVLSLNVKCTKNDKAPKDCTDPKILYNNA 160

Query: 112 NVYAKDLTIVSNLLGRNI----GHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEH 167
           +VYA+DL       G+ +      P++       +L+ KLR GQE+ L      GI  +H
Sbjct: 161 HVYARDLKFEPQ--GKQVETFANCPVVPTDP--DILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWCPAAAIEFEYDP 182
           AK+ P A   +   P
Sbjct: 217 AKFSPVATASYRLLP 231

>KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} highly
           similar to uniprot|P07703 Saccharomyces cerevisiae
           YPR110C RPC40 RNA polymerase subunit common to RNA
           polymerase I and III
          Length = 350

 Score = 84.7 bits (208), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 89/182 (48%), Gaps = 21/182 (11%)

Query: 19  DFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSTDIE 78
           +F L NVD ++AN+ RR+MIAE+P++A + V    NT+V+ DE +AHR+GL PL+  D +
Sbjct: 69  NFDLVNVDASIANAFRRIMIAEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLTPLK-VDPD 127

Query: 79  QLEYSRDCF--CEDHCDKCSVVLTLQAVGESE--------------STTNVYAKDLTIVS 122
            L +        E   D+ ++VLTL                        ++YA+DL    
Sbjct: 128 MLSWVDTSVPEAERFTDENTIVLTLNVRCTRNPDAPKDCTDPKILYRNAHIYARDLKFEP 187

Query: 123 NLLGRNI--GHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180
               R     +P++       +L+ KLR GQE+ L      GI  +HAK+ P +   +  
Sbjct: 188 QGKQRETFAKNPVVPADP--DILLAKLRPGQEISLRAHCVLGIGSDHAKFSPVSTASYRL 245

Query: 181 DP 182
            P
Sbjct: 246 MP 247

>Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar to
           Ashbya gossypii ADR031C
          Length = 334

 Score = 84.0 bits (206), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 127/292 (43%), Gaps = 55/292 (18%)

Query: 8   VKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I        +F L ++D ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VQISHLDDREANFDLIHIDASIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCF--CEDHCDKCSVVLTLQA--------------VGESESTT 111
           GL+PL+  D + L +        E   D+ +VV++L                  E  +  
Sbjct: 102 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVMSLNVKCTANPDAPKGSTDPKELYNNA 160

Query: 112 NVYAKDLTI--VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAK 169
           ++Y++DL        L     HP++       +L+ KLR GQE+ L      G+  +HAK
Sbjct: 161 HIYSRDLKFEPQGKQLDSFAKHPVLPTDP--DILLAKLRPGQEISLRVHCILGVGGDHAK 218

Query: 170 WCPAAAIEFEYDPWNKLKHT-----------------------NYWYEQDPEKEWPNSKN 206
           + P     +   P   +  T                          Y +D  K+  + + 
Sbjct: 219 FSPVCTASYRLMPHIDILETIQGEDATKFVKCFPPGVAAIDEKGEAYIKDARKDTVSREV 278

Query: 207 CEYEDPPNENDPFDYKAK----ADTFYMNVETVGSISVDQVVVRGVDTLQKK 254
             + +       F+ K K     D F  NVE+ G+++ +++  + V  L+ K
Sbjct: 279 LRHPE-------FEGKVKLGRVKDHFIFNVESTGAMTPEEIFFKSVRILKNK 323

>Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 84.0 bits (206), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 130/296 (43%), Gaps = 60/296 (20%)

Query: 7   QVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I        +F L N+D ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYSRDCFCEDH--CDKCSVVLTLQA--------------VGESEST 110
           +GL+PL+  D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLTIVSNLLGRN----IGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKE 166
            +VYA+DL       G+        P++       +L+ KLR GQE+ L      GI  +
Sbjct: 160 AHVYARDLKFEPQ--GKQSTTFADFPVV--PADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWCPAAAIEFEYDPWNKL------------------------KHTNYWYEQDPEKEWP 202
           HAK+ P +   +   P   +                        + ++  Y +D  K+  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDESSDEVYVKDARKDTV 275

Query: 203 NSKNCEYEDPPNENDPFDYKAK----ADTFYMNVETVGSISVDQVVVRGVDTLQKK 254
           + +   Y       D F  K K     + F  NVE+ G+++ +++  + V  L+ K
Sbjct: 276 SREVLRY-------DEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C
           (RPC40) - RNA polymerase III (C) subunit [contig 255]
           FULL
          Length = 334

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 92/193 (47%), Gaps = 21/193 (10%)

Query: 8   VKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I    +   +F L NVD ++AN+ RR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRISSLDEREANFDLVNVDASIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSTDIEQLEYSRDCF--CEDHCDKCSVVLTLQAVGESE--------------STT 111
           GL PL+  D + L +        E   D+ ++VLTL                        
Sbjct: 102 GLTPLK-VDPDMLSWVDSSVPEAERFTDENTIVLTLNVKCTRNPDAPKDCTDPKILYRNA 160

Query: 112 NVYAKDLTI--VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAK 169
           ++YA+DL        L     +P++       VL+ KLR GQE+ L      GI  +HAK
Sbjct: 161 HIYARDLKFEPQGKQLETFAKNPVV--PADPDVLLAKLRPGQEISLRAHCILGIGSDHAK 218

Query: 170 WCPAAAIEFEYDP 182
           + P     +   P
Sbjct: 219 FSPVCTASYRLMP 231

>Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 126/285 (44%), Gaps = 38/285 (13%)

Query: 7   QVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I    +   +F L N+D ++AN+ RR+MI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVNISSLDEREANFDLINIDASIANAFRRIMISEVPCVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSTDIEQLEYSRDCFCEDH--CDKCSVVLTLQA--------------VGESEST 110
           +GL+PL+  D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTIVLSLNVKCTRNPDAPKDCTDPKELYNN 159

Query: 111 TNVYAKDLTIVSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKW 170
            +VYA+DL                       +L+ KLR GQE+ L      GI  +HAK+
Sbjct: 160 AHVYARDLKFEPQGRQSTTFAACSVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKF 219

Query: 171 CPAAAIEFEYDPW-NKLKHTNYWYEQDPEKEWP--------NSKNCEYEDPPNE---NDP 218
            P +   +   P  N L+       +  +K +P         S+    +D   +    + 
Sbjct: 220 SPVSTASYRLLPQINILQSIKGESAKRFQKCFPPGVIGIDDTSREAYVKDARKDTVSREV 279

Query: 219 FDYKAKADT---------FYMNVETVGSISVDQVVVRGVDTLQKK 254
             Y+  AD          F  NVE+ G+++ +++  + V  L+ K
Sbjct: 280 LRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>Kpol_1075.5 s1075 complement(13967..20494) [6528 bp, 2175 aa] {ON}
           complement(13967..20494) [6528 nt, 2176 aa]
          Length = 2175

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 111 TNVYAKDLTIVSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKW 170
           + VY + L  V+++LG +I H  I   E + +LI  L++ +E K   I KK    E    
Sbjct: 118 SQVYEEILEWVTDMLGDDIPHETI--IETSDLLISVLKEDEENKDGLIQKKKKIVEDELS 175

Query: 171 CPAAAIEFE 179
           CP   I+F+
Sbjct: 176 CPIDTIQFQ 184

>KNAG0B00410 Chr2 (69475..71790) [2316 bp, 771 aa] {ON} Anc_3.544
           YGL227W
          Length = 771

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 11/81 (13%)

Query: 93  DKCSVVLTLQAVGESESTTNVYAKDLTIVSNLLGRNIGHPIIQDKEGNGVLICKLRKGQE 152
           DKC   L  +  G  ES   V + ++ +   +LG   G P+ +  E           GQ+
Sbjct: 600 DKCVAYLNSEIPGLLESNAEV-SFEIDLARFILGIMSGEPVARSIE----------TGQD 648

Query: 153 LKLTCIAKKGISKEHAKWCPA 173
           L L C     IS+E   W  A
Sbjct: 649 LSLKCSTNSAISEETRTWFQA 669

>NDAI0D02100 Chr4 complement(488629..490311) [1683 bp, 560 aa] {ON}
           Anc_5.167 YGR166W
          Length = 560

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%)

Query: 20  FILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSTDIEQ 79
           FI+ + +L +   LR+    ++  + IDS+ V+ N T +          LI  +STD E 
Sbjct: 28  FIIFDENLKVVLRLRKKANVDLSNIVIDSLTVKINGTRVWHSIGDEVFDLILPESTDDEL 87

Query: 80  LEYSRDCFCEDHCDKCSVVL 99
           +   +     DH  + SVV+
Sbjct: 88  IWEMKSNISTDHMFRSSVVM 107

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,245,327
Number of extensions: 1525013
Number of successful extensions: 3213
Number of sequences better than 10.0: 51
Number of HSP's gapped: 3245
Number of HSP's successfully gapped: 53
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)