Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A026407.196ON42142122380.0
NCAS0A125207.196ON43243315960.0
Smik_9.1687.196ON43142115950.0
Suva_9.1777.196ON43540315730.0
Kpol_1063.97.196ON41742115680.0
Skud_9.1477.196ON43140015690.0
CAGL0J02442g7.196ON41238515610.0
YIL022W (TIM44)7.196ON43140015550.0
NDAI0B017807.196ON43439415400.0
KLLA0D16214g7.196ON41838615360.0
TDEL0H025107.196ON41839715230.0
SAKL0F07502g7.196ON41239815160.0
Kwal_55.203687.196ON41239615110.0
TPHA0C045307.196ON41639314960.0
KNAG0H026907.196ON41940014800.0
KLTH0E04554g7.196ON47941814760.0
ZYRO0D15840g7.196ON40739914650.0
Ecym_43807.196ON41838714550.0
ADL118C7.196ON41839413910.0
TBLA0J015007.196ON42142213530.0
YKL022C (CDC16)2.665ON840148780.56
TPHA0H016105.404ON351110731.6
Smik_8.1545.363ON109061705.0
TDEL0B065902.571ON51574686.6
Smik_14.3366.295ON628150687.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A02640
         (421 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.1...   866   0.0  
NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa] ...   619   0.0  
Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W ...   619   0.0  
Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W ...   610   0.0  
Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON} (26537.....   608   0.0  
Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W ...   608   0.0  
CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa] ...   605   0.0  
YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}  TIM44Essen...   603   0.0  
NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {O...   597   0.0  
KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]...   596   0.0  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...   591   0.0  
SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {...   588   0.0  
Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022...   586   0.0  
TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {O...   580   0.0  
KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...   574   0.0  
KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} simila...   573   0.0  
ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]...   568   0.0  
Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar t...   565   0.0  
ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON} S...   540   0.0  
TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7....   525   0.0  
YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON} ...    35   0.56 
TPHA0H01610 Chr8 complement(366969..368024) [1056 bp, 351 aa] {O...    33   1.6  
Smik_8.154 Chr8 complement(229050..232316,232428..232433) [3273 ...    32   5.0  
TDEL0B06590 Chr2 complement(1166277..1167824) [1548 bp, 515 aa] ...    31   6.6  
Smik_14.336 Chr14 (594978..596864) [1887 bp, 628 aa] {ON} YNR006...    31   7.8  

>KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/421 (100%), Positives = 421/421 (100%)

Query: 1   MLVRSRVGVSGKPYYLKSAIQLVSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSI 60
           MLVRSRVGVSGKPYYLKSAIQLVSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSI
Sbjct: 1   MLVRSRVGVSGKPYYLKSAIQLVSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSI 60

Query: 61  KELQDASGKISESEAYKKARDAYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKN 120
           KELQDASGKISESEAYKKARDAYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKN
Sbjct: 61  KELQDASGKISESEAYKKARDAYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKN 120

Query: 121 TRQMASETAKKLDESFEPVRNTKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKS 180
           TRQMASETAKKLDESFEPVRNTKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKS
Sbjct: 121 TRQMASETAKKLDESFEPVRNTKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKS 180

Query: 181 GKRVRAVKSNDEAGTALVATNVQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPL 240
           GKRVRAVKSNDEAGTALVATNVQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPL
Sbjct: 181 GKRVRAVKSNDEAGTALVATNVQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPL 240

Query: 241 IVLLRKITLKITGFFGETESSRVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDE 300
           IVLLRKITLKITGFFGETESSRVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDE
Sbjct: 241 IVLLRKITLKITGFFGETESSRVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDE 300

Query: 301 KVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCR 360
           KVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCR
Sbjct: 301 KVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCR 360

Query: 361 AQEINIYRKIKTGEVAAGNASDILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQF 420
           AQEINIYRKIKTGEVAAGNASDILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQF
Sbjct: 361 AQEINIYRKIKTGEVAAGNASDILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQF 420

Query: 421 T 421
           T
Sbjct: 421 T 421

>NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa]
           {ON} Anc_7.196 YIL022W
          Length = 432

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/433 (69%), Positives = 362/433 (83%), Gaps = 13/433 (3%)

Query: 1   MLVRSRVGVSGKP-YYLKSAIQ-----------LVSLHTSRNLGQQQRTPLQIFRETFKK 48
           ML R+ + +S +P  Y  S I            L S  T+R+ G   RTP+QIFR+TFKK
Sbjct: 1   MLYRNSLQISRRPTLYSHSLISTTTTTTVVNKGLFSTTTARSNGGGGRTPIQIFRDTFKK 60

Query: 49  EWEKSAELQGSIKELQDASGKISESEAYKKARDAYLKAHRGSSTILDKTLKKTGDTLEDI 108
           EW+KS ELQ +IK L DASGK+SESE +K A+DAYLKAH+GSSTIL KT++KTG+T+E++
Sbjct: 61  EWDKSQELQENIKALHDASGKLSESETFKMAKDAYLKAHKGSSTILSKTMQKTGETVENM 120

Query: 109 ATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIYKDVSEVLNDDGDSYRYGGFIQKD 168
           A+KAW+SEI+K+TR+ A +TA  LD+SFEPVR T++YKD+SEV+ DDGDS RYGGFI K+
Sbjct: 121 ASKAWDSEIAKSTREAAKKTADTLDKSFEPVRKTQVYKDISEVI-DDGDSSRYGGFITKE 179

Query: 169 ERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSHESIGQKYENFKERTMVGKILHNF 228
           ERRLKRE+ L SGKR RA+KSN+EAGTALVAT++++ +S G+K E+FKE+T+VGK + + 
Sbjct: 180 ERRLKRESDLASGKRQRAIKSNEEAGTALVATDIEAKQSFGKKVEDFKEKTVVGKTMSSV 239

Query: 229 KVNYWDESENPLIVLLRKITLKITGFFGETESSRVYSQFKLIDQTFNAESFTRHLREYIV 288
           KV  WDESENPLIV LRKIT KI GFF ETES+RVY+QFK++D TF  E FTRHLREYIV
Sbjct: 240 KVKLWDESENPLIVFLRKITNKIGGFFDETESARVYTQFKMMDATFTNEGFTRHLREYIV 299

Query: 289 PEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNILDIRNVEIVSAKLLQ 348
           PE+LEAYIKGDEKVLK WFSEAPFNVYSAQQKVFR+Q LF DG ILDIR VEIVSAKLL 
Sbjct: 300 PELLEAYIKGDEKVLKKWFSEAPFNVYSAQQKVFREQGLFSDGRILDIRGVEIVSAKLLA 359

Query: 349 PQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILMSTYAMVFTRDPEEIDNDETEGWR 408
           PQDIPVLVV CRAQEIN+YRK+KTGE+AAG+ S+ILMS+YAMVFTRDPE+ID+DETEGW+
Sbjct: 360 PQDIPVLVVGCRAQEINLYRKVKTGEIAAGDQSNILMSSYAMVFTRDPEQIDDDETEGWK 419

Query: 409 ILEFVRGNSRQFT 421
           ILEFVRG SRQFT
Sbjct: 420 ILEFVRGGSRQFT 432

>Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/421 (72%), Positives = 356/421 (84%), Gaps = 6/421 (1%)

Query: 1   MLVRSRVGVSGKPYYLKSAIQLVSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSI 60
           +  R R G +G    L  A  L S   +R  G   R+PLQIFR+TFKKEWEKS ELQ +I
Sbjct: 17  IAARYRSGDTG----LMIARVLFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENI 72

Query: 61  KELQDASGKISESEAYKKARDAYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKN 120
           K LQDASGK+ ESEAYKKAR+AYLKA RGS TI+ KTLKKTG+T+E IATKAWESE+ KN
Sbjct: 73  KTLQDASGKLGESEAYKKAREAYLKAQRGS-TIVGKTLKKTGETMEHIATKAWESELGKN 131

Query: 121 TRQMASETAKKLDESFEPVRNTKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKS 180
           TR+ AS TAKKLDESFEPVR TKIYK+VSEV+ DDG+S RYGGFI K++RRLKRE  L S
Sbjct: 132 TRKAASATAKKLDESFEPVRQTKIYKEVSEVI-DDGESSRYGGFITKEQRRLKREKDLAS 190

Query: 181 GKRVRAVKSNDEAGTALVATNVQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPL 240
           GKR RAVKSNDEAGTA+VATN++S ES G+K E+FKE+T+VG+ + + K   WDESENPL
Sbjct: 191 GKRHRAVKSNDEAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPL 250

Query: 241 IVLLRKITLKITGFFGETESSRVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDE 300
           IV++RKIT K+ GFF ETESSRVYSQFK++D TF+ ESFTRHLREYIVPEILEAY+KGD 
Sbjct: 251 IVVMRKITNKVGGFFAETESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDV 310

Query: 301 KVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCR 360
           KVLK WFSEAPFNVY+AQQK+F++Q+++ DG ILDIR VE+VSAKLL PQDIPVLVV CR
Sbjct: 311 KVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCR 370

Query: 361 AQEINIYRKIKTGEVAAGNASDILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQF 420
           AQEIN+YRK KTGE+AAG+ ++ILMS+YAMVFTRDPE+ID+DETEGW+ILEFVRG SRQF
Sbjct: 371 AQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQF 430

Query: 421 T 421
           T
Sbjct: 431 T 431

>Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W
           (REAL)
          Length = 435

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/403 (73%), Positives = 348/403 (86%), Gaps = 2/403 (0%)

Query: 19  AIQLVSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKK 78
           A  L S   +R  G   R+PLQIFR+TFKKEW+KS ELQ +IK LQDASGK+ ESEAYKK
Sbjct: 35  ARALFSTSATRAQGGNPRSPLQIFRDTFKKEWDKSQELQENIKTLQDASGKLGESEAYKK 94

Query: 79  ARDAYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEP 138
           AR+AYL+A RGS TI+ KTLKKTG+T+E IAT+AW+SE+ KNTR+ AS TAKKLDESFEP
Sbjct: 95  AREAYLRAQRGS-TIVGKTLKKTGETVEHIATRAWDSELGKNTRKAASATAKKLDESFEP 153

Query: 139 VRNTKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALV 198
           VR TKIYK+VSEV+ DDG+S RYGGFI K++RRLKRE  L SGKR RAVKSNDEAGTA+V
Sbjct: 154 VRQTKIYKEVSEVI-DDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVV 212

Query: 199 ATNVQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGET 258
           ATN++S ES G+K E+FKE+T VG+ + + K   WDESENPLIV++RK+T K+ GFF ET
Sbjct: 213 ATNIESKESFGKKVEDFKEKTAVGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGFFAET 272

Query: 259 ESSRVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQ 318
           ESSRVYSQFK++D TF+ E+FTRHLREYIVPEILEAY+KGD KVLK WFSEAPFNVY+AQ
Sbjct: 273 ESSRVYSQFKMMDPTFSNENFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQ 332

Query: 319 QKVFRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAG 378
           QK+F++Q++F DG ILDIR VEIVSAKLL PQDIPVLVV CRAQEIN+YRK KTGE+AAG
Sbjct: 333 QKIFKEQDVFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGEIAAG 392

Query: 379 NASDILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421
           + ++ILMS+YAMVFTRDPE+ID+DETEGW+ILEFVRG SRQFT
Sbjct: 393 DEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 435

>Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON}
           (26537..27790) [1254 nt, 418 aa]
          Length = 417

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/421 (70%), Positives = 358/421 (85%), Gaps = 5/421 (1%)

Query: 2   LVRSRVGVSGKPYYLKS-AIQLVSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSI 60
           + RS V     P  L S +I L S  TS  + Q  RTP+QIFR+TFKKEWEKS +LQ +I
Sbjct: 1   MQRSVVLKRNTPKLLCSGSIHLFS--TSSRVLQGPRTPIQIFRDTFKKEWEKSKDLQDNI 58

Query: 61  KELQDASGKISESEAYKKARDAYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKN 120
           K LQDASG++ ESEAYKKAR+AYLKA +GS TI+ KTL+KTG+T+EDIA+KAW+SEI K+
Sbjct: 59  KALQDASGRLGESEAYKKAREAYLKAQKGS-TIVGKTLQKTGETVEDIASKAWDSEIGKS 117

Query: 121 TRQMASETAKKLDESFEPVRNTKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKS 180
           TR+ AS TA+K+DESFEPVR T++YKDVS+V+ DDGDS RYGGFI K++RRLKRE+ L S
Sbjct: 118 TRKAASATARKIDESFEPVRKTQVYKDVSDVI-DDGDSSRYGGFIGKEQRRLKRESDLVS 176

Query: 181 GKRVRAVKSNDEAGTALVATNVQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPL 240
           GKRVRAVKSNDEAGT++VATN+++ ES+G+K E+FKE T  G+ +H  KV  WDE+ENPL
Sbjct: 177 GKRVRAVKSNDEAGTSIVATNIEAKESLGKKMEDFKENTTAGRTIHGVKVKLWDENENPL 236

Query: 241 IVLLRKITLKITGFFGETESSRVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDE 300
           IV LRK++ KI GFF ETESSRV SQFKL+D TF+ +SFT+HLREYI+PE+LEAY+KGDE
Sbjct: 237 IVFLRKVSGKIGGFFAETESSRVLSQFKLMDPTFSNDSFTKHLREYIIPEVLEAYVKGDE 296

Query: 301 KVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCR 360
            VLK WFSEAP+NVY+AQQK FR+Q LFPDG ILDIR VEIVSAKLL PQDIPVLVV CR
Sbjct: 297 AVLKKWFSEAPYNVYAAQQKEFRKQQLFPDGRILDIRGVEIVSAKLLAPQDIPVLVVGCR 356

Query: 361 AQEINIYRKIKTGEVAAGNASDILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQF 420
           AQEI++YRK+KTGE+AAG+ S+ILMS+YAMVFTRDPE+ID+DETEGW+ILEFVRG SRQF
Sbjct: 357 AQEIHLYRKVKTGEIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQF 416

Query: 421 T 421
           T
Sbjct: 417 T 417

>Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/400 (73%), Positives = 346/400 (86%), Gaps = 2/400 (0%)

Query: 22  LVSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARD 81
           L S   +R  G   R+PLQIFR+TFKKEWEKS ELQ +IK LQDASGK+ ESEAYKKAR+
Sbjct: 34  LFSTSATRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKARE 93

Query: 82  AYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRN 141
           AYL+A RGS TI+ KTLKKTG+T+E IATKAWESE+ KNTR+ AS TAK+LDESFEPVR 
Sbjct: 94  AYLRAQRGS-TIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKRLDESFEPVRQ 152

Query: 142 TKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATN 201
           TKIYK+VSEV+ DDG+S RYGGFI K++RRLKRE  L SGKR RAVKSNDEAGTA+VATN
Sbjct: 153 TKIYKEVSEVI-DDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATN 211

Query: 202 VQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESS 261
           ++S ES G+K E+F+E+T +G+ + + K   WDESENPLIV++RK+T K+ GFF ETESS
Sbjct: 212 IESKESFGKKVEDFREKTAMGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGFFAETESS 271

Query: 262 RVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKV 321
           RV+SQFKL+D TF+ ESFTRHLR+YIVPEILEAY+K D KVLK WFSEAP+NVY+AQQK+
Sbjct: 272 RVHSQFKLMDPTFSNESFTRHLRDYIVPEILEAYVKADVKVLKKWFSEAPYNVYAAQQKI 331

Query: 322 FRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNAS 381
           FR+Q+++ DG ILDIR VEIVSAKLL PQDIPVLVV CRAQEIN+YRK KTGE+AAGN +
Sbjct: 332 FREQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGEIAAGNEA 391

Query: 382 DILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421
           +ILMS+YAMVFTRDPE+ID+DETEGW+ILEFVRG SRQFT
Sbjct: 392 NILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022w TIM44
          Length = 412

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/385 (74%), Positives = 342/385 (88%), Gaps = 1/385 (0%)

Query: 36  RTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYLKAHRGSSTILD 95
           R+PLQIFRETFKKEWEKS ELQ +IK LQDASG++ ESEAYKKAR+AYLKA +GS TI+ 
Sbjct: 28  RSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYKKAREAYLKASKGSQTIVG 87

Query: 96  KTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIYKDVSEVLNDD 155
           KTL+KTG+T+E++ATKAW+S+I+K TR +AS+TAKKLDESFEPVR TKIYKDVSEV+ DD
Sbjct: 88  KTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFEPVRQTKIYKDVSEVI-DD 146

Query: 156 GDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSHESIGQKYENF 215
           GDS  YGGFI K++RRLKRE  L SGKRVRAVKSNDEAG+ALVAT++++ ES+G+K E+F
Sbjct: 147 GDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALVATDIEAKESLGKKIEDF 206

Query: 216 KERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYSQFKLIDQTFN 275
           KE+T VG+ L + KV+ WDESENPLIV LRKIT KI GFF ETES+RVY QFK++D TF 
Sbjct: 207 KEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAETESARVYKQFKMVDPTFT 266

Query: 276 AESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNILD 335
              FT+HLR+YIVPE+LEAY+KGDEKVLK WFSEAPFNVY+AQQK+F++Q LF DG ILD
Sbjct: 267 NIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQKIFKKQELFSDGKILD 326

Query: 336 IRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILMSTYAMVFTRD 395
           IR VE+VSAKLLQPQDIPVLVV CRAQEI++YRK KTGE+AAG+ S+ILMS+YAMVFTRD
Sbjct: 327 IRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGDESNILMSSYAMVFTRD 386

Query: 396 PEEIDNDETEGWRILEFVRGNSRQF 420
           PE+ID+DETEGW+ILEF+RG+SR F
Sbjct: 387 PEQIDDDETEGWKILEFIRGSSRPF 411

>YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}
           TIM44Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); tethers the
           import motor and regulatory factors (PAM complex) to the
           translocation channel (Tim23p-Tim17p core complex)
          Length = 431

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/400 (74%), Positives = 349/400 (87%), Gaps = 2/400 (0%)

Query: 22  LVSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARD 81
           L S  T+R  G   R+PLQIFR+TFKKEWEKS ELQ +IK LQDASGK+ ESEAYKKAR+
Sbjct: 34  LFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKARE 93

Query: 82  AYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRN 141
           AYLKA RGS TI+ KTLKKTG+T+E IATKAWESE+ KNTR+ A+ TAKKLDESFEPVR 
Sbjct: 94  AYLKAQRGS-TIVGKTLKKTGETMEHIATKAWESELGKNTRKAAAATAKKLDESFEPVRQ 152

Query: 142 TKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATN 201
           TKIYK+VSEV+ DDG+S RYGGFI K++RRLKRE  L SGKR RAVKSN++AGTA+VATN
Sbjct: 153 TKIYKEVSEVI-DDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTAVVATN 211

Query: 202 VQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESS 261
           ++S ES G+K E+FKE+T+VG+ + + K   WDESENPLIV++RKIT K+ GFF ETESS
Sbjct: 212 IESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESS 271

Query: 262 RVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKV 321
           RVYSQFKL+D TF+ ESFTRHLREYIVPEILEAY+KGD KVLK WFSEAPFNVY+AQQK+
Sbjct: 272 RVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKI 331

Query: 322 FRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNAS 381
           F++Q+++ DG ILDIR VEIVSAKLL PQDIPVLVV CRAQEIN+YRK KTGE+AAG+ +
Sbjct: 332 FKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEA 391

Query: 382 DILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421
           +ILMS+YAMVFTRDPE+ID+DETEGW+ILEFVRG SRQFT
Sbjct: 392 NILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {ON}
           Anc_7.196 YIL022W
          Length = 434

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/394 (73%), Positives = 339/394 (86%), Gaps = 2/394 (0%)

Query: 27  TSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYLKA 86
           T  N G   RTP+QIFR+TFKKEWEKS ELQ +IK L DASGK+SESE +K A+DAYLKA
Sbjct: 42  TLNNNGGGGRTPIQIFRDTFKKEWEKSQELQDNIKALHDASGKLSESETFKMAKDAYLKA 101

Query: 87  HRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIYK 146
           H+GS TI+ KTLKKTG+T+E +A+KAW+SEI KNTR  A +TA+ +D+SFEPVR T+IYK
Sbjct: 102 HKGS-TIVSKTLKKTGETVETMASKAWDSEIGKNTRIAAKKTAETIDKSFEPVRKTQIYK 160

Query: 147 DVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSHE 206
           DVSEV+ DDGDS RYGGFI K+ER+LKRE  L SGKR RAVKSNDEAGTALVATN+++ E
Sbjct: 161 DVSEVI-DDGDSSRYGGFITKEERKLKRERDLASGKRQRAVKSNDEAGTALVATNIEAKE 219

Query: 207 SIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYSQ 266
           S G+K E+FKE+T+VGK +   K+  WDESENPLIV LRKI+ KI+GFF ETES++VY+Q
Sbjct: 220 SFGKKVEDFKEKTVVGKTMKTVKMKLWDESENPLIVTLRKISNKISGFFDETESAKVYTQ 279

Query: 267 FKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQN 326
           FKL+D TF  + FTRHLR+YIVPEILEAYIKGDEKVLK WFSEAPFNVY+AQQKVFR+Q 
Sbjct: 280 FKLMDTTFTNDGFTRHLRDYIVPEILEAYIKGDEKVLKKWFSEAPFNVYAAQQKVFREQG 339

Query: 327 LFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILMS 386
           LF DG ILDIR VEIVSAKLL PQDIPVLVV CRAQEIN+Y+K K+GE+AAG+ S+I+MS
Sbjct: 340 LFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYKKAKSGEIAAGDESNIVMS 399

Query: 387 TYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQF 420
           +YAMVFTRDPE+ID+DETEGW+ILEFVRG SR F
Sbjct: 400 SYAMVFTRDPEQIDDDETEGWKILEFVRGGSRPF 433

>KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 418

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/386 (73%), Positives = 334/386 (86%), Gaps = 2/386 (0%)

Query: 36  RTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYLKAHRGSSTILD 95
           R+PLQIFRETFK+EWEKS ELQ +IK LQDASGK+ ESEAYKKAR+AY+KA +GS TI+ 
Sbjct: 35  RSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREAYVKAQKGS-TIVG 93

Query: 96  KTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIYKDVSEVLNDD 155
           KTLKKTG+T+E IA+KAW+SEI+K+TR++ ++TA KLDESFEPVR TK+YKDVSEV+ DD
Sbjct: 94  KTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTKVYKDVSEVI-DD 152

Query: 156 GDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSHESIGQKYENF 215
           GDS RYGGFI K++RRL +E A+ SGKR RAVKSND AGTALVATN++S ES G+K E+F
Sbjct: 153 GDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIESKESFGKKIEDF 212

Query: 216 KERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYSQFKLIDQTFN 275
           KE+T VG+ LH +K+  WDESENPL+V+LR ++ KI G F ETES+RVY QFK++D TFN
Sbjct: 213 KEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVYGQFKMMDPTFN 272

Query: 276 AESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNILD 335
            E FT+HLREYI+PEILEAY+KGDE VLK WFSEAP+NVY+AQQK FR+Q LF DG ILD
Sbjct: 273 TEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFREQELFADGKILD 332

Query: 336 IRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILMSTYAMVFTRD 395
           IR VEIVSAKLL PQDIPVLVV CRAQEI++YRK KTGE+AAG  S ILMS+YAMVFTRD
Sbjct: 333 IRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSILMSSYAMVFTRD 392

Query: 396 PEEIDNDETEGWRILEFVRGNSRQFT 421
           PE +D+ ETEGW+ILEFVRG SRQFT
Sbjct: 393 PETVDDKETEGWKILEFVRGGSRQFT 418

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/397 (70%), Positives = 342/397 (86%), Gaps = 2/397 (0%)

Query: 25  LHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYL 84
             TS    Q  R+P+QIFR+TFKKEW+KS ELQ +IK LQDASG++ ESEAYK+AR+AY+
Sbjct: 24  FSTSSGSLQNPRSPVQIFRDTFKKEWKKSQELQDNIKTLQDASGRLGESEAYKRAREAYV 83

Query: 85  KAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKI 144
           +A +GS TI+ KTLKKTG+T+E+IA+KAW+SEI++NTR+ AS+TAKK+DE FEPVR TKI
Sbjct: 84  RAQKGS-TIVGKTLKKTGETVENIASKAWDSEIARNTREAASKTAKKIDEGFEPVRQTKI 142

Query: 145 YKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQS 204
           YKDVSEV+ DDG+S RYGGFI K++RRLKRE  + SGKR +AVK N++AGTALVAT++++
Sbjct: 143 YKDVSEVM-DDGNSSRYGGFITKEQRRLKREQDMLSGKRAKAVKGNEDAGTALVATDIEA 201

Query: 205 HESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVY 264
            +S G+K E+FKE+T++G+ LH  K + WDES NPLIV LRKIT KI GFF ETE++RV 
Sbjct: 202 KQSFGKKVEDFKEKTVLGRTLHRLKNSLWDESVNPLIVFLRKITRKIGGFFAETEAARVL 261

Query: 265 SQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQ 324
            QFK++D TF  ESFTRHLREY++PEILEAY+KGDEKVLK WFSEAP+NVY+AQQK FR+
Sbjct: 262 GQFKMMDPTFTNESFTRHLREYVIPEILEAYVKGDEKVLKKWFSEAPYNVYAAQQKAFRE 321

Query: 325 QNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDIL 384
           Q LF DG ILDIR VEIVSAK+L PQDIPVLVV CRAQEI++YRK KTGEVAAG+ S+I+
Sbjct: 322 QQLFADGKILDIRGVEIVSAKMLPPQDIPVLVVGCRAQEIHLYRKAKTGEVAAGHESNIM 381

Query: 385 MSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421
           MS+YAMVFTRDPE+ID++ETEGWRILEFVRG SRQFT
Sbjct: 382 MSSYAMVFTRDPEQIDDEETEGWRILEFVRGGSRQFT 418

>SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {ON}
           highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 412

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/398 (70%), Positives = 334/398 (83%), Gaps = 2/398 (0%)

Query: 24  SLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAY 83
           ++ ++  L Q QR+PLQIFRETFK+EWEKS ELQ +IK LQDASGK+ ES+AYKKAR+AY
Sbjct: 17  TISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREAY 76

Query: 84  LKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTK 143
           L+A +GS TI+ KTLKKTG+T+EDIA KAWESE+ K TR+  + TA+K+DESFEPVR TK
Sbjct: 77  LRAQKGS-TIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTK 135

Query: 144 IYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQ 203
           +YKDVSEV+ DDG+S RYGGFI K++RRLK+E  L SGKR +AVKSNDEAGTALVATN++
Sbjct: 136 VYKDVSEVI-DDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIE 194

Query: 204 SHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRV 263
           + ES  +K E+FKE+T  G+ +H  KV  WDESENPLIVLLR I  K+ G F ETES+RV
Sbjct: 195 AKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARV 254

Query: 264 YSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFR 323
             QFK++D  FN ESFT+HLREYI+PEILEAY+KGDE VLK WFSEAP+NVY+AQQK FR
Sbjct: 255 MGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFR 314

Query: 324 QQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDI 383
            Q LF DG ILDIR VEIVSAKLL PQDIPVLVV CRAQEI++YRK KTGE+AAG  S+I
Sbjct: 315 DQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNI 374

Query: 384 LMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421
           L+S+YAMVFTRDPE +D+ ETEGWRILEFVRG SRQFT
Sbjct: 375 LLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412

>Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022W
           (TIM44) - 48.8 kDa protein involved in mitochondrial
           protein import [contig 149] FULL
          Length = 412

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/396 (70%), Positives = 337/396 (85%), Gaps = 2/396 (0%)

Query: 26  HTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYLK 85
            T R      R+PLQIFRETFK+EW+KS ELQ +IK LQDASGK+ ES+AYKKAR+AYLK
Sbjct: 19  QTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYKKAREAYLK 78

Query: 86  AHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIY 145
           A +GS TI+ KT+KKTGD++E IA KAWESEISK+TR+  ++TA KLDESFEPVR+T++Y
Sbjct: 79  AQKGS-TIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEPVRHTRVY 137

Query: 146 KDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSH 205
           KDVSEV+ + G+S RYGGFI K++RRLK E  + SGKR +AV+SNDEAGTALVATN+++ 
Sbjct: 138 KDVSEVM-ESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVATNIEAK 196

Query: 206 ESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYS 265
           ES G+K ++FKE+T+VG+ LH+FKV  WDESENPLIVLLR I  KI G F ETES+RV  
Sbjct: 197 ESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETESARVMG 256

Query: 266 QFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQ 325
           QFK++D  FN+ESF  HLREYI+PE+LEAY+KGDEKVLK WFSEAP+NVY+AQQKVFR+Q
Sbjct: 257 QFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQKVFREQ 316

Query: 326 NLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILM 385
            LF DG ILDIR V+IVSAKLL PQD+PVLVV CRAQEI++YR +KTGEVAAG  S+ILM
Sbjct: 317 GLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILM 376

Query: 386 STYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421
           S+YAMVFTRDPE+IDN ETEGW+ILEFVRG SRQFT
Sbjct: 377 SSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412

>TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {ON}
           Anc_7.196 YIL022W
          Length = 416

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/393 (70%), Positives = 341/393 (86%), Gaps = 4/393 (1%)

Query: 29  RNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYLKAHR 88
           RN G   +TP+QIFRETFKKEWEKS ELQ +IK LQDASG++ +SEAYKKA++AY+KA +
Sbjct: 28  RNGGG--KTPIQIFRETFKKEWEKSQELQDNIKTLQDASGRLGQSEAYKKAKEAYVKAQQ 85

Query: 89  GSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIYKDV 148
            SSTI+ KTLKKTG+T+ED+A K W+SEI K+TR++ S+ AKK+DESFEPVR T++YK+V
Sbjct: 86  -SSTIVSKTLKKTGETVEDLAKKTWDSEIGKSTRKVVSQGAKKIDESFEPVRQTQVYKEV 144

Query: 149 SEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSHESI 208
           SEV+ DDG+S RYGGFI K++RR KRE  L SGKRVRA KSN+EAGTA+VATNV+S ES 
Sbjct: 145 SEVI-DDGESSRYGGFISKEQRRKKREADLASGKRVRATKSNEEAGTAIVATNVESKESF 203

Query: 209 GQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYSQFK 268
           G+K ++FKE+T+VGK + +FKV  WDE+ENPLIV+LR I+ KI+GFF ETESSRVYSQFK
Sbjct: 204 GKKIDDFKEKTVVGKTMKSFKVRVWDENENPLIVVLRTISNKISGFFAETESSRVYSQFK 263

Query: 269 LIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQNLF 328
           L+D TF+  +FT+HLR+YI+PE+LEAY+KGDE VLK WFSEAPFNVY+AQQK  R+Q LF
Sbjct: 264 LMDPTFSNAAFTKHLRDYIIPEVLEAYVKGDEVVLKKWFSEAPFNVYAAQQKELRKQQLF 323

Query: 329 PDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILMSTY 388
            DG ILDIR V+IVSAKLL PQDIPVLVV CRAQE+++YRK+KTGE+ AG+ S+I+MS+Y
Sbjct: 324 TDGRILDIRGVDIVSAKLLAPQDIPVLVVGCRAQELHLYRKVKTGELGAGDESNIMMSSY 383

Query: 389 AMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421
           AMVFTRDP+ ID+DETEGW+ILEFVRG SRQFT
Sbjct: 384 AMVFTRDPDNIDDDETEGWKILEFVRGGSRQFT 416

>KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.196
           YIL022W
          Length = 419

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/400 (69%), Positives = 344/400 (86%), Gaps = 5/400 (1%)

Query: 25  LHTSR---NLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARD 81
           LHT+R   N G+  R+PL IFR+TFKKEWEKS ELQ +I+ LQDASGKI E+EAY+KAR+
Sbjct: 22  LHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEAYRKARE 81

Query: 82  AYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRN 141
           A+L+A +GS TI+ KTLKKTG+T+E IA+KAW+SEI+K +R+ A +TA+KLDE FEPVR 
Sbjct: 82  AFLRAQKGS-TIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGFEPVRQ 140

Query: 142 TKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATN 201
           T++YKDVSEV+ DDGDS  YGGF  ++ER+ +RE AL SG+RVRAVKSNDEAGTALVAT 
Sbjct: 141 TQLYKDVSEVI-DDGDSTSYGGFFTREERQRRREKALASGERVRAVKSNDEAGTALVATG 199

Query: 202 VQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESS 261
           V+S ES+G+K E+FKE+T VG+ LH  K   WDESENPLIV +RK++ K+  FF ETES 
Sbjct: 200 VESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAETESG 259

Query: 262 RVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKV 321
           RVY+QFKL+D  FN+ +FT+HLREY+VPEILEAY++GDEKVLK WFSEAP+NVY+AQQK+
Sbjct: 260 RVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAAQQKM 319

Query: 322 FRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNAS 381
           F+++ LF DG ILDIR VEIVSAKLLQPQD+PVLVV CRAQEIN+Y+K+KTGE+AAG+ S
Sbjct: 320 FKEKALFADGRILDIRGVEIVSAKLLQPQDLPVLVVGCRAQEINLYKKVKTGEIAAGSES 379

Query: 382 DILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421
           +ILMS+YAMVFTRDPE++ ++ETEGW+ILEFVRG SRQFT
Sbjct: 380 NILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419

>KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} similar
           to uniprot|Q01852 Saccharomyces cerevisiae YIL022W TIM44
           48.8 kDa protein involved in mitochondrial protein
           import
          Length = 479

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/418 (67%), Positives = 338/418 (80%), Gaps = 9/418 (2%)

Query: 11  GKPYYLKSAIQLVSLHTSRNLGQ-------QQRTPLQIFRETFKKEWEKSAELQGSIKEL 63
           GK   L+    L S+   RNL Q         R+PLQIFRETFK+EW+KS ELQ +IK L
Sbjct: 64  GKFRMLRPGRPLKSVVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKAL 123

Query: 64  QDASGKISESEAYKKARDAYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQ 123
           QDASGKI ESEAYKKAR+AYL A +GS TI+ KTLKKTGD++E IA KAWESEI K+TRQ
Sbjct: 124 QDASGKIGESEAYKKAREAYLSAQKGS-TIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQ 182

Query: 124 MASETAKKLDESFEPVRNTKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKR 183
             ++TA KLDESFEPVR+T++YKDVSEV+ D  +S RYGGFI K++RRLK E  + SGKR
Sbjct: 183 AVNKTAAKLDESFEPVRHTRVYKDVSEVM-DSSNSSRYGGFISKEQRRLKLEQDIASGKR 241

Query: 184 VRAVKSNDEAGTALVATNVQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVL 243
            +AVKSN+EAGTALVAT +++ ES G+K ++FKE+T+VG+ L + K   WDESENPLIVL
Sbjct: 242 PKAVKSNEEAGTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVL 301

Query: 244 LRKITLKITGFFGETESSRVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVL 303
           +R I  K+ G F ETES+RV  QFK++D  FN+ESF  HLREYI+PE+LEAY+KG+E+VL
Sbjct: 302 MRTIGNKVGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVL 361

Query: 304 KNWFSEAPFNVYSAQQKVFRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQE 363
           K WFSEAP+NVY+AQQKVFR+Q LF DG ILDIR V+IVSAKLL PQD+PVLVV CRAQE
Sbjct: 362 KQWFSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLPPQDLPVLVVGCRAQE 421

Query: 364 INIYRKIKTGEVAAGNASDILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421
           I++YR +KTGEVAAG  S+ILMS+YAMVFTRDPE ID+ ETEGW+ILEFVRG SRQFT
Sbjct: 422 IHLYRDVKTGEVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479

>ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 407

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/399 (66%), Positives = 337/399 (84%), Gaps = 2/399 (0%)

Query: 23  VSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDA 82
           V+L ++ +   Q R+PLQIFR+TFKKEWEKS ELQ +IK LQDASG++ +SE  K+AR+A
Sbjct: 11  VALFSTSSRSLQGRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAREA 70

Query: 83  YLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNT 142
           YL+A +GS TI+ KTL+KTG+T+E IA+KAWESEI+K+TR  AS TAKKLD+SFEPVRNT
Sbjct: 71  YLRAQKGS-TIVGKTLQKTGETVEGIASKAWESEIAKSTRSAASATAKKLDKSFEPVRNT 129

Query: 143 KIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNV 202
           KIYKDVSEV+ +D D+ RYGGF+ K++R++KRE  + SGKR RA++SN+EAGTALVATN+
Sbjct: 130 KIYKDVSEVM-EDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNI 188

Query: 203 QSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSR 262
           ++ ES+G+K E+F+E+T +G+ +   KV  W+E+ENPLIV+LRKIT K+ GFF ETE+++
Sbjct: 189 EAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAK 248

Query: 263 VYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVF 322
           V  QFKL+D +F +E FTR LR+Y++PE+LEAY KGDEK LK WFSEAPFNVY+AQQK F
Sbjct: 249 VIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFF 308

Query: 323 RQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASD 382
           R Q LF D  ILDIR V+IVSAKLL PQDIPVL+V CRAQEI +YR IK+GEVAAG+ S+
Sbjct: 309 RDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESN 368

Query: 383 ILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421
           ILMS+YAMVFTRDPE ++++ETEGWRI+EFVRG SRQFT
Sbjct: 369 ILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407

>Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar to
           Ashbya gossypii ADL118C
          Length = 418

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/387 (67%), Positives = 329/387 (85%), Gaps = 2/387 (0%)

Query: 35  QRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYLKAHRGSSTIL 94
           Q++PLQIFRETFK EW+KS ELQ +IK LQDASG++ ES+AYKKAR+AYLKA RGS T++
Sbjct: 34  QKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREAYLKAQRGS-TVV 92

Query: 95  DKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIYKDVSEVLND 154
            KTLKKTG+T+E++  KAW+S+I KNTR++ S+TA+KLDESFEPVR+T++YKD+SE++ D
Sbjct: 93  GKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHTRVYKDMSELI-D 151

Query: 155 DGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSHESIGQKYEN 214
           DG+S RYGGFI K+ RR KRE+ L SG+R  AV+SNDEAGTA+VATN +  ES G+K ++
Sbjct: 152 DGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKEGKESFGKKIQD 211

Query: 215 FKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYSQFKLIDQTF 274
           FKE+T +G+ LH  KV  WDE+ENPLI +LR I+ KI G F ETES+RV++QFKL+D TF
Sbjct: 212 FKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARVFAQFKLLDPTF 271

Query: 275 NAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQNLFPDGNIL 334
           N+E FT+HLREYI+PE+LEAY+KGDE VLK W SEAP+NVY+AQQK FR+Q LFPDG +L
Sbjct: 272 NSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFREQELFPDGRVL 331

Query: 335 DIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILMSTYAMVFTR 394
           DIR VEIVSAKLL PQD+P LVV CR QEI++YRK KTGE+AAG+ S+I+MS+YAMV TR
Sbjct: 332 DIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESNIMMSSYAMVLTR 391

Query: 395 DPEEIDNDETEGWRILEFVRGNSRQFT 421
           DPE + + ETEGW++LEF+RG SRQFT
Sbjct: 392 DPENVTDKETEGWKVLEFIRGGSRQFT 418

>ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL022W
           (TIM44)
          Length = 418

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/394 (65%), Positives = 329/394 (83%), Gaps = 2/394 (0%)

Query: 28  SRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYLKAH 87
           +R  G   ++PLQ+FRETFK+EW+KS ELQ +IK LQDA G++ ES+AYKKAR+AYLKA 
Sbjct: 27  TRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKKAREAYLKAQ 86

Query: 88  RGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIYKD 147
           +GS TI+ KTLK+TG+TLE I  +AWESEI K TR+  S+TA+KLDESFEPVR TK+YKD
Sbjct: 87  KGS-TIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEPVRQTKVYKD 145

Query: 148 VSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSHES 207
           +SE++ DDG+S RYGGF++K+ RR KRE  L +GKR   V+SN+EAG+ALVAT+ ++ ES
Sbjct: 146 MSEII-DDGESSRYGGFMEKERRREKRERDLATGKRATPVRSNEEAGSALVATDKEASES 204

Query: 208 IGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYSQF 267
           +G+K ++FKE+T+VG+ LH  KV  WDE+ENPLI LLR I+ K+ G F ETES+RV++QF
Sbjct: 205 LGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETESARVFAQF 264

Query: 268 KLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQNL 327
           KL+D TFN E FT+HLREYI+PE+LEAY+KGDE+VLK WFSEAP+NVYSAQQK  RQQ L
Sbjct: 265 KLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIRQQEL 324

Query: 328 FPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILMST 387
           F DG ILDIR VEI+SAKLL PQD+P +VV CRAQEI+++RK  TGE+AAG+ S+I++S+
Sbjct: 325 FADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHESNIMLSS 384

Query: 388 YAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421
           YAMV TRDPE++D+ ETEGW+ILEFVRG SR FT
Sbjct: 385 YAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418

>TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/422 (61%), Positives = 328/422 (77%), Gaps = 22/422 (5%)

Query: 17  KSAIQLVSLHTSRNL-------------GQQQRTPLQIFRETFKKEWEKSAELQGSIKEL 63
           +S IQ  +LH S+ L                 +TP+QIFRETFK+EWEKSA LQ  IK L
Sbjct: 5   RSLIQRNALHPSKLLISSFHSYPVVLQSNDSNKTPIQIFRETFKQEWEKSATLQDQIKTL 64

Query: 64  QDASGKISESEAYKKARDAYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQ 123
            DAS +I++S+A+KKA+DAY K     +TIL KT+ KTG  L D A KAW+S++++ T+ 
Sbjct: 65  TDASDRINQSDAFKKAKDAY-KNVSNQTTILSKTISKTGTKLNDAALKAWDSDLAQKTKL 123

Query: 124 MASETAKKLDESFEPVRNTKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKR 183
                AKKLD+SFEPVRNTKIYKDVSEV++D  +SY+YGGFI K+ERR KR + L++GKR
Sbjct: 124 ----AAKKLDDSFEPVRNTKIYKDVSEVIDDKDNSYKYGGFISKEERRSKRISDLQTGKR 179

Query: 184 VRAVKSNDEAGTALVATNVQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVL 243
           ++ +KSNDEAGTAL+AT+++S ESI +K  +FKE+T+VG+ + + K   WDE++NPLIV 
Sbjct: 180 MKPIKSNDEAGTALIATDLKSKESINEKLNDFKEKTVVGQTMTSIKTKVWDENDNPLIVG 239

Query: 244 LRKITLKITGFFGETESSRVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVL 303
           +RK+T     FF ETESSRV +QFKLID  FN ESF R LREYI+PE+LEAYIKGDEK+L
Sbjct: 240 MRKVTGVFNRFFAETESSRVLTQFKLIDPNFNNESFLRSLREYIIPEVLEAYIKGDEKIL 299

Query: 304 KNWFSEAPFNVYSAQQKVFRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQE 363
           KNWFSEAP+NVYSAQQK  R+Q +F DG +LDIR V+IV+AK+L PQDIPV+VVSCRAQE
Sbjct: 300 KNWFSEAPYNVYSAQQKELRKQKIFSDGRVLDIRGVDIVTAKMLPPQDIPVIVVSCRAQE 359

Query: 364 INIYRKI----KTGEVAAGNASDILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQ 419
           INIY+K     +T ++ AG+ S+ILMSTYAMVFTRDPE++DNDETEGW+ILEFVRG SR+
Sbjct: 360 INIYKKFNVEKQTNDIVAGHDSNILMSTYAMVFTRDPEQLDNDETEGWKILEFVRGGSRK 419

Query: 420 FT 421
           FT
Sbjct: 420 FT 421

>YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON}
           CDC16Subunit of the anaphase-promoting complex/cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; required for sporulation
          Length = 840

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 71/148 (47%), Gaps = 6/148 (4%)

Query: 19  AIQLVSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKK 78
           +IQL   HT R L + +   ++ FR   +K  +K++E+  S+  L   + K+ ++  +  
Sbjct: 675 SIQLNLGHTYRKLNENE-IAIKCFRCVLEKN-DKNSEIHCSLGYLYLKTKKLQKAIDHLH 732

Query: 79  ARDAYLKAHRGSSTILDKTLKKTGDTLEDIATKAW---ESEISKNTRQMASETAKKLDES 135
            +  YLK +  S+T L K   +   TL   A+       + +S+ ++  AS   K+   +
Sbjct: 733 -KSLYLKPNNSSATALLKNALELNVTLSLDASHPLIDKSNLMSQASKDKASLNKKRSSLT 791

Query: 136 FEPVRNTKIYKDVSEVLNDDGDSYRYGG 163
           ++PV   K  +   E+ + +  + R GG
Sbjct: 792 YDPVNMAKRLRTQKEIFDQNNKALRKGG 819

>TPHA0H01610 Chr8 complement(366969..368024) [1056 bp, 351 aa] {ON}
           Anc_5.404 YHR101C
          Length = 351

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 11/110 (10%)

Query: 2   LVRSRVGVSGKPYYLKSAIQLVSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIK 61
           LVRS +G    PYY   A+   SL+          +P++IF + FKK      +L  + +
Sbjct: 189 LVRSILGKIPSPYY---AVVYTSLNPGNIATHDNASPIRIFSDIFKKGKFYKRDLTKNNR 245

Query: 62  ELQDASGKISESEAYKKARDAYLKAHRGSSTILDKT-LKKTGDTLEDIAT 110
           +        +    + K  D+Y+       T+ DK  ++K   TL+ I T
Sbjct: 246 KFDAPPSVHNYKPKFDKMSDSYV-------TVFDKEFIEKHLPTLKTIVT 288

>Smik_8.154 Chr8 complement(229050..232316,232428..232433) [3273 bp,
           1090 aa] {ON} YHR077C (REAL)
          Length = 1090

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 63  LQDASGKISESEAYKKARDAYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEI-SKNT 121
           L D S  + ES++ K  +D+ + +   SS   D  +  + D ++D++ K W S + +K T
Sbjct: 350 LPDISKTVEESQSSKSEKDSNVASKNISSFFTDLEMADSKDIIDDLSNKYWLSHLDNKAT 409

Query: 122 R 122
           R
Sbjct: 410 R 410

>TDEL0B06590 Chr2 complement(1166277..1167824) [1548 bp, 515 aa]
           {ON} Anc_2.571 YKL047W
          Length = 515

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 262 RVYSQFKLIDQTFNAESFTRHLREYIVPEIL---EAYIKGDEKVLKNWFSEAPFNVYSAQ 318
           ++Y+   +ID  F+A      L     P       AY+   +++L +W +E  F  Y   
Sbjct: 108 KMYALGVIIDPKFSARGIPDDLVSSWWPTQFIGANAYVDDLQQLLTHWLAEENFENYDLF 167

Query: 319 QKVFRQQNLFPDGN 332
           ++ F+  +L  DGN
Sbjct: 168 EEYFKCNSLIDDGN 181

>Smik_14.336 Chr14 (594978..596864) [1887 bp, 628 aa] {ON} YNR006W
           (REAL)
          Length = 628

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 61/150 (40%), Gaps = 25/150 (16%)

Query: 211 KYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYSQFKLI 270
           K +N  ++    K   NF +N   +  N L+ +  KI+  I   +            +L+
Sbjct: 388 KLQNLAQKVFASKARLNFALNDKAQKYNTLVEMNGKIS-DIMNIYD-----------RLL 435

Query: 271 DQTFNAESFTRHLREYIVPEI------LEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQ 324
           +Q   + + ++   +Y +P++        AY   ++        E P   Y  QQ+   Q
Sbjct: 436 EQQLQSINLSQ---QYTLPQVPSDPYSYSAYHMANQHYEVPSLHETPSYQYKPQQESSYQ 492

Query: 325 Q----NLFPDGNILDIRNVEIVSAKLLQPQ 350
           Q    NLFP  NI  ++ + +V     +PQ
Sbjct: 493 QPVQTNLFPTTNIDHLKTINMVPHAQQKPQ 522

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,079,585
Number of extensions: 1958940
Number of successful extensions: 6112
Number of sequences better than 10.0: 125
Number of HSP's gapped: 6375
Number of HSP's successfully gapped: 127
Length of query: 421
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 309
Effective length of database: 40,638,807
Effective search space: 12557391363
Effective search space used: 12557391363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)