Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A018602.533ON49036214290.0
KNAG0C058102.533ON5541203953e-41
Smik_13.2492.533ON4731323599e-37
TDEL0A030702.533ON2391073395e-36
YMR070W (MOT3)2.533ON4901413531e-35
Skud_13.2262.533ON4751443466e-35
TBLA0G022302.533ON2161123299e-35
ZYRO0B02002g2.533ON2941083322e-34
NCAS0F009002.533ON5251323407e-34
Suva_13.2462.533ON419853252e-32
NDAI0H014002.533ON5411373275e-32
Kpol_1018.332.533ON5891143223e-31
NCAS0A048002.533ON5111093124e-30
CAGL0K03003g2.533ON6471173092e-29
SAKL0A09482g2.533ON3881242961e-28
AGL071C2.533ON3961242952e-28
Ecym_72552.533ON5441342922e-27
KLLA0E18547g2.533ON4311212856e-27
TPHA0G035102.533ON3871372838e-27
KLTH0D06842g2.533ON5061162823e-26
NDAI0K018602.533ON7301342844e-26
Kwal_26.80212.533ON5071112752e-25
TBLA0I014802.533ON513692682e-24
KAFR0J003402.533ON2181102304e-21
KNAG0A070402.533ON3521062218e-19
TPHA0C041902.533ON417531821e-13
YKL062W (MSN4)2.598ON630561501e-09
NCAS0A129102.598ON822481501e-09
Smik_11.1862.598ON641561501e-09
Skud_11.1672.598ON628561482e-09
NDAI0C005602.598ON972561492e-09
Kpol_185.32.598ON647561473e-09
TBLA0G019202.598ON523561437e-09
ZYRO0F01012g2.598ON584561439e-09
TDEL0B069102.598ON437561402e-08
Suva_11.1642.598ON639561412e-08
Suva_13.2062.598ON709481412e-08
CAGL0F05995g2.598ON597481402e-08
KLTH0D08734g2.598ON677561402e-08
CAGL0M13189g2.598ON541561392e-08
YMR037C (MSN2)2.598ON704481402e-08
SAKL0B11330g2.598ON499561392e-08
Skud_13.1932.598ON704481402e-08
TBLA0H028302.598ON746481402e-08
KLLA0F26961g2.598ON694591403e-08
Smik_13.2072.598ON703481393e-08
TPHA0N014602.598ON519561383e-08
KAFR0A023202.598ON443481365e-08
NCAS0H030802.598ON730561376e-08
Ecym_23012.598ON767481376e-08
Kwal_26.83512.598ON698561367e-08
Kpol_1013.212.598ON494561348e-08
NDAI0B013402.598ON769481351e-07
KAFR0F020702.598ON370561321e-07
ABR089C2.598ON571481332e-07
TPHA0C025802.598ON365481312e-07
KNAG0H005502.598ON620561294e-07
KNAG0G012808.144ON472531285e-07
KAFR0B063608.425ON627631251e-06
CAGL0M00594g4.351ON1020841252e-06
Suva_13.704.351ON777511233e-06
CAGL0L06072g8.144ON300561203e-06
NCAS0C040708.144ON289671194e-06
KNAG0M023102.598ON660561206e-06
YML081W (TDA9)4.351ON1251511206e-06
Smik_13.584.351ON1253511206e-06
TBLA0B061604.351ON1384561206e-06
KAFR0F012106.256ON311681186e-06
Skud_13.614.351ON1253511206e-06
TPHA0B003804.351ON1310451207e-06
YPL230W (USV1)6.256ON391481179e-06
NDAI0G034208.144ON484561171e-05
TBLA0G032403.298ON511541171e-05
Smik_6.4356.256ON386481161e-05
Suva_16.766.256ON392481161e-05
SAKL0H24816g8.144ON410551161e-05
NCAS0A062504.351ON1341611181e-05
NDAI0C06260na 1ON582501171e-05
KNAG0M003504.351ON1076631171e-05
SAKL0G18062g4.351ON1238541171e-05
KLTH0H08800g8.117ON168531101e-05
Kpol_1031.428.144ON359571151e-05
KAFR0B068104.351ON1155541172e-05
Skud_13.3486.256ON216701122e-05
Kpol_1001.14.351ON1341451162e-05
Kwal_26.80112.531ON190511102e-05
Skud_16.486.256ON398491142e-05
KLTH0D18062g4.351ON1128521162e-05
Kwal_47.166214.351ON1178521162e-05
KLTH0E06688g8.144ON397491142e-05
TBLA0E047704.351ON1655571162e-05
TBLA0B060502.303ON762721152e-05
TDEL0F026904.80ON350631132e-05
TBLA0H006608.425ON1311601152e-05
KAFR0B025508.234ON890531152e-05
Kpol_1052.83.298ON386711133e-05
AER159C4.351ON1191541153e-05
NCAS0B046008.144ON547491143e-05
Suva_13.3636.256ON211571103e-05
Smik_13.3876.256ON212571103e-05
KLLA0B04477g4.351ON1332541143e-05
YMR182C (RGM1)6.256ON211571103e-05
ACL057W8.144ON520541133e-05
ADL198W2.303ON547731133e-05
Kpol_541.398.116ON291561114e-05
KAFR0B021608.144ON453541124e-05
NCAS0G012706.256ON274991114e-05
SAKL0F01980g3.518ON385701124e-05
ZYRO0A09416g8.425ON1346671134e-05
ZYRO0G19140g8.144ON557491125e-05
KNAG0D021208.144ON402501115e-05
AGR172W8.425ON1057551125e-05
Kwal_47.172418.144ON403491115e-05
KLLA0C17072g8.144ON474491115e-05
Ecym_84038.144ON573541125e-05
KAFR0E042704.351ON1255511125e-05
Smik_5.2768.144ON442491116e-05
Skud_5.2488.144ON442481116e-05
CAGL0H04213g4.351ON1321471127e-05
TBLA0E04210singletonON454501107e-05
NDAI0D037504.80ON493561117e-05
Suva_5.2518.144ON449491107e-05
KLLA0F20636gsingletonON285501097e-05
TPHA0C021608.425ON13751081118e-05
NDAI0I009906.256ON409791099e-05
CAGL0E06116g6.256ON613481109e-05
NDAI0D032404.351ON1362511101e-04
ZYRO0B14894g4.351ON1119611101e-04
KLLA0F13046g8.425ON1379511101e-04
YER130C8.144ON443491091e-04
KNAG0H019302.303ON618871091e-04
SAKL0H12958g8.425ON1129551101e-04
CAGL0K02145g8.144ON317551071e-04
TBLA0E028205.586ON312651071e-04
TDEL0B046708.144ON312491071e-04
KNAG0G018708.234ON875611091e-04
Kpol_529.138.425ON1410571091e-04
TDEL0D006704.351ON1199541091e-04
KNAG0C060305.586ON314651071e-04
KNAG0H011803.281ON254601061e-04
Suva_2.3838.425ON13191221082e-04
KLTH0G10802g2.303ON526511082e-04
TBLA0F038308.234ON967531082e-04
NDAI0J028504.351ON1537541082e-04
NCAS0G037302.303ON571711072e-04
TBLA0E042208.234ON519501072e-04
Skud_8.555.586ON535901072e-04
SAKL0E07216g2.303ON548511072e-04
NCAS0B028408.425ON1152531072e-04
CAGL0E04884g8.425ON1489511082e-04
CAGL0A01628g4.80ON424581062e-04
TPHA0D010508.144ON439481062e-04
TPHA0G002707.543ON472341062e-04
Ecym_33412.303ON560511072e-04
KAFR0A008001.326ON753531072e-04
TBLA0F003708.144ON687511072e-04
KLLA0F23782g2.162ON782601072e-04
TPHA0A019408.234ON912531072e-04
Suva_7.2404.80ON515561062e-04
ADR308Cna 2ON278651043e-04
KAFR0A067205.586ON235891033e-04
YDR216W (ADR1)8.425ON1323541063e-04
Kwal_27.114602.303ON531511053e-04
Smik_4.4638.425ON1324541063e-04
KNAG0D037104.80ON459651053e-04
CAGL0E04312g5.586ON688651053e-04
KAFR0C029808.144ON225491023e-04
TPHA0G008202.303ON532511053e-04
KAFR0F036004.80ON335561043e-04
YDR463W (STP1)5.586ON519651053e-04
KNAG0B067104.351ON1053541053e-04
Suva_8.625.586ON545701054e-04
Kpol_1023.635.586ON556651054e-04
Ecym_8011na 2ON276501034e-04
Skud_10.3514.351ON1327511054e-04
NCAS0H028905.586ON532651044e-04
CAGL0L11880g8.234ON980611054e-04
Skud_4.7395.586ON514651044e-04
ZYRO0B11770g8.234ON867531054e-04
NDAI0B019308.144ON436481044e-04
Smik_4.7425.586ON528651044e-04
KLLA0C16005g6.256ON331591034e-04
Kpol_1032.528.234ON824531044e-04
NDAI0H011105.586ON454861044e-04
KLLA0E08713g2.303ON596721045e-04
NCAS0F00910singletonON350521035e-04
Smik_7.2514.80ON505561045e-04
KNAG0E016003.518ON338561035e-04
Suva_12.2184.351ON1270511045e-04
CAGL0L05786g8.116ON348491025e-04
KNAG0I020702.162ON572581035e-04
Smik_10.4204.351ON1348511045e-04
NCAS0F009202.531ON354521026e-04
Skud_4.4788.425ON1323541046e-04
YJR127C (RSF2)4.351ON1380511046e-04
AEL174W1.326ON661611036e-04
TBLA0I032803.518ON330501026e-04
YGL035C (MIG1)4.80ON504561036e-04
TPHA0K002105.586ON481651027e-04
TPHA0D034003.518ON338501017e-04
TPHA0A04530singletonON501531027e-04
KAFR0A071206.256ON315841017e-04
Smik_4.3378.234ON894611037e-04
NDAI0C048608.425ON1350581037e-04
Kpol_1023.1004.351ON916541037e-04
TDEL0A013008.234ON837531037e-04
YDR096W (GIS1)8.234ON894611037e-04
KNAG0F017106.256ON413481027e-04
KAFR0C004903.281ON22451998e-04
Skud_7.2494.80ON502561028e-04
TDEL0G023302.303ON506721028e-04
KAFR0H032402.303ON519511028e-04
TPHA0H018506.256ON361541018e-04
Kwal_47.178882.162ON786681028e-04
TBLA0B049607.543ON448591019e-04
ZYRO0D13992g5.586ON587741029e-04
SAKL0A10582gsingletonON288541000.001
Suva_2.2558.234ON894611020.001
NCAS0A018204.80ON455621010.001
NDAI0G007202.303ON708691010.001
KLTH0E09724g2.162ON768681010.001
Kpol_1026.84.80ON412561000.001
Skud_4.3548.234ON916531010.001
Skud_5.3088.234ON802501010.001
KAFR0C031408.117ON370641000.001
Kpol_423.153.518ON392561000.001
KLTH0E09922g8.425ON1119791010.001
AFR531Wna 3ON27483990.001
YER169W (RPH1)8.234ON796501010.001
NDAI0C006905.586ON650651000.001
Suva_5.3038.234ON797501010.001
Ecym_4128na 4ON31248990.001
CAGL0K12078g3.281ON463491000.001
TBLA0I027004.214ON737671000.001
Smik_5.3418.234ON798501000.001
SAKL0G06292g5.586ON517671000.001
NDAI0B022508.234ON1156531010.001
KNAG0G011408.117ON519631000.001
YHR006W (STP2)5.586ON541701000.001
ZYRO0G20526g1.326ON849781000.001
Ecym_54242.162ON775681000.002
Ecym_1475na 3ON34976980.002
ACR264W2.162ON769681000.002
NCAS0C042308.117ON33853980.002
KAFR0C057105.586ON44262990.002
Ecym_1383na 5ON38150980.002
KNAG0A044608.425ON1290501000.002
KLTH0G01826g3.518ON30749980.002
Kwal_14.22068.117ON25461970.002
NCAS0I014603.298ON33054980.002
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A01860
         (490 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   555   0.0  
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   156   3e-41
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   142   9e-37
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   135   5e-36
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   140   1e-35
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   137   6e-35
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   131   9e-35
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   132   2e-34
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   135   7e-34
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...   129   2e-32
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   130   5e-32
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   128   3e-31
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   124   4e-30
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   123   2e-29
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   118   1e-28
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   118   2e-28
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   117   2e-27
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   114   6e-27
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   113   8e-27
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...   113   3e-26
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   114   4e-26
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   110   2e-25
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...   107   2e-24
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       93   4e-21
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    90   8e-19
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    75   1e-13
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    62   1e-09
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    62   1e-09
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    62   1e-09
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    62   2e-09
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     62   2e-09
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    61   3e-09
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    60   7e-09
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    60   9e-09
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    59   2e-08
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    59   2e-08
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    59   2e-08
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    59   2e-08
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    59   2e-08
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    58   2e-08
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    59   2e-08
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    58   2e-08
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    59   2e-08
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    59   2e-08
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    59   3e-08
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    58   3e-08
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    58   3e-08
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    57   5e-08
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    57   6e-08
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    57   6e-08
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    57   7e-08
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    56   8e-08
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     57   1e-07
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    55   1e-07
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    56   2e-07
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    55   2e-07
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    54   4e-07
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    54   5e-07
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    53   1e-06
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    53   2e-06
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    52   3e-06
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    51   3e-06
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      50   4e-06
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    51   6e-06
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    51   6e-06
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    51   6e-06
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    51   6e-06
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    50   6e-06
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    51   6e-06
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    51   7e-06
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    50   9e-06
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    50   1e-05
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     50   1e-05
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    49   1e-05
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    49   1e-05
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    49   1e-05
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    50   1e-05
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             50   1e-05
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    50   1e-05
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    50   1e-05
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    47   1e-05
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    49   1e-05
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    50   2e-05
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    48   2e-05
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    49   2e-05
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    47   2e-05
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    49   2e-05
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    49   2e-05
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    49   2e-05
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    49   2e-05
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    49   2e-05
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    49   2e-05
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    48   2e-05
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    49   2e-05
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    49   2e-05
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    48   3e-05
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    49   3e-05
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    49   3e-05
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    47   3e-05
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    47   3e-05
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    49   3e-05
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    47   3e-05
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    48   3e-05
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    48   3e-05
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    47   4e-05
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    48   4e-05
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      47   4e-05
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    48   4e-05
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    48   4e-05
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    48   5e-05
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    47   5e-05
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    48   5e-05
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    47   5e-05
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    47   5e-05
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    48   5e-05
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    48   5e-05
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    47   6e-05
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    47   6e-05
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    48   7e-05
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             47   7e-05
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      47   7e-05
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    47   7e-05
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    47   7e-05
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    47   8e-05
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    47   9e-05
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    47   9e-05
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    47   1e-04
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    47   1e-04
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    47   1e-04
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    47   1e-04
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    47   1e-04
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    47   1e-04
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    46   1e-04
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    46   1e-04
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    46   1e-04
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    47   1e-04
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    47   1e-04
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    47   1e-04
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    46   1e-04
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    45   1e-04
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    46   2e-04
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    46   2e-04
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    46   2e-04
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    46   2e-04
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     46   2e-04
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    46   2e-04
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    46   2e-04
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    46   2e-04
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    46   2e-04
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    46   2e-04
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    45   2e-04
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    45   2e-04
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    45   2e-04
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    46   2e-04
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    46   2e-04
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    46   2e-04
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    46   2e-04
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    46   2e-04
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    45   2e-04
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    45   3e-04
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    44   3e-04
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    45   3e-04
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    45   3e-04
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    45   3e-04
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    45   3e-04
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    45   3e-04
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    44   3e-04
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    45   3e-04
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    45   3e-04
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    45   3e-04
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    45   3e-04
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    45   4e-04
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    45   4e-04
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    44   4e-04
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    45   4e-04
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    45   4e-04
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    45   4e-04
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    45   4e-04
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    45   4e-04
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     45   4e-04
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    45   4e-04
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    44   4e-04
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    45   4e-04
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     45   4e-04
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    45   5e-04
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               44   5e-04
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    45   5e-04
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    44   5e-04
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    45   5e-04
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    44   5e-04
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    44   5e-04
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    45   5e-04
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     44   6e-04
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    45   6e-04
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    45   6e-04
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    44   6e-04
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    44   6e-04
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    44   6e-04
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    44   7e-04
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    44   7e-04
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             44   7e-04
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    44   7e-04
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    44   7e-04
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    44   7e-04
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    44   7e-04
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    44   7e-04
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    44   7e-04
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    44   7e-04
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    43   8e-04
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    44   8e-04
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    44   8e-04
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    44   8e-04
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    44   8e-04
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    44   8e-04
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    44   9e-04
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    44   9e-04
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    43   0.001
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    44   0.001
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      44   0.001
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    44   0.001
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    44   0.001
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    43   0.001
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    44   0.001
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    44   0.001
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               43   0.001
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    43   0.001
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    44   0.001
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    43   0.001
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    44   0.001
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    43   0.001
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    44   0.001
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    43   0.001
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    43   0.001
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    43   0.001
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    43   0.001
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    43   0.001
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    44   0.001
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    43   0.001
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    43   0.001
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    43   0.001
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    43   0.002
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    42   0.002
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    43   0.002
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               42   0.002
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    43   0.002
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    42   0.002
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    43   0.002
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    42   0.002
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    42   0.002
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    42   0.002
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    42   0.002
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    43   0.002
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    42   0.002
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    43   0.002
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    43   0.002
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    42   0.002
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    42   0.002
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     42   0.002
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    41   0.003
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    42   0.003
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    42   0.003
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    42   0.003
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    42   0.003
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    40   0.003
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    42   0.003
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    42   0.003
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    42   0.003
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                41   0.003
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    42   0.003
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    42   0.003
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    42   0.003
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                41   0.003
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    42   0.003
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    42   0.003
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    42   0.003
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    42   0.003
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    42   0.003
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    42   0.003
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    41   0.004
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    42   0.004
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    42   0.004
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    41   0.004
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    42   0.004
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    41   0.004
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    42   0.004
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    42   0.004
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    41   0.004
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    41   0.004
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    42   0.004
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    41   0.005
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    40   0.005
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    42   0.005
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    42   0.005
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    41   0.005
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    40   0.005
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    41   0.005
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    41   0.005
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    42   0.005
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     42   0.005
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      41   0.005
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    41   0.005
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      41   0.005
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    40   0.005
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    41   0.005
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    41   0.005
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    41   0.006
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    40   0.006
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    40   0.006
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    41   0.006
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    41   0.006
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    39   0.007
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    41   0.007
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    41   0.007
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    41   0.007
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    40   0.007
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    41   0.007
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    41   0.007
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    40   0.008
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    41   0.008
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    41   0.008
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    40   0.008
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    40   0.008
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    40   0.008
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    40   0.009
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    40   0.009
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    40   0.009
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    40   0.009
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               40   0.009
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    40   0.010
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    40   0.010
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    40   0.010
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    40   0.010
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    40   0.010
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    40   0.010
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    40   0.010
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    40   0.011
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    40   0.011
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    40   0.011
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    40   0.011
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    40   0.011
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    40   0.011
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    40   0.011
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    40   0.011
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    40   0.011
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    40   0.011
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    40   0.012
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    40   0.012
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    40   0.012
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    39   0.012
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    39   0.012
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    40   0.013
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    40   0.013
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    40   0.013
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    39   0.014
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    39   0.014
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    39   0.014
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    40   0.014
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    39   0.015
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    40   0.015
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    39   0.015
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    40   0.016
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    40   0.016
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    40   0.016
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    39   0.017
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    40   0.018
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    39   0.018
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    40   0.018
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    39   0.019
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    40   0.019
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    39   0.019
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    38   0.019
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    39   0.019
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    40   0.020
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    40   0.020
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    39   0.020
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               39   0.021
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     39   0.022
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    39   0.022
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    39   0.023
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    39   0.024
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    37   0.026
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    37   0.026
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    39   0.026
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    39   0.026
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    39   0.027
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    39   0.027
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     39   0.027
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    39   0.028
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    39   0.031
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    39   0.032
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    39   0.032
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    39   0.033
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                38   0.033
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    38   0.033
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    38   0.036
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    38   0.037
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    39   0.037
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    39   0.039
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    39   0.039
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    38   0.040
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    38   0.040
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    36   0.041
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    38   0.041
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      38   0.042
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    39   0.042
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    38   0.048
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    38   0.049
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    38   0.050
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    37   0.052
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    37   0.052
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    38   0.054
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    37   0.054
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    38   0.054
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                37   0.057
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    37   0.057
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    37   0.061
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    37   0.061
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    38   0.061
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    37   0.063
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    36   0.063
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    38   0.064
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    38   0.068
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    38   0.070
NCAS0B04360 Chr2 (791449..792276) [828 bp, 275 aa] {ON}                37   0.070
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    37   0.071
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    38   0.072
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    37   0.080
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    37   0.081
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    37   0.086
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    37   0.088
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    37   0.091
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    37   0.091
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    37   0.095
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    36   0.096
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    36   0.099
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    37   0.10 
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    36   0.11 
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    37   0.11 
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    37   0.11 
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    37   0.11 
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    37   0.12 
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    37   0.12 
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    37   0.12 
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    37   0.13 
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    37   0.13 
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    36   0.13 
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    37   0.14 
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    37   0.14 
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    36   0.14 
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    37   0.14 
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    37   0.14 
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    36   0.15 
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    37   0.16 
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    35   0.16 
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    37   0.17 
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    37   0.17 
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    35   0.17 
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    36   0.18 
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     36   0.19 
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    36   0.19 
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    36   0.19 
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               36   0.19 
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    36   0.19 
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    36   0.19 
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    36   0.19 
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    36   0.19 
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    35   0.20 
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                35   0.20 
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    35   0.21 
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    35   0.23 
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    36   0.23 
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    36   0.24 
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    35   0.25 
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    36   0.25 
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    35   0.26 
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    35   0.27 
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    36   0.27 
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    36   0.28 
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    36   0.29 
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    36   0.29 
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    35   0.29 
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      35   0.30 
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    36   0.30 
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    35   0.31 
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       33   0.31 
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    35   0.31 
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    34   0.32 
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    35   0.35 
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    35   0.35 
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    35   0.36 
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    34   0.37 
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    34   0.37 
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    34   0.38 
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    35   0.38 
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    35   0.42 
NCAS0A02160 Chr1 complement(406753..407991) [1239 bp, 412 aa] {O...    35   0.43 
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    35   0.44 
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    35   0.49 
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    35   0.50 
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    34   0.52 
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    34   0.58 
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    33   0.58 
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    34   0.60 
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    34   0.71 
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    34   0.71 
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    34   0.71 
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    34   0.72 
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    34   0.73 
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    34   0.75 
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    33   0.81 
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    34   0.82 
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    33   0.82 
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    34   0.84 
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    34   0.84 
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    34   0.85 
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    34   0.86 
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    34   0.90 
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    33   0.92 
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    33   0.93 
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    34   0.94 
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    33   0.96 
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    33   1.00 
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    33   1.0  
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    33   1.1  
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    33   1.1  
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    34   1.1  
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    33   1.2  
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    34   1.2  
KNAG0D04020 Chr4 complement(726098..727558) [1461 bp, 486 aa] {O...    33   1.3  
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    33   1.3  
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    33   1.4  
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    33   1.4  
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    33   1.4  
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    33   1.4  
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    33   1.9  
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    33   1.9  
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    33   2.0  
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    33   2.0  
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    33   2.1  
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    33   2.3  
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    32   2.4  
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      32   2.4  
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    32   2.4  
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  32   2.5  
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    33   2.6  
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    33   2.6  
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    32   2.8  
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    32   3.0  
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    32   3.1  
ZYRO0A12936g Chr1 complement(1023335..1024135) [801 bp, 266 aa] ...    32   3.7  
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    32   3.9  
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    32   4.0  
CAGL0K04257g Chr11 complement(392116..393759) [1644 bp, 547 aa] ...    32   4.1  
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    32   4.3  
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    32   4.6  
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    31   4.7  
SAKL0B04664g Chr2 complement(410577..411857) [1281 bp, 426 aa] {...    32   5.1  
TDEL0G03620 Chr7 complement(667834..668565) [732 bp, 243 aa] {ON...    31   5.8  
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    32   6.1  
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    32   6.1  
TDEL0E01860 Chr5 (353978..354790) [813 bp, 270 aa] {ON} Anc_4.18...    31   6.8  
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    31   7.3  
CAGL0B02651g Chr2 complement(253495..254064) [570 bp, 189 aa] {O...    30   7.3  
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    31   7.5  
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    31   7.8  
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    31   8.3  
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    30   8.4  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    31   8.6  
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  31   8.7  
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    31   9.1  
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    30   9.4  
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    31   9.7  

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/362 (77%), Positives = 282/362 (77%)

Query: 129 SNIPVQQHQPQKNNDQNAIHNSLMNNKKFNRPSVSNIQDTQTSGSXXXXXXXXXXXXXXX 188
           SNIPVQQHQPQKNNDQNAIHNSLMNNKKFNRPSVSNIQDTQTSGS               
Sbjct: 129 SNIPVQQHQPQKNNDQNAIHNSLMNNKKFNRPSVSNIQDTQTSGSNINIAATATTNRTNL 188

Query: 189 XXXXDQMNSSNNIANTSPFIYHWGPINTSKNISELQDSNPYSSTQPFIIQRQFYNDLPYA 248
               DQMNSSNNIANTSPFIYHWGPINTSKNISELQDSNPYSSTQPFIIQRQFYNDLPYA
Sbjct: 189 VANNDQMNSSNNIANTSPFIYHWGPINTSKNISELQDSNPYSSTQPFIIQRQFYNDLPYA 248

Query: 249 NNQRPHVXXXXXXXXXXXXTIPFTVSGNDTQPNASSTSTVPAKQDILIQEKKHSMHSIES 308
           NNQRPHV            TIPFTVSGNDTQPNASSTSTVPAKQDILIQEKKHSMHSIES
Sbjct: 249 NNQRPHVYQLSSQQPLYSSTIPFTVSGNDTQPNASSTSTVPAKQDILIQEKKHSMHSIES 308

Query: 309 KPNESKYRXXXXXXXXXXXXXXXXXXXXXXXXXXXVIGGNLTLIHSCHLCEKSFRRKSWL 368
           KPNESKYR                           VIGGNLTLIHSCHLCEKSFRRKSWL
Sbjct: 309 KPNESKYRNDANSSKDNNDSNNAGGNGDNTDNSSNVIGGNLTLIHSCHLCEKSFRRKSWL 368

Query: 369 KRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKKNNAVFSCVNGGNRE 428
           KRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKKNNAVFSCVNGGNRE
Sbjct: 369 KRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKKNNAVFSCVNGGNRE 428

Query: 429 KLNDTDDIRNLISLGVINKDDVKKVINKLIXXXXXXXXXXXXXXKGAADSHXXXXXXXXI 488
           KLNDTDDIRNLISLGVINKDDVKKVINKLI              KGAADSH        I
Sbjct: 429 KLNDTDDIRNLISLGVINKDDVKKVINKLIDNHNSNSNDNNDNDKGAADSHNSNSNNSNI 488

Query: 489 PG 490
           PG
Sbjct: 489 PG 490

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 35/59 (59%)

Query: 1  MNYWNNQSPPTIIKPELSSNLLDPXXXXXXXXXXXXXXXXXXXXXXXXQMIIKPNNDCS 59
          MNYWNNQSPPTIIKPELSSNLLDP                        QMIIKPNNDCS
Sbjct: 1  MNYWNNQSPPTIIKPELSSNLLDPSFKNSENASKNKSKKNNKNHNDNSQMIIKPNNDCS 59

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  156 bits (395), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 74/120 (61%), Positives = 86/120 (71%), Gaps = 15/120 (12%)

Query: 351 LIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVI 410
            IH CHLCEKSF+R+SWLKRHLLSHS ER +LCPWCLSRHKRKDNLLQHMKLKHSNYL+ 
Sbjct: 434 FIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLKHSNYLLD 493

Query: 411 ELKKNNAVFSCVNGGNREKLNDTD------------DIRNLISLGVINKDDVKKVINKLI 458
           ELK  N  F   N G  +  N TD             I+ L+  G++NKDDVK+V+NK+I
Sbjct: 494 ELKNANVSF---NWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVLNKII 550

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  142 bits (359), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 86/132 (65%), Gaps = 25/132 (18%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           IH C  CEKSF+RKSWLKRHLLSHS +R FLCPWCLSR KRKDNLLQHMKLKH+NYL+ E
Sbjct: 337 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 396

Query: 412 LKKNNAVFSCVNGG------------------------NREKLNDTD-DIRNLISLGVIN 446
           LKKNN +F+  N                            E  N  D +I+ LI+ GV+N
Sbjct: 397 LKKNNIIFNYNNSSINSNNSNNNNSASGSGGGSAAAAPENEDGNSYDPNIKTLINDGVLN 456

Query: 447 KDDVKKVINKLI 458
           KDDVK+V+N LI
Sbjct: 457 KDDVKRVLNNLI 468

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  135 bits (339), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 64/107 (59%), Positives = 81/107 (75%), Gaps = 7/107 (6%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           +H CHLC KSF+RKSWL+RHLLSHS  R F CPWCLS+HKRKDNLLQHMKLKH++Y++ E
Sbjct: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192

Query: 412 LKKNNAVFSCVNGGNREKLNDTDDIRNLISLGVINKDDVKKVINKLI 458
           L+ NN V+    G  +      ++IR L+  G +NKD+VKKV+N LI
Sbjct: 193 LRLNN-VYVSTEGSCK------NNIRTLLYEGRLNKDEVKKVLNSLI 232

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  140 bits (353), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/141 (51%), Positives = 85/141 (60%), Gaps = 34/141 (24%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           IH C  CEKSF+RKSWLKRHLLSHS +R FLCPWCLSR KRKDNLLQHMKLKH+NYL+ E
Sbjct: 345 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 404

Query: 412 LKKNNAVFSCV---------------------------------NGGNREKLNDTD-DIR 437
           LKKNN +F+                                        E  N  D +I+
Sbjct: 405 LKKNNIIFNYNNSSSSNNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGNGYDTNIK 464

Query: 438 NLISLGVINKDDVKKVINKLI 458
            LI+ GV+NKDDVK+V+N LI
Sbjct: 465 TLINDGVLNKDDVKRVLNNLI 485

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  137 bits (346), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 85/144 (59%), Gaps = 37/144 (25%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           IH C  CEKSF+RKSWLKRHLLSHS +R FLCPWCLSR KRKDNLLQHMKLKH+NYL+ E
Sbjct: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386

Query: 412 LKKNNAVFS-------------------------------------CVNGGNREKLNDTD 434
           LKKNN +F+                                          N +  +   
Sbjct: 387 LKKNNIIFNYNKTSTNSNDNNNSTSTRTSASASSGGGGGGGGGAAAAAAPENEDGSSYDP 446

Query: 435 DIRNLISLGVINKDDVKKVINKLI 458
           +I+ LI+ GV+NKDDVK+V+N LI
Sbjct: 447 NIKTLINDGVLNKDDVKRVLNNLI 470

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  131 bits (329), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 85/112 (75%), Gaps = 6/112 (5%)

Query: 348 NLTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNY 407
           N    H C  CEK F+RKSWLKRH+LSHS ERQ+ CPWC+SRHKRKDNLLQHMKLKH++ 
Sbjct: 108 NEMAYHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDE 167

Query: 408 LVIELKKNNAVFSC-VNGGNREKLNDTDDIRNLISLGVINKDDVKKVINKLI 458
           ++ +LK      +C + G + E++ + D+IR ++  G+++KD+VKKV+N+L+
Sbjct: 168 VLKKLK-----MTCYLEGDDGEEMMNRDNIRTMLYEGLLDKDEVKKVLNELL 214

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  132 bits (332), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 8/108 (7%)

Query: 351 LIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVI 410
           L H C +C+KSF+RKSWL+RHLLSHS ER F CPWCLS+HKRKDNLLQHMKLKH+ Y++ 
Sbjct: 190 LSHLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLE 249

Query: 411 ELKKNNAVFSCVNGGNREKLNDTDDIRNLISLGVINKDDVKKVINKLI 458
           +L+  N     ++G  R      D+IR L+  G +NK+DVKKV+N LI
Sbjct: 250 KLRNQNV---GIDGEVRN-----DNIRTLLCEGRLNKEDVKKVLNGLI 289

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  135 bits (340), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 63/132 (47%), Positives = 85/132 (64%), Gaps = 25/132 (18%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           ++ CH+C K+F+R+SWLKRHLLSHS+ER + CPWCLSRHKR+DNLLQHMKLKHS  L+ E
Sbjct: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446

Query: 412 LKKNNAVFSC------------------------VNGGNRE-KLNDTDDIRNLISLGVIN 446
           LK  N +F                          ++G N    +N    IR L++ GV+N
Sbjct: 447 LKFRNVIFDWHNYHYQQQVQRHQQYQQQGGMPPQIHGANEPFNINSEFTIRTLVTNGVVN 506

Query: 447 KDDVKKVINKLI 458
           K+DVK+V+N+L+
Sbjct: 507 KEDVKRVLNQLV 518

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score =  129 bits (325), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 60/85 (70%), Positives = 67/85 (78%), Gaps = 6/85 (7%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           IH C  CEKSF+RKSWLKRHLLSHS +R FLCPWCLSR KRKDNLLQHMKLKH+NYL+ E
Sbjct: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385

Query: 412 LKKNNAVF------SCVNGGNREKL 430
           LKKNN +F      +  N G RE+L
Sbjct: 386 LKKNNIIFNYNNSNTTSNSGRREQL 410

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  130 bits (327), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 84/137 (61%), Gaps = 31/137 (22%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412
           + C +CEK F+R+SWLKRHLLSHS+ER +LCPWCLSRHKR+DNLLQHMKLKH N L+ EL
Sbjct: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459

Query: 413 KKNNAVFS------------------CVNGGNREKLNDTDD-------------IRNLIS 441
           K  N + S                   +N G    +  T D             I++LIS
Sbjct: 460 KLRNFISSQTAAASVAFVTSAAPSIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLIS 519

Query: 442 LGVINKDDVKKVINKLI 458
            G+INK+DVK+++N LI
Sbjct: 520 EGLINKEDVKRLLNILI 536

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  128 bits (322), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 77/114 (67%), Gaps = 11/114 (9%)

Query: 351 LIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS----N 406
             H CH+C K F+RKSWL+RHLLSHS+ER F CPWCLS+HKRKDNLLQHMKLKH+     
Sbjct: 475 FAHVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENVLE 534

Query: 407 YLVIELKKNNAVFSCVNGGNREKLNDTDD--IRNLISLGVINKDDVKKVINKLI 458
            L I LK NN      N  +   L    D  IR L+  G++NKD+VKK++N L+
Sbjct: 535 QLRINLKANNP-----NDNSEPTLEGNGDHNIRTLMGEGILNKDEVKKLLNSLV 583

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  124 bits (312), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 79/109 (72%), Gaps = 2/109 (1%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           ++ CH+C KSFRR SWLKRHLL+HS++R + CP C+S+HKRKDNLLQH+KLKH+ +++ +
Sbjct: 386 VYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVLEQ 445

Query: 412 LKKNNAVFSCV--NGGNREKLNDTDDIRNLISLGVINKDDVKKVINKLI 458
           L+++N         G   +      +I+ L+  G +NK+DVKKV+N+LI
Sbjct: 446 LRQDNIDIKTAKDEGEEDQGTASNTNIKTLLVEGRLNKEDVKKVLNRLI 494

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  123 bits (309), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 77/117 (65%), Gaps = 10/117 (8%)

Query: 349 LTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           L   H CHLC K F+RKSWLKRHLLSHS +R FLCPWC SRHKR+DNLLQHMKLKH   L
Sbjct: 530 LAFPHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNL 589

Query: 409 VIELKKNNAVFSCVNGGNREKLN-------DTDDIRNLISLGVINKDDVKKVINKLI 458
           + E+   N  F   N    E+L+       +  D + LI  G++NKD++K ++N +I
Sbjct: 590 LQEINSRNMRF---NWPILERLSKQIDGTIEYPDTKTLIHEGLLNKDELKNILNTVI 643

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  118 bits (296), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 78/124 (62%), Gaps = 18/124 (14%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412
           H CHLC+KSF+RKSWLKRHLLSHS+ + F CPWC SRHKRKDNLLQHMKLKH+  ++ EL
Sbjct: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317

Query: 413 KK-------------NNAVFSCVNG-----GNREKLNDTDDIRNLISLGVINKDDVKKVI 454
           +              N A  +  NG          ++    I+ +I  G +NKDDVK+V+
Sbjct: 318 QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKRVL 377

Query: 455 NKLI 458
           N LI
Sbjct: 378 NMLI 381

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  118 bits (295), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/124 (47%), Positives = 79/124 (63%), Gaps = 22/124 (17%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           IH CH CEK+F+RKSWLKRHLLSHST + + CPWC SRHKRKDNL QH+KLKH+  L+  
Sbjct: 184 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 243

Query: 412 LKKN-NAVFSCVNGGNREKLNDTD----------------DIRNLISLGVINKDDVKKVI 454
           L  N N   S +N     +L+ +D                 I+++I  G+++K++VKK +
Sbjct: 244 LSSNPNTPTSLIN-----RLHSSDAAAGSAAAAAGTPAAFSIKDMIDSGMLSKNEVKKTL 298

Query: 455 NKLI 458
           N LI
Sbjct: 299 NSLI 302

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  117 bits (292), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 76/134 (56%), Gaps = 27/134 (20%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           IH CH CEK+F+RKSWLKRHLLSHST + + CPWC SRHKRKDNL QH+KLKH+  L+  
Sbjct: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344

Query: 412 LKKN--------NAVFSCVNGGNREKLNDTD-------------------DIRNLISLGV 444
           L  N        N + S  NG         D                    I+++I  G+
Sbjct: 345 LSSNPNTASHLMNRLHSGANGAVAVTAASADSSATMVSSSSSSAAGPTTFSIKDMIDSGM 404

Query: 445 INKDDVKKVINKLI 458
           ++K++VKK +N LI
Sbjct: 405 LSKNEVKKTLNSLI 418

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  114 bits (285), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 73/121 (60%), Gaps = 15/121 (12%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412
           + CHLCEK FRRKSWLKRHLLSHS  ++F CPWC S HKRKDNLLQH+KLKH+ YL+ E 
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365

Query: 413 KKNNAVFSCVNG-GNREKLNDTD--------------DIRNLISLGVINKDDVKKVINKL 457
                + +  NG GN   L  T                IR+++    + KD VK+ +N +
Sbjct: 366 TLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNYI 425

Query: 458 I 458
           +
Sbjct: 426 V 426

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  113 bits (283), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 77/137 (56%), Gaps = 23/137 (16%)

Query: 345 IGGNLTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKH 404
           I  N   I  C++C K F+RKSWLKRHLLSHS+ RQ+ CPWCLS+HKRKDNLLQHMKLKH
Sbjct: 246 IYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKH 305

Query: 405 SNYLVIELKK-----------------------NNAVFSCVNGGNREKLNDTDDIRNLIS 441
              ++ E+ K                       N    S +N  +    ND   I  ++ 
Sbjct: 306 KQQVLQEMDKLSESSLELNDESSTGTDTASPIVNETALSMLNDDSGSSSNDNVSIIAMVD 365

Query: 442 LGVINKDDVKKVINKLI 458
            G + K++VKKV+N +I
Sbjct: 366 NGTLKKENVKKVLNSII 382

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score =  113 bits (282), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 75/116 (64%), Gaps = 3/116 (2%)

Query: 346 GGNLTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           G ++ +++ C +CEKSF+RKSW +RHLLSHS+ + + CPWC SRHKR+DNL QHMK KH 
Sbjct: 381 GSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHV 440

Query: 406 NYLVIELKKNNAVFSCVNGGNREKLNDT---DDIRNLISLGVINKDDVKKVINKLI 458
           + ++ EL +   +   +    R  ++D      IR L+  G + K+ VK V+N +I
Sbjct: 441 HQVLQELMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVLNAVI 496

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  114 bits (284), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 79/134 (58%), Gaps = 27/134 (20%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           +  C  C KSF+R SWLKRHLL+HS ER + CPWCLS+HKRKDNLLQH+KLKH+  ++ +
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQ 618

Query: 412 LKKNNAVFSCVNGGNREK-----------------LNDTDDIRN----------LISLGV 444
           L+  N   S +     ++                 +ND  DI+N          L+  G 
Sbjct: 619 LRLENIEISTIEETMEDRRVDVHERSKSVDTGTSGVNDDIDIKNVKQPGTNIKTLLYDGR 678

Query: 445 INKDDVKKVINKLI 458
           +NK+DVKKV+NKL+
Sbjct: 679 LNKEDVKKVLNKLL 692

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  110 bits (275), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 72/111 (64%), Gaps = 3/111 (2%)

Query: 351 LIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVI 410
           + + C +C+KSF+R+SW KRHLLSHS+ + + CPWC SRHKR+DNL QHMK KH  ++V 
Sbjct: 387 VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQ 446

Query: 411 ELKKNNAVFSCVNGGNREKLNDTD---DIRNLISLGVINKDDVKKVINKLI 458
           EL +   V   V  G +   +++     I+ LI  G + K+ VK V+N +I
Sbjct: 447 ELLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVI 497

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score =  107 bits (268), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 58/69 (84%)

Query: 351 LIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVI 410
           +I  CHLCEKSF+RKSWLKRHLLSHS +R F CP CLS+HKRKDNL+QH+KLKH +Y++ 
Sbjct: 338 IIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYILK 397

Query: 411 ELKKNNAVF 419
           +L K++ + 
Sbjct: 398 KLNKDDLII 406

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 93.2 bits (230), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 70/110 (63%), Gaps = 10/110 (9%)

Query: 349 LTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           +T ++ C++C K F+R++WL+RH LSH+ +R FLCPWC S+HKR+DNL +H+KLKH   L
Sbjct: 115 VTSVYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELL 174

Query: 409 VIELKKNNAVFSCVNGGNREKLNDTDDIRNLISLGVINKDDVKKVINKLI 458
           +  +++   +             +  D+  L+  G ++++D+K+V   LI
Sbjct: 175 MKAIREYYPLTDF----------EDKDLNELMRSGYLHREDIKRVFLHLI 214

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 89.7 bits (221), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 66/106 (62%), Gaps = 10/106 (9%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412
           + C  C KSF+R +WLKRH ++H+    F C WC S HKR+DN+ +HMKLKH N L++++
Sbjct: 250 YPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMN-LLMKV 308

Query: 413 KKNNAVFSCVNGGNREKLNDTDDIRNLISLGVINKDDVKKVINKLI 458
            +N    +   G          D++ L++ G ++K+DVK+V+  ++
Sbjct: 309 IRNYYPLAEFEG---------KDLKGLLADGRLHKEDVKRVLVDIV 345

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 38/53 (71%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKH 404
            + C +C K+F+R SWLKRH  SHS  + F C WC  ++KRKDNL+QH++ KH
Sbjct: 323 FYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKH 375

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  CEK+FRR   LKRH+ S HSTER F C +C  +  R DNL QH+K   KH ++
Sbjct: 575 CKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 630

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           C  C K+FRR   LKRH+ S HS+ER F CP C  +  R DNL QH+K
Sbjct: 767 CETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIK 814

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  CEK+FRR   LKRH+ S HSTER F C +C  +  R DNL QH+K   KH ++
Sbjct: 586 CKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 641

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  CEK+FRR   LKRH+ S HSTER F C +C  +  R DNL QH+K   KH ++
Sbjct: 573 CKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 628

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  CEK+FRR   LKRH  S HS ER F C +C  R  R DNL QH+K   KH ++
Sbjct: 917 CSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLKTHKKHGDF 972

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  CEK+FRR   LKRH+ S HS+ER F C +C  +  R DNL QH+K   KH ++
Sbjct: 592 CTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLKTHKKHGDF 647

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  CEK+FRR   LKRH+ S HS+ER F C +C  R  R DNL QH+K   KH ++
Sbjct: 468 CGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLKTHKKHGDF 523

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  C K+FRR   LKRH+ S HS+ER F C +C  +  R DNL QH+K   KH ++
Sbjct: 529 CKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 584

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  C K+FRR   LKRH+ S HSTER F C +C  +  R DNL QH+K   KH ++
Sbjct: 382 CKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 437

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  C+K+FRR   LKRH+ S HS ER F C +C  +  R DNL QH+K   KH ++
Sbjct: 584 CKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 639

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           CH+C KSF+R   LKRH+ S HS ER F C  C  +  R DNL QH+K
Sbjct: 654 CHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 701

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           CHLC K+F+R   LKRH+ S HST+R F C  C  +  R DNL QH+K
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 15/22 (68%)

Query: 354 SCHLCEKSFRRKSWLKRHLLSH 375
           SCHLCEK F R   L +H+ +H
Sbjct: 565 SCHLCEKKFSRSDNLSQHIKTH 586

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  C K+FRR   LKRH+ S HSTER F C +C  +  R DNL QH+K   KH ++
Sbjct: 622 CQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 677

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  C+K+FRR   LKRH+ S HSTER F C +C  +  R DNL QH+K   +H ++
Sbjct: 486 CADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLKTHKRHGDF 541

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           CH+C KSF+R   LKRH+ S HS ER F C  C  +  R DNL QH+K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  C K+FRR   LKRH+ S HS+ER F C +C  +  R DNL QH+K   KH ++
Sbjct: 444 CQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 499

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           CH+C KSF+R   LKRH+ S HS ER F C  C  +  R DNL QH+K
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           C  C K+FRR   LKRH+ S HS ER F C  CL +  R DNL QH+K
Sbjct: 691 CDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLK 738

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412
           C  C K+FRR   LKRH+ S HSTER F C +C  +  R DNL QH+K    +  + EL
Sbjct: 623 CDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLKTHKKHGDITEL 681

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           CH+C KSF+R   LKRH+ S HS ER F C  C  +  R DNL QH+K
Sbjct: 648 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIK 695

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C+ CEK+FRR   LKRH+ S HS+ER F C +C  +  R DNL QH+K   KH ++
Sbjct: 464 CNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLKTHKKHGDF 519

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           C  C K+FRR   LKRH+ S HSTER F C  C  +  R DNL QH+K
Sbjct: 388 CDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLK 435

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  C K+FRR   LKRH+ S HS+ER F C +C  +  R DNL QH+K   KH ++
Sbjct: 675 CSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 730

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           C  C K+FRR   LKRH+ S HST+R F C +C  +  R DNL QH+K
Sbjct: 700 CQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLK 747

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  C K+FRR   LKRH+ S HS+ER F C +C  +  R DNL QH+K   KH ++
Sbjct: 643 CQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF 698

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  C K FRR   LKRH+ S HS ER F C +C  +  R DNL QH+K   KH ++
Sbjct: 439 CGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLKTHKKHGDF 494

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           C  C KSFRR   LKRH+ S HS ER F C  C  +  R DNL QH+K
Sbjct: 714 CDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLK 761

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  CEK F+R   LKRH  S HS ER F C  C  +  R DNL QH+K   KH ++
Sbjct: 315 CSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLKTHKKHGDF 370

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           C  C K+FRR   LKRH+ S HS++R F C +C  +  R DNL QH+K
Sbjct: 506 CQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLK 553

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           C+ CEK F+R   LKRH+ S HSTER + C +C     R DNL QH+K
Sbjct: 310 CNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  C K+F+R   LKRH+ S HS +R F C  C  +  R DNL QH+K   KH ++
Sbjct: 565 CGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLKTHKKHGDF 620

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLKHSN 406
           C  C + F+R+  LKRH+LS H  E++F CP C     R DNL QH+K  HSN
Sbjct: 402 CKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIK-THSN 453

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKK 414
           C +C+K+F R+  L RHL SH+ E+ F C  C     R+D L++H    HS+  +++ K 
Sbjct: 51  CFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRHSNKLHSDTAIVQRKS 110

Query: 415 NNA 417
            NA
Sbjct: 111 CNA 113

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 45/84 (53%), Gaps = 5/84 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKK 414
           C +C + F R+  LKRH  SH+ E+ FLC  C     RKD +L+H++  H +Y   +L K
Sbjct: 29  CPICSRGFVRQEHLKRHQNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQLDK 88

Query: 415 NNAVFSCVNGGNREKLNDTDDIRN 438
                +   G   EK+ +T D+ N
Sbjct: 89  -----TIGRGKWDEKILNTPDVWN 107

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           CH+C + F R+  LKRH  +H+ E+ FLC +C     R+D +L+H    HS
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHS 113

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLKHSN 406
           I  C +CE+ F+R+  LKRH+ S H  ER + C  CL    R DNL QH K  H+N
Sbjct: 217 IFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH-KRTHNN 271

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           + CHLC+K F+R   LKRH  + H   R F C  C  R  R DNL QH+++     ++  
Sbjct: 223 YFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIHEQQPIMEP 282

Query: 412 LKKNNAV 418
           ++K ++V
Sbjct: 283 IRKRSSV 289

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNY 407
           C  C K+F+R   LKRH+ S HS ER + C  C  +  R DNL QH+K   +H ++
Sbjct: 605 CEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLKTHKRHGDF 660

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           CH+C + F R+  LKRH  +H+ E+ FLC +C     R+D +L+H    HS
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHS 113

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           CH+C + F R+  LKRH  +H+ E+ FLC +C     R+D +L+H    HS
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHS 113

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           + C  C + F R+  LKRH  SH+ E+ FLC +C     R+D +L+H +  HS+ +
Sbjct: 105 YICQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLHSSLM 160

>KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.256
           YPL230W
          Length = 311

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 354 SCHL---CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVI 410
           +CH    C  +F R   L RH+  H+ E+ F C  C     R DNL QH +  H+N  + 
Sbjct: 19  TCHGYGDCHMTFARAEHLARHVRRHTGEKPFECNVCFKHFSRVDNLKQHKETVHANVFID 78

Query: 411 ELKKNNAV 418
           E+  N  +
Sbjct: 79  EMSNNTPI 86

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           CH+C + F R+  LKRH  +H+ E+ FLC +C     R+D +L+H    HS
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHS 113

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQH 399
           C +C + F R+  LKRH +SH+ E+ FLC +C     RKD +L+H
Sbjct: 36  CSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 80

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 26/48 (54%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           C  SF R   L RH+  H+ E+ F CP CL    R DNL QH +  H+
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHA 96

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLV 409
           C +C + FRR+  +KRH+ + H  ER + C  C     R DNL QH++    NY V
Sbjct: 415 CTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLRTHTRNYEV 470

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMKLKH 404
           + C +C K FRR S LK H+  H+  + +LCP+  C      K N+L+H KL +
Sbjct: 415 YHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKLHY 468

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 26/48 (54%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           C  SF R   L RH+  H+ E+ F CP CL    R DNL QH +  H+
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHA 96

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 26/48 (54%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           C  SF R   L RH+  H+ E+ F CP CL    R DNL QH +  H+
Sbjct: 52  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHA 99

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNY 407
            C  C++ F+R+  LKRH+ S H  E+ + C  C  +  R DNL QH+K    +Y
Sbjct: 355 GCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIKTHGGDY 409

>NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]
           {ON} Anc_4.351
          Length = 1341

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKK 414
           C  C + F R+  LKRH  SH+ E+ FLC +C     R+D +L+H    H+  +  EL++
Sbjct: 74  CPTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALIGNELQQ 133

Query: 415 N 415
           N
Sbjct: 134 N 134

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMKL 402
           CH+C KS  R S L+ H+L H+ +R F C W  C  R   K N+ +H KL
Sbjct: 493 CHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKL 542

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKK 414
           C +C ++F R+  LKRH  SH+ E+ F+C +C     R+D +L+H    HS  +  EL  
Sbjct: 54  CSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRHQHKLHSALIGTELHH 113

Query: 415 NNA 417
            N 
Sbjct: 114 ENV 116

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           C +C + F R+  LKRH  SH+ E+ FLC +C     R+D +L+H +  H++ +
Sbjct: 75  CPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLM 128

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKL 402
           +H CH+C K+F R S L  H L H+  + F+C  P C  R   K NL++H K+
Sbjct: 110 LHECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKKI 162

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNY 407
           + +C  C++ F+R+  LKRH+ S H  E+ F C  C  +  R DNL QH+K  HSN+
Sbjct: 302 LFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK-THSNF 357

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           C +C + F R+  LKRH  +H++E+ FLC +C     R+D +L+H    HS+ +
Sbjct: 56  CSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLHSSLI 109

>Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {ON}
           YMR182C (REAL)
          Length = 216

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKKN-N 416
           C  SF R   L RH+  H+ E+ F C  CL    R DNL QH    HS+  ++ L++   
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRRQKQ 86

Query: 417 AVFSCVNGGN 426
           +  + VNG N
Sbjct: 87  SSGNTVNGPN 96

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQH 399
           C +C + F R   LKRH +SH+ E+ FLC +C     RKD +L+H
Sbjct: 38  CSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 82

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMK 401
           + C LC K F R S L+ HLL+H+  R F CP+  C      K N+++H+K
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSN 406
           C  SF R   L RH+  H+ E+ F CP CL    R DNL QH +  H++
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAH 97

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSN 406
           C +C + F R+  LKRH  +H+ E+ FLC +C     R+D +L+H +  HS+
Sbjct: 34  CSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHSS 85

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSN 406
           C +C + F R+  LKRH  +H+ E+ FLC +C     R+D +L+H +  HS 
Sbjct: 80  CSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHST 131

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           +C  C++ F+R+  LKRH+ S H  E+ F C  C  +  R DNL QH+K
Sbjct: 341 ACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVK 389

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           C +C + F R+  L+RH  +H+ E+ FLC +C     R+D +L+H    H   + +E
Sbjct: 89  CQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHPTLISME 145

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNYLV 409
           I++C LC+K F R   LK HL +H+ ER F+C  C     R+ +  +H  L      Y+ 
Sbjct: 650 IYACELCDKKFTRPYNLKSHLRTHTNERPFICSICNKAFARQHDRKRHEDLHTGKKRYIC 709

Query: 410 IELKKNNAVFSC 421
               KN   + C
Sbjct: 710 GGKLKNGTSWGC 721

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 346 GGNLTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLK 403
           G +    H C +C+++FRR     RHL +H+ E+   C  P C  R  R D L +H ++ 
Sbjct: 22  GKDAPRPHVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRI- 80

Query: 404 HSN 406
           H+N
Sbjct: 81  HTN 83

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 346 GGNLTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
            G L L   C  C+++F R+  L RH  SH+ E+ FLC  C     R+D L++H +  H 
Sbjct: 146 SGKLRLF-LCDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIHG 204

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLK 403
           ++ C +C++ F     L RH  S HS E+ F CP C  R KR+D++LQH+  K
Sbjct: 780 VYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQHLNKK 832

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 346 GGNLTLI-HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQ---- 398
           GGN+  I + C +C K F+R S L  H+  H+  + F CP+  C      K N+L+    
Sbjct: 297 GGNIEKIKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKL 356

Query: 399 HMKLKHSNYLV 409
           H KL   NY++
Sbjct: 357 HFKLSSGNYIL 367

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           C +C + F R+  LKRH  SH+ E+ FLC +C     R+D +L+H +  H++ +
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLM 135

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           +C  CE+ F+R+  LKRH+ S H  E+ + C  C     R DNL QH+K
Sbjct: 496 ACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

>Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {ON}
           YMR182C (REAL)
          Length = 211

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKK 414
           C  SF R   L RH+  H+ E+ F C  CL    R DNL QH    HS+  ++ L++
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDIDLVSLRR 83

>Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {ON}
           YMR182C (REAL)
          Length = 212

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKK 414
           C  SF R   L RH+  H+ E+ F C  CL    R DNL QH    HS+  ++ L++
Sbjct: 27  CNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRR 83

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           C +C + F R+  L+RH  SH+ E+ FLC +C     R+D +L+H +  H++ +
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLM 138

>YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}
           RGM1Putative zinc finger DNA binding transcription
           factor; contains two N-terminal C2H2 zinc fingers and
           C-terminal proline rich domain; overproduction impairs
           cell growth and induces expression of genes involved in
           monosaccharide catabolism and aldehyde metabolism;
           deletion decreases expression of Y-prime telomeric
           elements; regulates expression of subtelomeric COS genes
           in conjunction with RNA binding protein Pub1p; localized
           to X elements within subtelomeric regions by ChIP
          Length = 211

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKK 414
           C  SF R   L RH+  H+ E+ F C  CL    R DNL QH    HS+  ++ L++
Sbjct: 27  CNMSFNRTEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHSDVDLMSLRR 83

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLKHSN 406
            C  CE+ F+R+  LKRH+ S H  E+ + C  C  +  R DNL QH+K  HSN
Sbjct: 461 GCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIK-THSN 513

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSN---YL 408
           I+SC+LC+K F R   LK HL +H+ ER F C  C     R+ +  +H  L HS    Y+
Sbjct: 425 IYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSVCGKAFARQHDRKRHEDL-HSGKKRYV 483

Query: 409 VIELKKNNAVFSC 421
                K  A + C
Sbjct: 484 CGGKLKGGATWGC 496

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 349 LTLIHS-CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMK 401
           +TL+   CH+C+K   R + LK HLL H+ +  F CPW  C      K N+L+H+K
Sbjct: 144 MTLLRKQCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLK 199

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLKHSN 406
           SC  C++ F+R+  LKRH+ S H  E+ F C  C     R DNL QH+K  HSN
Sbjct: 399 SCEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIK-THSN 451

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 43/99 (43%), Gaps = 14/99 (14%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKKNNA 417
           C  +F R   L RH+  H+ E+ F C  CL R  R DNL QH +  H+   V+     N 
Sbjct: 27  CHMAFTRAEHLARHIRKHTGEKPFQCDVCLKRFSRVDNLKQHRESVHAT--VVNAASKNV 84

Query: 418 VFSCVNGGNREKLNDTDDIRNLISLGVINKDDVKKVINK 456
               V  G  EK              ++N ++ KKVI +
Sbjct: 85  PL--VAKGRVEKPKKI----------ILNNENFKKVIEQ 111

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKHSNYLVI 410
           + C LC K F R    +RH+ +H+ E+   C  P C+ R  R D L +H+++ H+N    
Sbjct: 25  YKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLRI-HTNTSKR 83

Query: 411 ELKKNNAVFS 420
           + +K  A  S
Sbjct: 84  KTRKRRADIS 93

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHM-KLKHSNYLVI 410
           +  C +C ++F R+  L RH  SH+ E+ + C  C  +  R+D LL+H  K+   NY   
Sbjct: 85  LFVCQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIHGGNYGDT 144

Query: 411 ELKKNNA 417
            +K+NN 
Sbjct: 145 IIKQNNV 151

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
            C  C++ F+R+  LKRH+ S H  E+ F C  C  +  R DNL QH+K
Sbjct: 504 GCEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           +SC  CE+ F+R+  LKRH+ S H   + + C  C  +  R DNL QH K
Sbjct: 349 YSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSN 406
           +  CH C ++F R+  L RH  SH+ E+ ++C  C  R  R+D LL+H    H  
Sbjct: 48  LFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRHAHKLHGG 102

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           +C  C++ F+R+  LKRH+ S H  E+ F C  C  +  R DNL QH+K
Sbjct: 347 ACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIK 395

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
            C  C++ F+R+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 419 GCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLK 467

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTE 378
           + CHLC K F R   L +HL +H+ E
Sbjct: 447 YGCHLCGKKFSRSDNLSQHLKTHTHE 472

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLKHSN 406
            C  CE+ F+R+  LKRH+ S H  E+ + C  C  +  R DNL QH+K  H+N
Sbjct: 515 GCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK-THTN 567

>KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1255

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           C  C + F R+  LKRH  SH+ ER FLC  C     RKD +L+H +  H+
Sbjct: 51  CPTCTRGFVRQEHLKRHQRSHTRERPFLCVLCGRCFARKDLVLRHQQKLHA 101

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
            C  C++ F+R+  LKRH+ S H  E+ F C  C     R DNL QH+K
Sbjct: 389 GCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           C  C++ F+R+  LKRH+ S H  E+ F C  C     R DNL QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQH 399
           H C +C + F R   LKRH  +H+ E+ FLC +C     R+D +L+H
Sbjct: 33  HLCPICTRGFVRLEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRH 79

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLK 403
           C+ C +SF     L RH  + H  E+ F CP C  R KR+D++LQH+  K
Sbjct: 392 CYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKK 441

>NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80
          Length = 493

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKHSN 406
           H C +C+++F R     RHL +H+ E+  +C  P C+ R  R D L +H ++ H+N
Sbjct: 43  HVCPVCQRAFHRLEHQTRHLRTHTGEKPNVCDFPGCIKRFSRSDELTRHKRI-HTN 97

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
            C  C++ F+R+  LKRH+ S H  E+ F C  C     R DNL QH+K
Sbjct: 396 GCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMKL 402
           C  C K F R S L+ H+L HS ++ F C W  C  +   K NL++H+KL
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 58/108 (53%), Gaps = 5/108 (4%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHM-KLKHSNYLVI 410
           +  C +C ++F R+  L RH  SH+ E+ + C  C  +  R+D LL+H  K+ + +Y   
Sbjct: 43  LFVCSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRHAQKIHNGDYGDT 102

Query: 411 ELKKNNAVFSCVNGGNREKLNDTDDIRNL-ISLGVINKDDVKKVINKL 457
            +  +N   +  N  N  K++D+  + NL I L +++K++   +I  L
Sbjct: 103 VIITSNGTITLNN--NERKIDDS-LVDNLSIDLNLVSKNNKDTIIENL 147

>NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {ON}
           Anc_6.256
          Length = 409

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKKNNA 417
           C   F R+  L RH+  H+ E+ F C  CL    R DNL QH +  H       L  N A
Sbjct: 23  CSMVFTREEHLARHIRKHTGEKPFQCDICLRFFSRVDNLKQHRETVHLEG-ATPLNINKA 81

Query: 418 VFS----CVNGGNREKLND 432
           + +    C+NG   +K ND
Sbjct: 82  LTTTPTLCLNGSINQKNND 100

>CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {ON}
           some similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230w USV1 or uniprot|Q00453 Saccharomyces
           cerevisiae YMR182c RGM1
          Length = 613

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 25/48 (52%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           CE SF R   L RH+  H+ E+ F C  CL    R DNL QH    H+
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKCDICLKYFSRIDNLKQHKDTVHA 80

>NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {ON}
           Anc_4.351
          Length = 1362

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           C  C + F R+  LKRH  SH+ E+ FLC +C     R+D +L+H    H+
Sbjct: 73  CSTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHA 123

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKK 414
           C +C + F R+  LKRH  SH+ E+ FLC +C     R+D +L+H    H+  +   L++
Sbjct: 77  CSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALVSKTLEE 136

Query: 415 N 415
           +
Sbjct: 137 D 137

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           C +C ++F R+  L RH  SH+ E+ ++C  C  R  R+D L++H +  H 
Sbjct: 127 CKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQKLHG 177

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
            C  C++ F+R+  LKRH+ S H  E+ F C  C     R DNL QH+K
Sbjct: 390 GCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 10/87 (11%)

Query: 344 VIGGNLT------LIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLL 397
           V GG+++       I++C +C+K F R   LK HL +H+ ER F+C  C     R+ +  
Sbjct: 484 VSGGSVSNVRKNPAIYACDMCDKKFTRPYNLKSHLRTHTNERPFVCSICGKAFARQHDRK 543

Query: 398 QHMKLKHSN---YLVIELKKNNAVFSC 421
           +H  L HS    Y+     K+   + C
Sbjct: 544 RHEDL-HSGKKRYICGGTLKDGTKWGC 569

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 9/58 (15%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCP--------W-CLSRHKRKDNLLQHMKLK 403
           C +C K+F R+   KRH   HS +++++C         W C  +  R D L +H K +
Sbjct: 529 CSICGKAFARQHDRKRHEDLHSGKKRYICGGTLKDGTKWGCGKKFARSDALGRHFKTE 586

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSN 406
           +  C +C ++F R+  L RH  SH+ E+ + C  C  R  R+D LL+H    H  
Sbjct: 58  LFVCKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRHAHKLHGG 112

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 348 NLTLIHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           +L+    C  C++ F+R+  LKRH+ S H  E+ + C  C  +  R DNL QH+K
Sbjct: 259 DLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

>TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON}
           Anc_5.586 YHR006W
          Length = 312

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC-------LSRH-----KRKDNLLQHMKL 402
           CH C+ SFR  S+L RH+  H+ E+ F CP+        L  H      RKD    H+K 
Sbjct: 15  CHYCDASFRLMSYLTRHIKKHAIEKAFKCPFYNEKLPADLRCHVSGGFSRKDTFKMHLKC 74

Query: 403 KHSNY 407
           +H  Y
Sbjct: 75  RHFIY 79

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
            C  C++ F+R+  LKRH+ S H  E+ F C  C  +  R DNL QH+K
Sbjct: 259 GCEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIK 307

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 344 VIGGNLTLIHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           VI      ++ C  C++ F     L RH  S HS E+ + CP C  R KR+D++LQH+  
Sbjct: 751 VIMNEYGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNK 810

Query: 403 K 403
           K
Sbjct: 811 K 811

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHM-KLKHSNY 407
           +  C +C ++F R+  L RH  SH+ E+ + C  C  +  R+D LL+H  K+   NY
Sbjct: 117 LFVCSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRHAHKIHGGNY 173

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           C +C + F R+  LKRH  SH+ E+ FLC +C     R+D +L+H    H + +
Sbjct: 59  CPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHGSLV 112

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC-------LSRH-----KRKDNLLQHMKL 402
           CH C+  FR + +L RH+  H+ E+ F CP+        L  H      R+D    H+K+
Sbjct: 63  CHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRDLQCHPSGGFSRRDTYKTHLKV 122

Query: 403 KHSNY 407
           KH  Y
Sbjct: 123 KHVLY 127

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 2/60 (3%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMKLKHSNYLVIEL 412
           C  C K F     L RH   H+ E+  LCP+  C  R  R+DN LQH +    N+    L
Sbjct: 187 CTTCTKGFTTSGHLARHKRIHTGEKNHLCPFEGCKQRFSRQDNCLQHYRTHFKNFTFTNL 246

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 57/122 (46%), Gaps = 22/122 (18%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL------ 408
           C +C ++F R+  LKRH  SH+ E+ + C  C     R+D L++H +  HS  L      
Sbjct: 106 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLGETISQ 165

Query: 409 -------VIELKKNNAV---FSCVNGG---NREKLNDTDDIRNLISLGVINKDDVKKVIN 455
                  +I+ +KN+A    F   N G   N   LN   + R  ++ G I K   +K + 
Sbjct: 166 NKKSSRTIIKARKNSASSVKFQTPNYGTPDNGNTLNCAVNTRRRVNPGAIAK---RKYLK 222

Query: 456 KL 457
           KL
Sbjct: 223 KL 224

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           +++C LC+K F R   LK HL +H+ ER F C  C     R+ +  +H  L
Sbjct: 407 VYACELCDKKFTRPYNLKSHLRTHTDERPFACAICGKAFARQHDRKRHEDL 457

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLK 403
           I+ C  C++ F     L RH  S HS E+   CP C  R KR+D++LQH+  K
Sbjct: 858 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa]
           {ON} Anc_4.351
          Length = 1537

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           C  C + F R   LKRH  SH+ E+ +LC +C     R+D +L+H    HS+ L
Sbjct: 47  CPTCTRGFVRLEHLKRHERSHTQEKPYLCIFCGRCFARRDLVLRHQTKLHSSIL 100

>NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303
          Length = 571

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNYLVI 410
           ++C LC+K+F R   LK HL +H+ E+ F+C  C     R+ +  +H  L      Y+  
Sbjct: 452 YACELCDKTFTRPYNLKSHLRTHTNEKPFVCNICGKAFARQHDRKRHEDLHTGKKRYVCG 511

Query: 411 ELKKNNAVFSC 421
            + KN   + C
Sbjct: 512 GVLKNGTPWGC 522

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLK 403
           C  C +SF     L RH  + H  E+ F CP C  R KR+D++LQH+  K
Sbjct: 449 CFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQHLNKK 498

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 350 TLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC-------LSRH-----KRKDNLL 397
           TL + CH C+  FR + +L RH+  H+  + + CP+        L  H      R+D   
Sbjct: 202 TLPYVCHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDDSISQELRCHTSGGFSRRDTYK 261

Query: 398 QHMKLKHSNY--LVIELKKNNAVFSCVNGG 425
            H+K +H NY   V    +N +  +C   G
Sbjct: 262 THLKSRHFNYPEGVKPQDRNKSSGACAQCG 291

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           I++C LC+K F R   LK HL +H+ ER F C  C     R+ +  +H  L
Sbjct: 423 IYACELCDKKFTRPYNLKSHLRTHTDERPFACNVCGKAFARQHDRKRHEDL 473

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 9/73 (12%)

Query: 354 SCHLCEKSFRRKSWLKRHLLSHSTERQFLC--------PW-CLSRHKRKDNLLQHMKLKH 404
           +C++C K+F R+   KRH   H+ +++++C         W C  +  R D L +H K   
Sbjct: 453 ACNVCGKAFARQHDRKRHEDLHTGKKRYICGGNLKDGTSWGCGKKFARSDALGRHFKTDS 512

Query: 405 SNYLVIELKKNNA 417
               +  L +  A
Sbjct: 513 GRRCIAPLYEEAA 525

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKH 404
           +  C +C ++F R+  L RH  SH+ E+ + C  C  +  R+D LL+H +  H
Sbjct: 77  LFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVH 129

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           C  C ++F R+  L RH  SH+ E+ + C  C  R  R+D LL+H    H 
Sbjct: 32  CQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRHAHKVHG 82

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKHSNYL 408
           H C +C ++F R     RH+ +H+ E+   C  P C+ R  R D L +H ++ H+N L
Sbjct: 43  HVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTNPL 99

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           C  CE+ F+R+  LKRH+ S H   + + C  C  +  R DNL QH+K
Sbjct: 388 CDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIK 435

>TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543
           YPR186C
          Length = 472

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 24/34 (70%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC 386
           HSC +C   F RKS L+RHL+SHS E+ F C +C
Sbjct: 108 HSCDVCGSKFSRKSHLERHLISHSAEKPFHCSFC 141

>Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar to
           Ashbya gossypii ADL198W
          Length = 560

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           I+SC LC K F R   LK HL +H+ ER F C  C     R+ +  +H  L
Sbjct: 437 IYSCDLCNKKFTRPYNLKSHLRTHTDERPFACNMCGKAFARQHDRKRHEDL 487

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 9/68 (13%)

Query: 354 SCHLCEKSFRRKSWLKRHLLSHSTERQFLC--------PW-CLSRHKRKDNLLQHMKLKH 404
           +C++C K+F R+   KRH   HS +++++C         W C  +  R D L +H K   
Sbjct: 467 ACNMCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKDGTSWGCGKKFARSDALGRHFKTDS 526

Query: 405 SNYLVIEL 412
               +  L
Sbjct: 527 GRRCIAPL 534

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNY 407
           CHLC+KSF   + LK H+ +H+ E+   C  C  R     NL +HMK    N+
Sbjct: 670 CHLCDKSFSVSTSLKIHIRTHTGEKPLECKVCGRRFNESSNLSKHMKTHEHNF 722

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC 386
           + C +C K F     LK+H   HS E+ F C  C
Sbjct: 640 YKCEVCSKCFSSDETLKQHSRVHSGEKPFKCHLC 673

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           C +C + F   S L +H+ +H  E  F CP C      +  +  HM+  + N L
Sbjct: 698 CKVCGRRFNESSNLSKHMKTH--EHNFKCPICSKGFNTQKRMETHMRFCNVNNL 749

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           I  C  C + F+R+  LKRH  S H  E+ F C  C  +  R DNL QH+K
Sbjct: 633 IFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIK 683

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 354 SCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELK 413
           SC  C K F +   L+ H+  H+ E+ + C  C  +  RK NL  H KL H N    E K
Sbjct: 552 SCEFCGKRFTQGGNLRTHIRLHTGEKPYECERCGRKFSRKGNLAAH-KLTHDNLKPFECK 610

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKK 414
           C  C K F + + L+ H+ SH   + F C +C  R  +  NL  H++L H+     E ++
Sbjct: 525 CPYCHKYFTQSTHLEVHVRSHIGYKPFSCEFCGKRFTQGGNLRTHIRL-HTGEKPYECER 583

Query: 415 NNAVFS 420
               FS
Sbjct: 584 CGRKFS 589

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLK 403
           ++ C  C++ F     L RH  S HS E+   CP C  R KR+D++LQH+  K
Sbjct: 776 VYICQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 828

>Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 bp,
           515 aa] {ON} YGL035C (REAL)
          Length = 515

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKHSN 406
           H+C +C+++F R     RH+  H+ E+   C  P C+ R  R D L +H ++ H+N
Sbjct: 38  HACPICQRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 92

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412
           C +C +  RR S LK H+L+H+ +R F C  P C      + N+L+H +L      +++ 
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHSRGSELVDT 265

Query: 413 KKNNA 417
              N+
Sbjct: 266 HSQNS 270

>KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5.586
           YHR006W
          Length = 235

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 16/89 (17%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHK-------------RKDNLLQ 398
           ++ CH C+ SFR + +L RH+  HS E+ + CP+  + H+             R+D    
Sbjct: 34  MYVCHYCDASFRIRGYLTRHIKKHSIEKAYHCPF-YNEHQPSELKCHNSGGFSRRDTYKT 92

Query: 399 HMKLKHSNY--LVIELKKNNAVFSCVNGG 425
           H+K +H  Y   V + ++N +   C   G
Sbjct: 93  HLKSRHILYPKGVKQNERNKSTGHCAQCG 121

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           C +C ++F R+  LKRH  SH+ E+ + C  C     R+D L++H +  HS  L
Sbjct: 106 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 159

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           +++C LC+K F R   LK HL +H+ ER F C  C     R+ +  +H  L
Sbjct: 412 VYACELCDKKFTRPYNLKSHLRTHTDERPFSCAICGKAFARQHDRKRHEDL 462

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 11/87 (12%)

Query: 354 SCHLCEKSFRRKSWLKRHLLSHSTERQFLC--------PW-CLSRHKRKDNLLQHMKLKH 404
           SC +C K+F R+   KRH   H+ ++++ C         W C  +  R D L +H K + 
Sbjct: 442 SCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFKTEG 501

Query: 405 SNYLVIELKKNNAVFSCVNGGNREKLN 431
               +  L +   V S    G R +++
Sbjct: 502 GKRCIAPLYEE--VTSEREAGRRPEID 526

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           C +C ++F R+  LKRH  SH+ E+ + C  C     R+D L++H +  HS  L
Sbjct: 112 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 165

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 344 VIGGNLTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMK 401
           + G N    H C +C ++F R     RH+ +H+ E+   C  P C  R  R D L +H +
Sbjct: 34  IPGENAPRPHVCPVCGRAFHRLEHQTRHMRTHTGEKPHACDFPGCTKRFSRSDELTRHKR 93

Query: 402 LKHSN 406
           + H+N
Sbjct: 94  I-HTN 97

>CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006w SPT2 or uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 688

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRH------------KRKDNLLQHMKL 402
           CH C+  FR + +L RH+  H+ E+ + CP+   +              R+D    HMK 
Sbjct: 200 CHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYNGQEVPSKRCHNSGGFSRRDTYKTHMKA 259

Query: 403 KHSNY 407
           +H  Y
Sbjct: 260 RHLIY 264

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 354 SCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           +C  C + FRR+  +KRH+ S H  E+ + C  C     R DNL QH K
Sbjct: 172 ACQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQHRK 220

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           I+ C +CEK F R   L+ HL +H+ ER F+C  C     R+ +  +H  L
Sbjct: 419 IYDCVICEKKFTRPYNLRSHLRTHTNERPFVCTVCGKAFAREHDRKRHEDL 469

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 9/72 (12%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLC--------PW-CLSRHKRKDNLLQHMKLKHS 405
           C +C K+F R+   KRH   H+ +++++C         W C  +  R D L +H K +  
Sbjct: 450 CTVCGKAFAREHDRKRHEDLHTGKKRYICGGKLKSGEAWGCGKKFARSDALGRHFKTESG 509

Query: 406 NYLVIELKKNNA 417
              +  L +  A
Sbjct: 510 KKCITPLYEEAA 521

>KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.80
           YGL035C
          Length = 335

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKHSN 406
           H C +C+++F R     RH+ +H+ E+   C  P C+ R  R D L +H ++ H+N
Sbjct: 21  HVCPICQRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 75

>YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}
           STP1Transcription factor, undergoes proteolytic
           processing by SPS (Ssy1p-Ptr3p-Ssy5p)-sensor component
           Ssy5p in response to extracellular amino acids;
           activates transcription of amino acid permease genes and
           may have a role in tRNA processing
          Length = 519

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 12/65 (18%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSR------------HKRKDNLLQHMKL 402
           CH C+ +FR + +L RH+  H+ E+ + CP+  S               R+D    H+K 
Sbjct: 162 CHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRDTYKTHLKA 221

Query: 403 KHSNY 407
           +H  Y
Sbjct: 222 RHVLY 226

>KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1053

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           C +C + F R   LKRH  SH+ E+ +LC +C     RKD +L+H    H   L
Sbjct: 24  CPVCSRGFVRLEHLKRHQRSHTREKPYLCVFCGRCFARKDLVLRHQGKLHPEVL 77

>Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W
           (REAL)
          Length = 545

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 12/70 (17%)

Query: 350 TLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC-------LSRH-----KRKDNLL 397
           TL + CH C+  FR + +L RH+  H+  + + CP+        L  H      R+D   
Sbjct: 201 TLPYICHYCDSRFRIRGYLTRHIKKHAKRKAYHCPFFDGSISQELRCHNSGGFSRRDTYK 260

Query: 398 QHMKLKHSNY 407
            H+K +H NY
Sbjct: 261 THLKSRHFNY 270

>Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa]
           {ON} complement(144388..146058) [1671 nt, 557 aa]
          Length = 556

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 12/65 (18%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW----------CLSR--HKRKDNLLQHMKL 402
           CH C+ SFR + +L RH+  H+ ++ + CP+          C +     R+D    H+K+
Sbjct: 182 CHYCDASFRIRGYLTRHIKKHAIQKAYCCPFYNKSSPPDIRCHTSGGFSRRDTYKTHLKV 241

Query: 403 KHSNY 407
           +H  Y
Sbjct: 242 RHFMY 246

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKL 402
           C +C +  RR S LK H+L+H+ +R F C  P C      + N+L+H +L
Sbjct: 215 CKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERL 264

>Skud_10.351 Chr10
           complement(617553..621332,621389..621469,621466..621510,
           621543..621620) [3984 bp, 1327 aa] {ON} YJR127C (REAL)
          Length = 1327

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           C  C + F R+  LKRH  SH+ E+ +LC +C     R+D +L+H +  H+
Sbjct: 106 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHA 156

>NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {ON}
           Anc_5.586
          Length = 532

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW----CLSRHK--------RKDNLLQHMKL 402
           CH C+  FR + +L RH+  H+ E+ + CP+     LS  +        R+D    H+K 
Sbjct: 185 CHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTHLKA 244

Query: 403 KHSNY 407
           +H  Y
Sbjct: 245 RHFVY 249

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 344 VIGGNLTLIHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           VI  +   I+ C  C++ F     L RH  S HS E+   CP C  R KR+D++LQH+  
Sbjct: 893 VILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNK 952

Query: 403 K 403
           K
Sbjct: 953 K 953

>Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463W
           (REAL)
          Length = 514

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC-------LSRH-----KRKDNLLQHMKL 402
           CH C+ +FR + +L RH+  H+ E+ + CP+        L  H      R+D    H+K 
Sbjct: 162 CHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNGATPPDLRCHNSGGFSRRDTYKTHLKA 221

Query: 403 KHSNY 407
           +H  Y
Sbjct: 222 RHVLY 226

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLK 403
           ++ C  C++ F     L RH  S HS E+ + CP C  + KR+D++LQH+  K
Sbjct: 787 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 839

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMK 401
           C  CE+ F+R+  LKRH+ S H   + + C  C     R DNL QH+K
Sbjct: 386 CEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIK 433

>Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463W
           (REAL)
          Length = 528

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 12/65 (18%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC-------LSRH-----KRKDNLLQHMKL 402
           CH C+ +FR + +L RH+  H+ E+ + CP+        L  H      R+D    H+K 
Sbjct: 162 CHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNNATPPDLRCHNSGGFSRRDTYKTHLKA 221

Query: 403 KHSNY 407
           +H  Y
Sbjct: 222 RHVLY 226

>KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some
           similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230W USV1 Up in StarVation
          Length = 331

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKKNN 416
           C   F R+  L RH+  H+ E+ F C  CL    R DNL QH++  HS  +     KN+
Sbjct: 28  CRMEFTRQEHLARHIRKHTGEQPFQCHLCLRFFSRLDNLKQHVESVHSVSMATSQLKNS 86

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLK 403
           ++ C  C++ F     L RH  S HS E+   CP C  R KR+D++LQH+  K
Sbjct: 686 VYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 738

>NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586
          Length = 454

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 14/86 (16%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC-------LSRH-----KRKDNLLQHMKL 402
           CH C   FR K +L RHL  H+TE+ + CP+        L  H      R+D    H+K 
Sbjct: 102 CHHCNAQFRIKGYLTRHLKKHATEKAYTCPFFNTDSPPELRCHNSGGFSRRDTYKTHLKS 161

Query: 403 KHSNY--LVIELKKNNAVFSCVNGGN 426
           +H  +   V    +N +V  C   G+
Sbjct: 162 RHILFPKGVRPQDRNKSVGHCAQCGD 187

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNYLV 409
           +++C +C+K F R   LK HL SH+ ER ++C  C     R  +  +H  L      Y+ 
Sbjct: 468 VYACDICDKKFTRPYNLKSHLRSHTDERPYVCSVCGKAFARMHDKNRHEDLHTGKRRYVC 527

Query: 410 IELKKNNAVFSC 421
             + KN   + C
Sbjct: 528 GGILKNGNSWGC 539

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMK 401
           +H C +C KS  R + L+ H+L H+  R F C W  C +    K N+ +H K
Sbjct: 284 LHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFK 335

>Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON}
           YGL035C (REAL)
          Length = 505

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKHSN 406
           H+C +C ++F R     RH+  H+ E+   C  P C+ R  R D L +H ++ H+N
Sbjct: 38  HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 92

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKHSNYL 408
           C LC++ F R    KRH+ +H+ E+ + C  P C     R D L +H K+ H N+L
Sbjct: 19  CPLCQRGFHRLEHKKRHVRTHTGEKPYKCSFPDCPKSFSRTDELKRHSKI-HGNFL 73

>Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa]
           {ON} YJR127C (REAL)
          Length = 1270

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           C  C + F R+  LKRH  SH+ E+ +LC +C     R+D +L+H +  H+
Sbjct: 38  CPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHA 88

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMK 401
           C +C K   R S LK H L H+ +  F CPW  C      K N+L+H+K
Sbjct: 287 CPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLK 335

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%)

Query: 345 IGGNLTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           IG N    H C++C K F + + L+ HL SH  ++ + C WC     +  NL  H++L
Sbjct: 380 IGANGIKQHECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVRL 437

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHM 400
           + C  C K F +   LK H+  H+ E+ F C +C  R  RK NL  H+
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHL 463

>Smik_10.420 Chr10
           complement(647997..651776,651798..651836,651840..652019,
           652023..652070) [4047 bp, 1348 aa] {ON} YJR127C (REAL)
          Length = 1348

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           C  C + F R+  LKRH  SH+ E+ +LC +C     R+D +L+H +  H+
Sbjct: 127 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHA 177

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMK 401
           IH C +C+K   R + L+ HLL H+ E+ + C W  C +    K N+ +H K
Sbjct: 295 IHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           C +C ++F R+  LKRH  SH+ E+ + C  C     R+D L++H +  HS  L
Sbjct: 106 CEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNL 159

>YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}
           RSF2Zinc-finger protein involved in transcriptional
           control of both nuclear and mitochondrial genes, many of
           which specify products required for glycerol-based
           growth, respiration, and other functions
          Length = 1380

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           C  C + F R+  LKRH  SH+ E+ +LC +C     R+D +L+H +  H+
Sbjct: 153 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIFCGRCFARRDLVLRHQQKLHA 203

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKK 414
           CH C K F   S L+ H+ +H+ E+   C  C  R     NL +HMK+    Y+    K+
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSCTVCGKRFNESSNLSKHMKIHERKYMCKLCKR 633

Query: 415 N 415
           +
Sbjct: 634 S 634

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 354 SCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMK 401
           SC  C K+F     L +H+ +HS ER F C +C  +     +L  H++
Sbjct: 545 SCPHCPKTFSTDDILAQHIRTHSGERPFHCHYCRKQFSTSSSLRVHIR 592

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCP--WCLSRHKRKDNLLQHMKL 402
           C +C + F R    KRH+ +H+ E+  LCP   C     R D L +HMK+
Sbjct: 18  CPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMKV 67

>YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}
           MIG1Transcription factor involved in glucose repression;
           sequence specific DNA binding protein containing two
           Cys2His2 zinc finger motifs; regulated by the SNF1
           kinase and the GLC7 phosphatase
          Length = 504

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKHSN 406
           H+C +C ++F R     RH+  H+ E+   C  P C+ R  R D L +H ++ H+N
Sbjct: 38  HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 92

>TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON}
           Anc_5.586 YHR006W
          Length = 481

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 12/65 (18%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW------------CLSRHKRKDNLLQHMKL 402
           CH C+  FR + +L RH+  H+ ++ F CP+                  R+D    H+K+
Sbjct: 101 CHYCDAVFRIRGYLTRHIKKHAIQKAFHCPFYNDSASSKLKCHTTGGFSRRDTYKAHLKI 160

Query: 403 KHSNY 407
           +H  Y
Sbjct: 161 RHFMY 165

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMKL 402
           C +C K FRR    KRH+ +H+ E+   C +  C+ +  R D L +H+K+
Sbjct: 15  CDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKI 64

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMKL 402
           IH C +C +   R   L  H+L H+ ++ F C W  C      K NL +HMK+
Sbjct: 425 IHQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKI 477

>KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {ON}
           Anc_6.256 YPL230W
          Length = 315

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 39/84 (46%), Gaps = 2/84 (2%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIELKKNNA 417
           C  +F R   L RH+  H+ E+ F C  CL    R DNL QH    HS          NA
Sbjct: 34  CNMAFTRAEHLVRHIRKHTGEKPFQCYICLKFFSRVDNLKQHRDTVHSRINYPPSYFTNA 93

Query: 418 VFSCVNGGNREKLNDTDDIRNLIS 441
                NG N+  + D +++R++ S
Sbjct: 94  HLQ--NGHNQLIMEDQNNLRHVHS 115

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 344 VIGGNLTLIHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           VI  +   I+ C  C + F     L RH  S HS E+   CP C  R KR+D++LQH+  
Sbjct: 819 VIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNK 878

Query: 403 K 403
           K
Sbjct: 879 K 879

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLV 409
           +  C +C ++F R+  L RH  SH+ E+ + C  C  +  R+D L++H +  H+  +V
Sbjct: 115 LFVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVHNGNVV 172

>Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON}
           (235260..238010) [2751 nt, 917 aa]
          Length = 916

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYL 408
           C  C + F R+  LKRH  +H+ E+ F+C +C     R+D +++H    H + L
Sbjct: 43  CPTCSRGFVRREHLKRHQRAHTKEKPFVCVFCGRCFARRDLIIRHQNKLHFDIL 96

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLK 403
           ++ C  C++ F     L RH  S HS E+ + CP C  + KR+D++LQH+  K
Sbjct: 755 VYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 807

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 344 VIGGNLTLIHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           VI  +   I+ C  C + F     L RH  S HS E+   CP C  R KR+D++LQH+  
Sbjct: 819 VIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNK 878

Query: 403 K 403
           K
Sbjct: 879 K 879

>KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.256
           YPL230W
          Length = 413

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHS 405
           C  +F R   L RH+  H+ E+ F C  CL    R DNL QH +  HS
Sbjct: 51  CHMAFTRAEHLARHIRKHTGEKPFQCYICLKHFSRVDNLKQHRESVHS 98

>KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON}
           Anc_3.281 YBR066C
          Length = 224

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMK 401
           H C +C  +F     L RH   H+ E++++CP+  C  R  R DN +QH K
Sbjct: 158 HVCKVCTMAFTTSGHLSRHNKIHTGEKKYVCPFEGCGQRFSRHDNCVQHHK 208

>Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON}
           YGL035C (REAL)
          Length = 502

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKHSN 406
           H+C +C ++F R     RH+  H+ E+   C  P C+ R  R D L +H ++ H+N
Sbjct: 38  HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI-HTN 92

>TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.303
           YNL027W
          Length = 506

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 2/72 (2%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNYLV 409
           + +C LC+K F R   LK HL +H+ ER F+C  C     R+ +  +H  L      Y+ 
Sbjct: 391 MFACELCDKRFTRPYNLKSHLRTHTNERPFICSSCGKAFARQHDRKRHEDLHTGKKRYVC 450

Query: 410 IELKKNNAVFSC 421
               K+   + C
Sbjct: 451 GGHLKDGTAWGC 462

>KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.303
           YNL027W
          Length = 519

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           +++C +C+K F R   LK HL +H+ ER F C  C     R+ +  +H  L
Sbjct: 396 LYTCEVCDKKFTRPYNLKSHLRTHTNERPFACTICGKAFARQHDRKRHEDL 446

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 41/95 (43%), Gaps = 12/95 (12%)

Query: 354 SCHLCEKSFRRKSWLKRHLLSHSTERQFLC--------PW-CLSRHKRKDNLLQHMKLKH 404
           +C +C K+F R+   KRH   HS ++++ C        PW C  +  R D L +H K   
Sbjct: 426 ACTICGKAFARQHDRKRHEDLHSGKKRYACGGKLKSGIPWGCGKKFARSDALGRHFKTDC 485

Query: 405 SNYLVIELKKNNAVFSCVNGGNREKLNDTDDIRNL 439
               +  L +  A     N  N     +TD + NL
Sbjct: 486 GRKCIAPLYEEAAQEKAFNENNT---TETDTLANL 517

>TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {ON}
           Anc_6.256 YPL230W
          Length = 361

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%)

Query: 358 CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411
           C   F R   L RH   H+ E+ F C  CL    R DNL QH++  H   +VI+
Sbjct: 42  CNMVFTRSENLTRHRRKHTGEKPFKCHVCLKFFSRIDNLKQHIESVHGKDMVIQ 95

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412
           H C  C K F + + L+ H+ SH   + F C +C  R  +  NL  H++L H+     E 
Sbjct: 503 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HTGEKPYEC 561

Query: 413 KKNNAVFS 420
           +K    FS
Sbjct: 562 EKCGRRFS 569

>TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa]
           {ON} Anc_7.543 YPR186C
          Length = 448

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 4/59 (6%)

Query: 354 SCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC----LSRHKRKDNLLQHMKLKHSNYL 408
           +C +C+KS+ R   L+RHL+SHSTE+ F C +C     ++ + K + + H K     YL
Sbjct: 91  TCDICQKSYSRMYHLERHLISHSTEKPFHCSFCNKGVTTKQQLKRHEITHTKSFKCTYL 149

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 358 CEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHM 400
           CEK F R S L  H LS H   +QF C  C   + R  +L +H+
Sbjct: 66  CEKVFTRPSLLTEHQLSFHQGIKQFTCDICQKSYSRMYHLERHL 109

>ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 587

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/74 (22%), Positives = 33/74 (44%), Gaps = 12/74 (16%)

Query: 346 GGNLTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSR------------HKRK 393
           G N   +  CH C+  F+ + +L RH+  H+ ++ + CP+ +                R+
Sbjct: 197 GANSEGLFVCHYCDAKFKIRGYLTRHIKKHAIQKAYHCPFFMGEAPPELRCHNSGGFSRR 256

Query: 394 DNLLQHMKLKHSNY 407
           D    H++ +H  Y
Sbjct: 257 DTYKTHLRTRHFIY 270

>SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {ON}
           conserved hypothetical protein
          Length = 288

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 351 LIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMKL 402
           L H C  C KSFRR S LK H + H     + C W  C  R   K NLL+H ++
Sbjct: 216 LQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRI 269

>Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 344 VIGGNLTLIHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           VI  +   I+ C  C + F     L RH  S HS E+   CP C  R KR+D++LQH+  
Sbjct: 819 VIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNK 878

Query: 403 K 403
           K
Sbjct: 879 K 879

>NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80
          Length = 455

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 347 GNLTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKH 404
           G+    H C +C+++F R     RH+ +H+ E+   C  P C+ +  R D L +H ++ H
Sbjct: 62  GDAPRPHVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRI-H 120

Query: 405 SN 406
           +N
Sbjct: 121 TN 122

>NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {ON}
           Anc_2.303 YNL027W
          Length = 708

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 2/69 (2%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL--KHSNYLVIEL 412
           C LC K+F R   LK HL +H+ E+ F+C  C     R+ +  +H  L      Y+    
Sbjct: 582 CELCNKTFTRPYNLKSHLRTHTNEKPFICKICNKAFARQHDRKRHEDLHTGKKRYICGGK 641

Query: 413 KKNNAVFSC 421
            KN   + C
Sbjct: 642 LKNGDTWGC 650

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412
           H C  C K F + + L+ H+ SH   + F C +C  R  +  NL  H++L H+     E 
Sbjct: 486 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HTGEKPYEC 544

Query: 413 KKNNAVFS 420
           +K    FS
Sbjct: 545 EKCGRRFS 552

>Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa]
           {ON} (16151..16525,16527..17390) [1239 nt, 413 aa]
          Length = 412

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKHSN 406
           H C +C ++F R     RH+ +H+ E+   C  P C+ +  R D L +H ++ H+N
Sbjct: 39  HVCPICNRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHRRI-HTN 93

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLK 403
           I+ C  C + F     L RH  S HS E+   CP C  R KR+D++LQH+  K
Sbjct: 849 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 901

>Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W
           (REAL)
          Length = 802

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHM 400
           I+ C  C++ F     L RH  S HS E+   CP C  R KR+D++LQH+
Sbjct: 715 IYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 764

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 344 VIGGNLTLI----HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLL 397
            I  NL+L       C +C K   R S LK H L H+ +  F CPW  C      K N+L
Sbjct: 285 TIQSNLSLAIRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNML 344

Query: 398 QHMK 401
           +H K
Sbjct: 345 RHFK 348

>Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON}
           (33422..34600) [1179 nt, 393 aa]
          Length = 392

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMKLKHSNYL 408
           C +C K FRR    KRH+ +H+ E+  +C +  C     R D L +HM +  +  L
Sbjct: 29  CEICTKGFRRLEHKKRHIRTHTGEKPHVCTFQGCPKSFSRSDELKRHMNIHSTGEL 84

>KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1119

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSN----- 406
           +  C +C ++F R   L RH   H+ E+ + C  C  ++ R+D LL+H+   H       
Sbjct: 52  LFVCEVCTRAFARHEHLIRHERQHTKEKPYHCGVCERKYGRRDLLLRHVIKMHGGNCGDT 111

Query: 407 YLVIELKKNNAVFSCVNGG 425
            + +  K+ NA  +  + G
Sbjct: 112 VMPLGRKRKNAALTSTSAG 130

>AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if
           syntenic homolog of Saccharomyces cerevisiae YHR006W
           (STP2)
          Length = 274

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 10/83 (12%)

Query: 350 TLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW------CLS--RHKRKDNLLQHMK 401
           + ++ C  C  +F+ + +L RHL  H   + F CP+      C S     RKD    H+K
Sbjct: 153 SAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLK 212

Query: 402 LKHSNYLV--IELKKNNAVFSCV 422
             H  Y V   + ++NN+V  C 
Sbjct: 213 SIHFVYPVGTTKAQRNNSVGRCA 235

>YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC
           domain-containing histone demethylase; specifically
           demethylates H3K36 tri- and dimethyl modification
           states; associates with actively transcribed (RNA
           polymerase II) regions in vivo and specifically targets
           H3K36 in its trimethylation state as its substrate;
           transcriptional repressor of PHR1; Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 796

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHM 400
           I+ C  C++ F     L RH  S HS E+   CP C  R KR+D++LQH+
Sbjct: 708 IYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 757

>NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 12/65 (18%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC-------LSRH-----KRKDNLLQHMKL 402
           CH C+  FR + +L RH+  H+ E+ + CP+        L  H      R+D    H+K 
Sbjct: 275 CHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFFNNDALPELRCHNSGGFSRRDTYKTHLKA 334

Query: 403 KHSNY 407
           +H  Y
Sbjct: 335 RHFIY 339

>Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa]
           {ON} YER169W (REAL)
          Length = 797

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHM 400
           I+ C  C++ F     L RH  S HS E+   CP C  R KR+D++LQH+
Sbjct: 709 IYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 758

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKL 402
           C LC KSF R+S L+ HLL H+  + F C +C      K NL +H ++
Sbjct: 173 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRHERI 220

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMK 401
           C +C K F     L RH   H+ E++ +CP+  C  R  R DN LQH K
Sbjct: 404 CKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYK 452

>TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {ON}
           Anc_4.214 YGR067C
          Length = 737

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412
           H C  C ++F R    KRH  SH   + F C  C     R+D L +H+K  H  +L+   
Sbjct: 5   HVCAFCRRAFSRSEHRKRHERSHQGVKPFQCAVCNHVFVRRDLLKRHIKTVHRAWLLEHG 64

Query: 413 KKNNAVF 419
           + N+ +F
Sbjct: 65  QDNSQLF 71

>Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W
           (REAL)
          Length = 798

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 352 IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHM 400
           I+ C  C++ F     L RH  S HS E+   CP C  R KR+D++LQH+
Sbjct: 710 IYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHL 759

>SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON}
           uniprot|Q875P4 Saccharomyces kluyveri STP1
          Length = 517

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 12/67 (17%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSR------------HKRKDNLLQHM 400
           + CH C+  FR + +L RH+  H+ E+ + CP+  S+              R+D    H+
Sbjct: 162 YVCHYCDAEFRIRGYLTRHIKKHAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDTYKTHL 221

Query: 401 KLKHSNY 407
           K +H  Y
Sbjct: 222 KSRHFIY 228

>NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8.234
          Length = 1156

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 352  IHSCHLCEKSFRRKSWLKRHLLS-HSTERQFLCPWCLSRHKRKDNLLQHMKLK 403
            I+ C  C++ F     L RH  S HS E+   CP C  + KR+D++LQH+  K
Sbjct: 997  IYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 1049

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 345 IGGNLTLI----HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQ 398
           I  NLTL       C +C K   R S LK H + H+ +  F CPW  C      K N+ +
Sbjct: 443 IQSNLTLATKLRKQCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFR 502

Query: 399 HMK 401
           H+K
Sbjct: 503 HLK 505

>YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}
           STP2Transcription factor, activated by proteolytic
           processing in response to signals from the SPS sensor
           system for external amino acids; activates transcription
           of amino acid permease genes
          Length = 541

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 12/70 (17%)

Query: 350 TLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC-------LSRH-----KRKDNLL 397
           TL + CH C+  FR + +L RH+  H+  + + CP+        L  H      R+D   
Sbjct: 201 TLPYICHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYK 260

Query: 398 QHMKLKHSNY 407
            H+K +H  Y
Sbjct: 261 THLKSRHFTY 270

>ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 849

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 33/78 (42%), Gaps = 8/78 (10%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNY------- 407
           CHLC KSF   S LK H+ +H+ E+   C  C  R     NL +H+K     Y       
Sbjct: 765 CHLCGKSFSVSSSLKIHIRTHTGEKPLQCKICGKRFNESSNLNKHLKTHRKKYKCSCCFR 824

Query: 408 -LVIELKKNNAVFSCVNG 424
               E K     F+C N 
Sbjct: 825 SFDTEEKFKAHEFTCCNA 842

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 355 CHL--CEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMK 401
           CH   C + F ++  + RHL  HS  + F C  CL     +D L QHM+
Sbjct: 707 CHWKGCCRKFTQRQKMVRHLKVHSGYKPFKCQVCLKSFSSEDTLNQHMR 755

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWC 386
           C +C KSF  +  L +H+ +HS E+ F C  C
Sbjct: 737 CQVCLKSFSSEDTLNQHMRTHSGEKPFKCHLC 768

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 1/68 (1%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412
           H C  C K F + + L+ H+ SH   + F C +C  R  +  NL  H++L H+     E 
Sbjct: 491 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HTGERPYEC 549

Query: 413 KKNNAVFS 420
            K    FS
Sbjct: 550 DKCGKRFS 557

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLC 383
           + C  C K F RK  L  H+L+H   + F C
Sbjct: 547 YECDKCGKRFSRKGNLAAHMLTHENHKPFQC 577

>Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar to
           Ashbya gossypii AFR531W
          Length = 349

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 32/76 (42%), Gaps = 8/76 (10%)

Query: 350 TLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW----CL----SRHKRKDNLLQHMK 401
           T I+ C  C  SF+ + +L RHL  H   + F CP+    C         RKD    H+K
Sbjct: 231 TTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRKDTFRTHLK 290

Query: 402 LKHSNYLVIELKKNNA 417
             H  Y V   K   A
Sbjct: 291 SIHFVYPVGTTKAQRA 306

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 1/68 (1%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIEL 412
           H C  C K F + + L+ H+ SH   + F C +C  R  +  NL  H++L H+     E 
Sbjct: 487 HKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRL-HTGERPYEC 545

Query: 413 KKNNAVFS 420
            K    FS
Sbjct: 546 DKCGKRFS 553

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLC 383
           + C  C K F RK  L  H+L+H   + F C
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQC 573

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 351 LIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMK 401
           L   C +C K   R S LK H L H+ +  F CPW  C      K N+L+H+K
Sbjct: 268 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320

>KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON}
           Anc_5.586 YHR006W
          Length = 442

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 12/62 (19%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW----------CLSR--HKRKDNLLQHMKL 402
           CH C+  F+ + +L RH+  H+ E+ F CP+          C S     R+D    H+K 
Sbjct: 124 CHYCDAKFKIRGYLTRHIRKHAIEKAFKCPYFNATLPKTLRCHSTGGFSRRDTFKIHLKS 183

Query: 403 KH 404
           +H
Sbjct: 184 RH 185

>Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AEL077W
          Length = 381

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMKL 402
           C +C K   R S L+ H+  H+  R FLC W  C  R   K N+++H +L
Sbjct: 298 CPVCAKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRL 347

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKH 404
           C +C ++F R   L+RH  SH+ E+ + C  C     R+D LL+H    H
Sbjct: 77  CKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLRHALKTH 126

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 355 CHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMK 401
           C +C K F R    +RH+ +H+ E+   C  P C+ R  R D L +H++
Sbjct: 15  CDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVR 63

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 353 HSCHLCEKSFRRKSWLKRHLLSHSTERQFLC--PWCLSRHKRKDNLLQHMKLKHSNYLVI 410
           H C +C K+F R S L  H L H+  + + C  P C  R   K NL++H K+ H+ +  I
Sbjct: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKI-HAKWRDI 252

Query: 411 E 411
           E
Sbjct: 253 E 253

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 351 LIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPW--CLSRHKRKDNLLQHMKL 402
           L + C +C K FRR S L+ H    S  R + CP+  C      K N+L+H KL
Sbjct: 237 LGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKL 290

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,709,805
Number of extensions: 1447691
Number of successful extensions: 5997
Number of sequences better than 10.0: 595
Number of HSP's gapped: 5838
Number of HSP's successfully gapped: 706
Length of query: 490
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 376
Effective length of database: 40,409,475
Effective search space: 15193962600
Effective search space used: 15193962600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)