Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A018502.532ON25625613100.0
NCAS0D026402.532ON2602655328e-67
NDAI0I022702.532ON2772764722e-57
TPHA0C041802.532ON2642604232e-50
KNAG0C058202.532ON2712694008e-47
CAGL0K02981g2.532ON2782813903e-45
Skud_13.2252.532ON2542673744e-43
SAKL0A09460g2.532ON2402513622e-41
TBLA0G022202.532ON2782743582e-40
Smik_13.2482.532ON2552703466e-39
Kpol_1018.342.532ON2922793452e-38
YMR069W (NAT4)2.532ON2852663294e-36
TDEL0A030602.532ON2442312986e-32
ZYRO0B01980g2.532ON1881872911e-31
Suva_13.2442.532ON2572212952e-31
Kwal_26.80162.532ON2402492523e-25
KLTH0D06820g2.532ON2601902482e-24
KLLA0E18569g2.532ON2151591181e-06
Ecym_72562.532ON24368890.007
NDAI0J017404.135ON765142870.020
TBLA0A058401.127ON2023153870.022
ZYRO0A08294g2.385ON360156830.051
NCAS0B018008.604ON79169830.063
Smik_9.432.235ON135994820.089
Agos_YGOB_Anc_2.5322.532ON187119790.100
NDAI0C01310na 1ON265181800.10
Smik_7.1656.145ON62384800.14
KLTH0D11748g8.697ON16270740.37
TPHA0M004103.149ON460104760.41
TPHA0K019404.56ON87381760.46
Suva_7.1586.145ON62247750.58
Suva_7.3713.425ON94282750.62
Kpol_1076.83.58ON52462740.74
KLLA0A12089gsingletonON18168720.76
CAGL0H06281g7.88ON606118731.0
YGL110C (CUE3)6.145ON62447731.0
Kpol_1018.236.289ON651143731.0
NDAI0H019907.17ON116168731.1
Kpol_1057.152.666ON40283721.2
TBLA0D026108.63ON303108711.5
KAFR0C033208.113ON1206216721.5
KLLA0C09845g8.697ON163134691.7
TBLA0I012402.467ON47068711.7
NDAI0J011308.299ON52433711.7
Suva_14.841.99ON763104711.9
AFR224C2.407ON47283702.3
KLTH0H16060g4.4ON594198702.4
Skud_13.3666.289ON59488702.4
NCAS0J010004.135ON735113702.5
Kpol_1043.431.366ON75259702.5
KLLA0F06204g6.306ON877105702.5
NCAS0C012308.697ON19566682.7
NDAI0F013906.257ON189662702.7
YLR453C (RIF2)7.516ON39575692.9
Smik_7.1101.379ON571100693.1
Smik_13.1445.528ON63951693.2
NDAI0G005002.273ON96157693.4
YIL126W (STH1)2.235ON1359132693.5
KLTH0E01056g5.702ON177177693.5
Skud_10.91.127ON203169693.5
Smik_10.3501.508ON35082683.6
NDAI0E034808.429ON429105683.9
KAFR0J013402.292ON72885684.3
Skud_13.1992.607ON18152664.5
Smik_3.1876.367ON170581684.6
SAKL0G13134g5.190ON193746684.7
TDEL0C037801.176ON35162674.9
Skud_10.2841.508ON35382674.9
Suva_12.1491.508ON35782674.9
TBLA0E04270singletonON37675675.0
Kpol_479.148.618ON22359665.2
KNAG0E033908.58ON159137655.3
TBLA0A063304.268ON63855675.6
TBLA0C043504.63ON249137665.6
ZYRO0F18392g1.9ON72572675.7
TDEL0C041702.201ON140081676.1
Kpol_541.38.811ON143150676.1
Ecym_60742.407ON48679667.0
CAGL0C00407g8.277ON55036667.2
Kpol_309.78.872ON88347667.7
YPR010C (RPA135)8.113ON120380668.0
Kpol_1006.98.126ON1292100668.0
KAFR0B027108.259ON141682668.0
KLLA0F26312g2.626ON30150658.1
YJL207C (LAA1)1.127ON201499668.2
KLLA0D13904g7.139ON111112628.4
Ecym_73755.137ON430101659.1
NDAI0F038002.15ON63858659.8
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KAFR0A01850
         (771 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   509   0.0  
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   209   8e-67
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   186   2e-57
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...   167   2e-50
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...   158   8e-47
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   154   3e-45
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...   148   4e-43
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   144   2e-41
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...   142   2e-40
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...   137   6e-39
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...   137   2e-38
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...   131   4e-36
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...   119   6e-32
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...   116   1e-31
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...   118   2e-31
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...   101   3e-25
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...   100   2e-24
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    50   1e-06
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    39   0.007
NDAI0J01740 Chr10 (426321..428618) [2298 bp, 765 aa] {ON} Anc_4....    38   0.020
TBLA0A05840 Chr1 complement(1440357..1446428) [6072 bp, 2023 aa]...    38   0.022
ZYRO0A08294g Chr1 complement(667023..668105) [1083 bp, 360 aa] {...    37   0.051
NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {O...    37   0.063
Smik_9.43 Chr9 (95836..99915) [4080 bp, 1359 aa] {ON} YIL126W (R...    36   0.089
Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...    35   0.100
NDAI0C01310 Chr3 complement(268904..269701) [798 bp, 265 aa] {ON}      35   0.10 
Smik_7.165 Chr7 complement(296887..298758) [1872 bp, 623 aa] {ON...    35   0.14 
KLTH0D11748g Chr4 (960571..961059) [489 bp, 162 aa] {ON} similar...    33   0.37 
TPHA0M00410 Chr13 complement(79537..80919) [1383 bp, 460 aa] {ON...    34   0.41 
TPHA0K01940 Chr11 (408375..410996) [2622 bp, 873 aa] {ON} Anc_4....    34   0.46 
Suva_7.158 Chr7 complement(296305..298173) [1869 bp, 622 aa] {ON...    33   0.58 
Suva_7.371 Chr7 (633643..636471) [2829 bp, 942 aa] {ON} YGR089W ...    33   0.62 
Kpol_1076.8 s1076 complement(16733..18307) [1575 bp, 524 aa] {ON...    33   0.74 
KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} simil...    32   0.76 
CAGL0H06281g Chr8 (620236..622056) [1821 bp, 606 aa] {ON} highly...    33   1.0  
YGL110C Chr7 complement(301537..303411) [1875 bp, 624 aa] {ON}  ...    33   1.0  
Kpol_1018.23 s1018 complement(59840..61795) [1956 bp, 651 aa] {O...    33   1.0  
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    33   1.1  
Kpol_1057.15 s1057 complement(28361..29569) [1209 bp, 402 aa] {O...    32   1.2  
TBLA0D02610 Chr4 (641823..642734) [912 bp, 303 aa] {ON} Anc_8.63...    32   1.5  
KAFR0C03320 Chr3 complement(675037..678657) [3621 bp, 1206 aa] {...    32   1.5  
KLLA0C09845g Chr3 complement(850737..851228) [492 bp, 163 aa] {O...    31   1.7  
TBLA0I01240 Chr9 (265144..266556) [1413 bp, 470 aa] {ON} Anc_2.4...    32   1.7  
NDAI0J01130 Chr10 complement(259506..261080) [1575 bp, 524 aa] {...    32   1.7  
Suva_14.84 Chr14 complement(152787..155078) [2292 bp, 763 aa] {O...    32   1.9  
AFR224C Chr6 complement(840633..842051) [1419 bp, 472 aa] {ON} S...    32   2.3  
KLTH0H16060g Chr8 (1383120..1384904) [1785 bp, 594 aa] {ON} weak...    32   2.4  
Skud_13.366 Chr13 (633641..635425) [1785 bp, 594 aa] {ON} YMR198...    32   2.4  
NCAS0J01000 Chr10 (166339..168546) [2208 bp, 735 aa] {ON} Anc_4....    32   2.5  
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    32   2.5  
KLLA0F06204g Chr6 (602989..605622) [2634 bp, 877 aa] {ON} simila...    32   2.5  
NCAS0C01230 Chr3 complement(227981..228568) [588 bp, 195 aa] {ON...    31   2.7  
NDAI0F01390 Chr6 (340262..345952) [5691 bp, 1896 aa] {ON} Anc_6....    32   2.7  
YLR453C Chr12 complement(1041799..1042986) [1188 bp, 395 aa] {ON...    31   2.9  
Smik_7.110 Chr7 (195430..197145) [1716 bp, 571 aa] {ON} YGL160W ...    31   3.1  
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...    31   3.2  
NDAI0G00500 Chr7 (106930..109815) [2886 bp, 961 aa] {ON} Anc_2.2...    31   3.4  
YIL126W Chr9 (117992..122071) [4080 bp, 1359 aa] {ON}  STH1ATPas...    31   3.5  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...    31   3.5  
Skud_10.9 Chr10 complement(15406..21501) [6096 bp, 2031 aa] {ON}...    31   3.5  
Smik_10.350 Chr10 (537706..538758) [1053 bp, 350 aa] {ON} YJR060...    31   3.6  
NDAI0E03480 Chr5 complement(746985..748274) [1290 bp, 429 aa] {O...    31   3.9  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....    31   4.3  
Skud_13.199 Chr13 (339148..339693) [546 bp, 181 aa] {ON} YMR042W...    30   4.5  
Smik_3.187 Chr3 (267024..272141) [5118 bp, 1705 aa] {ON} YCR089W...    31   4.6  
SAKL0G13134g Chr7 (1127910..1133723) [5814 bp, 1937 aa] {ON} sim...    31   4.7  
TDEL0C03780 Chr3 complement(664822..665877) [1056 bp, 351 aa] {O...    30   4.9  
Skud_10.284 Chr10 (506276..507337) [1062 bp, 353 aa] {ON} YJR060...    30   4.9  
Suva_12.149 Chr12 (226538..227611) [1074 bp, 357 aa] {ON} YJR060...    30   4.9  
TBLA0E04270 Chr5 (1089254..1090384) [1131 bp, 376 aa] {ON}             30   5.0  
Kpol_479.14 s479 (28306..28977) [672 bp, 223 aa] {ON} (28306..28...    30   5.2  
KNAG0E03390 Chr5 complement(676662..677141) [480 bp, 159 aa] {ON...    30   5.3  
TBLA0A06330 Chr1 complement(1555490..1557406) [1917 bp, 638 aa] ...    30   5.6  
TBLA0C04350 Chr3 complement(1044965..1045714) [750 bp, 249 aa] {...    30   5.6  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...    30   5.7  
TDEL0C04170 Chr3 (740380..744582) [4203 bp, 1400 aa] {ON} Anc_2....    30   6.1  
Kpol_541.3 s541 complement(7377..11672) [4296 bp, 1431 aa] {ON} ...    30   6.1  
Ecym_6074 Chr6 (139563..141023) [1461 bp, 486 aa] {ON} similar t...    30   7.0  
CAGL0C00407g Chr3 (40815..42467) [1653 bp, 550 aa] {ON} similar ...    30   7.2  
Kpol_309.7 s309 complement(13389..16040) [2652 bp, 883 aa] {ON} ...    30   7.7  
YPR010C Chr16 complement(577585..581196) [3612 bp, 1203 aa] {ON}...    30   8.0  
Kpol_1006.9 s1006 (38965..42843) [3879 bp, 1292 aa] {ON} (38965....    30   8.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....    30   8.0  
KLLA0F26312g Chr6 (2438840..2439745) [906 bp, 301 aa] {ON} simil...    30   8.1  
YJL207C Chr10 complement(41389..47433) [6045 bp, 2014 aa] {ON}  ...    30   8.2  
KLLA0D13904g Chr4 complement(1195920..1196236,1196332..1196350) ...    28   8.4  
Ecym_7375 Chr7 (782285..783577) [1293 bp, 430 aa] {ON} similar t...    30   9.1  
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      30   9.8  

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  509 bits (1310), Expect = 0.0
 Identities = 256/256 (100%), Positives = 256/256 (100%)
 Frame = +1

Query: 1   MENIEIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFT 180
           MENIEIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFT
Sbjct: 1   MENIEIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFT 60

Query: 181 EGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEA 360
           EGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEA
Sbjct: 61  EGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEA 120

Query: 361 EKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIA 540
           EKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIA
Sbjct: 121 EKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIA 180

Query: 541 QVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKT 720
           QVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKT
Sbjct: 181 QVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKT 240

Query: 721 LKVVRKPIYYLLYLPV 768
           LKVVRKPIYYLLYLPV
Sbjct: 241 LKVVRKPIYYLLYLPV 256

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  209 bits (532), Expect = 8e-67
 Identities = 126/265 (47%), Positives = 166/265 (62%), Gaps = 15/265 (5%)
 Frame = +1

Query: 19  FNGFLKIVSDEFPKELRTKGQN----LKRKILYIASED-EENKESDSVINEQDDLTKFTE 183
           F  F  ++ +EFP  L    Q     LKRKIL I  ++    K S  V+       K + 
Sbjct: 4   FEAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVV-----YMKCST 58

Query: 184 GIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAE 363
             G K+LD FL+ILD NLG KY K+S++IY+N   WK NKL EM+SPGL+YVSYW EE++
Sbjct: 59  DQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESD 118

Query: 364 KKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLI-KGLSNVCQIA 540
           +    LFLSFMLTEED   +D +  SV+YLYEIQ++   R  +LGTRL+ + L + C   
Sbjct: 119 EP--MLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRL 176

Query: 541 QVKIRP--AFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTR----- 699
           + +      +PLIGI+LTVFSDN+ AIKFY+ IGM+ T  SP+D V  +E R+TR     
Sbjct: 177 RSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQN 236

Query: 700 --TSVNRKTLKVVRKPIYYLLYLPV 768
             TSV R    +V+KPIYYL YLP+
Sbjct: 237 ISTSVGR---TIVQKPIYYLFYLPL 258

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  186 bits (472), Expect = 2e-57
 Identities = 121/276 (43%), Positives = 160/276 (57%), Gaps = 27/276 (9%)
 Frame = +1

Query: 22  NGFLKIVSDEFPKELRTKG--QNLKRKILYIASEDEEN---KESDSVINEQDDLTKFTEG 186
           +  L IV +EFP  L++       +R+I +  S DE +   + S  V N   D  +    
Sbjct: 7   DALLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQQ---- 62

Query: 187 IGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEK 366
             S +L+ FL ILD NLG KY K+S+ IY+N+ SWK NKL EM SPGLIYVSYW E+ ++
Sbjct: 63  -RSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQE 121

Query: 367 KTCALFLSFMLTEEDFVV------DDIRK-----FSVIYLYEIQLIEKYRGCQLGTRLIK 513
               LFLSFMLTE D  +      DD  +      SVIYLYEIQ++ + RG  +GT+L+ 
Sbjct: 122 P--LLFLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLS 179

Query: 514 -GLSNVCQIAQVKIRPAF---PLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKI 681
             L   C     K    F   PL+GI+LTVFSDN +AI FY+ IGMK T  SP DEV +I
Sbjct: 180 VHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQI 239

Query: 682 ESRKTR-------TSVNRKTLKVVRKPIYYLLYLPV 768
           E R+TR             T ++++KP+YYL YLP+
Sbjct: 240 EKRQTRNLRRINNAGTREVTKQIIKKPVYYLYYLPI 275

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score =  167 bits (423), Expect = 2e-50
 Identities = 110/260 (42%), Positives = 147/260 (56%), Gaps = 13/260 (5%)
 Frame = +1

Query: 28  FLKIVSDEFPKELRTKGQ--NLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKL 201
           F+KIV   +P E+        L +KI+ + SE E+ K S  + N +       +      
Sbjct: 7   FVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDIKNSAELYNGRYLTYSQNKEECEIE 66

Query: 202 LDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCAL 381
               L ILDNNLG+ Y   ++++Y N+  WK+NK+ EMK+ GLIYV Y  E+ EKKT +L
Sbjct: 67  FSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLED-EKKTVSL 125

Query: 382 FLSFMLTEEDFVVDDIRKFS-VIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRP 558
           +LSF LT+E   + DI  FS VIYLYEIQL  + R   LGT+LI G    C +  V    
Sbjct: 126 YLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDC-LVDVHENI 184

Query: 559 AFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEV----------DKIESRKTRTSV 708
              +IGI+LTVFSDN  AI+FYE IGMK T  SP D+            +  S+K  +S 
Sbjct: 185 HKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIKTRSQNSSKKGSSSD 244

Query: 709 NRKTLKVVRKPIYYLLYLPV 768
              +L VV+KP YYL YLP+
Sbjct: 245 KPTSLSVVKKPDYYLYYLPL 264

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score =  158 bits (400), Expect = 8e-47
 Identities = 104/269 (38%), Positives = 152/269 (56%), Gaps = 22/269 (8%)
 Frame = +1

Query: 28  FLKIVSDEFPK----ELRTKGQNLKRKILYIASEDEENKESDSVI------------NEQ 159
           FL+ V  +FP     +L     +LKR+I YI    +++ ES + I               
Sbjct: 9   FLQTVDRQFPTVIGCDLNGTAVSLKRRIHYIEGVGDDDDESHNKIMSYPGGLPPLPPTTD 68

Query: 160 DDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYV 339
           D+ T   +    + L  FLEILDNNLG  Y ++SR+IY N+  W++NK +EM S  L+YV
Sbjct: 69  DNPTAKEDNTCERCLRIFLEILDNNLGPVYARLSRKIYGNSKHWRENKWLEMLSAQLVYV 128

Query: 340 SYWKEEAEKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGL 519
           SYW  ++E     L+ SFMLTEE+ +        V+YLYEIQLIE  R  +LG  ++  L
Sbjct: 129 SYWVSDSEP---VLYTSFMLTEENGISSIESTDRVVYLYEIQLIEAIRRQKLGQAIVSYL 185

Query: 520 SNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKT- 696
           +  C +   ++        + LTVFSDN++A+KFYER+   +T  SP+DEV +   R+T 
Sbjct: 186 TE-CALESPEV------AAVALTVFSDNEKALKFYERLNFTYTIDSPRDEVTEKPRRRTA 238

Query: 697 -RTSVN---RKTLKV-VRKPIYYLLYLPV 768
            RT+++      +KV ++KP YYLLYL V
Sbjct: 239 ARTALDPARDSDVKVTIKKPTYYLLYLEV 267

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  154 bits (390), Expect = 3e-45
 Identities = 107/281 (38%), Positives = 153/281 (54%), Gaps = 25/281 (8%)
 Frame = +1

Query: 1   MENIEIF-----NGFLKIVSDEFPKELRTKGQ--------NLKRKILYIASEDE--ENKE 135
           M N E++     + FL  V D FPK + TK           L+RK+L I  +D    NK 
Sbjct: 1   MTNNELYGTNVNDSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKA 60

Query: 136 SDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEM 315
             + +  +    K ++ I    L S LE+LD NLG KYE  S+E+Y N   WK+NK+ EM
Sbjct: 61  LTNEVVLRSKHIKESKNI----LSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEM 116

Query: 316 KSPGLIYVSYW-KEEAEKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQ 492
            + G+IYVSYW K + E     LFLSFMLTEE+ +  +    SVI+LYEIQ+ ++ R   
Sbjct: 117 NTEGMIYVSYWTKVDDEHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQG 176

Query: 493 LGTRLIKGLSNVCQ---IAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPK 663
           LG   +      C    +    +   FP  GI+LTVF+DN  AI  Y+++GM  T  SPK
Sbjct: 177 LGQYFLSNCLFQCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPK 236

Query: 664 DEV-DKIESRKTRTS--VNRKTLK---VVRKPIYYLLYLPV 768
           D + D+   R+TR S  +N K      +++KP+YY+ + P+
Sbjct: 237 DVLYDQNTRRRTRNSRKINNKNESPRILIKKPLYYMYWKPI 277

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score =  148 bits (374), Expect = 4e-43
 Identities = 108/267 (40%), Positives = 142/267 (53%), Gaps = 17/267 (6%)
 Frame = +1

Query: 16  IFNGFLKIVSDEFPKELRTKGQN----------LKRKILYIASEDEENKESDSVINEQDD 165
           +F  FL I  DEFP+ L     N          LKR+I+YI    EEN E DS+   Q  
Sbjct: 1   MFKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIP---EENGEVDSIDGPQCT 57

Query: 166 LTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSY 345
                +  G  +LDS ++++D +LG+KY + SR +Y N   WK NKL EMKS GL+YVSY
Sbjct: 58  NYNLHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSY 117

Query: 346 WKEEAEKKTCALFLSFMLTEEDFVV--DDIRKFS--VIYLYEIQLIEKYRGCQLGTRLIK 513
           W   A       F SFMLTEE  +V  D   + S  VIYLYEI +   +RG  LG RL++
Sbjct: 118 WGNGA----LGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLE 173

Query: 514 GLSNVCQ-IAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESR 690
               +C+ +A+   R      G+ LTVF DN RA + YE IG     GSP      +  R
Sbjct: 174 --RALCEGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGFCRAPGSPAPAAPAL--R 229

Query: 691 KTRTSVNRKTLKVVRKPIYYL--LYLP 765
            TR    RK + V R P+YY+  L++P
Sbjct: 230 PTRH--GRKRVVVARDPLYYVYCLHMP 254

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  144 bits (362), Expect = 2e-41
 Identities = 97/251 (38%), Positives = 139/251 (55%), Gaps = 2/251 (0%)
 Frame = +1

Query: 22  NGFLKIVSDEFPKELRTKGQNLK-RKILYIASEDEENKESDSVINEQDDLTKFTEGIGSK 198
           N  L  V D FP  +  K  +L  RK+L I         S  V     D         + 
Sbjct: 7   NVLLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQVCTWSGDRQS-----SNS 61

Query: 199 LLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCA 378
           LL  FL++LD NLG+KY  +S  +Y N  SW +NKL EM++ GL+YV Y++  +      
Sbjct: 62  LLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVSP----L 117

Query: 379 LFLSFMLTEE-DFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIR 555
           +FLSF+LT+E DF+ D ++   V+YLYEIQL+ + +G +LGT++++        +  ++ 
Sbjct: 118 MFLSFLLTDEPDFLPDPVK---VVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSRLD 174

Query: 556 PAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKTLKVVR 735
           P   L GI+LTVFSDN  A+  Y  IGM    GSP DE+     R+TR S     L+ V 
Sbjct: 175 PL--LKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEI-ATSQRRTRHSTT--DLQTVS 229

Query: 736 KPIYYLLYLPV 768
           +P YYL++LPV
Sbjct: 230 RPDYYLMFLPV 240

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score =  142 bits (358), Expect = 2e-40
 Identities = 93/274 (33%), Positives = 149/274 (54%), Gaps = 28/274 (10%)
 Frame = +1

Query: 31  LKIVSDEFPKELRTK-GQNLKRKILYIASEDEENKESDSVINEQDD------LTKFTEGI 189
           +++V + FPK + TK G  L+RKI  I   +  +  SD   N  DD        +    +
Sbjct: 7   VQLVDNAFPKSISTKQGITLERKIYIIGDSENNSLLSDQNNNSNDDEIYWYFKDRKNPTV 66

Query: 190 GSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKK 369
            + +     +++D NLG  Y+K S++IY+N+  W  NK  EM +  +IY++YW  + ++ 
Sbjct: 67  ENIIKTQIFQLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITYW--DCKQN 124

Query: 370 TCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVK 549
           + ALFLS +  EE +++++  +  V+YLYEI + ++Y+   +G RLIK       I  +K
Sbjct: 125 SVALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLK 184

Query: 550 I-RPAFPLIGIQLTVFSDNKRAIKFY-ERIGMKFTYGSPKDEVDKIESRKTRT------- 702
           I R     IG++LTVFS+N  A  FY  +I M++T+GSP+DE+  +  R TR+       
Sbjct: 185 IERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSFDEKLGE 244

Query: 703 --------SVNRKT----LKVVRKPIYYLLYLPV 768
                   S+N K      K +RKP YY+L  PV
Sbjct: 245 HCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score =  137 bits (346), Expect = 6e-39
 Identities = 102/270 (37%), Positives = 146/270 (54%), Gaps = 20/270 (7%)
 Frame = +1

Query: 16  IFNGFLKIVSDEFPKELR---TKGQN-------LKRKILYIASED---EENKESDSVINE 156
           +F+ FLKI   +FP+ L    T G N       LKR++L+I   D   ++N E  + +N 
Sbjct: 1   MFHQFLKICMQDFPETLEYTNTDGNNGTATTTVLKREMLFIPEGDSNSQDNIEIPTCVNY 60

Query: 157 QDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIY 336
                +  +  G+ +LDS ++++D +LG KY + SR +Y N   WK NKL EMKSP L+Y
Sbjct: 61  -----RLHKSRGNHILDSCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVY 115

Query: 337 VSYWKEEAEKKTCALFLSFMLTEEDFVV--DDIRKFS--VIYLYEIQLIEKYRGCQLGTR 504
           VSYW   A     A F SFMLTEE  +V  D   + S  VIYLYE+ +   +RG  +G R
Sbjct: 116 VSYWDNGA----LAAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRR 171

Query: 505 LIKGLSNVCQIAQVKIRPAF-PLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKI 681
           L++    +C+     +R  +    G+ LTVFSDN RA + YE +G     GSP       
Sbjct: 172 LLE--RALCEGVARHVRCLYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSP--AAGAP 227

Query: 682 ESRKTRTSVNRKTLKVVRKPIYYL--LYLP 765
            +R TR    R  + V R P+YY+  L++P
Sbjct: 228 TTRPTRHGGER--VVVPRDPLYYVYCLHMP 255

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score =  137 bits (345), Expect = 2e-38
 Identities = 97/279 (34%), Positives = 151/279 (54%), Gaps = 35/279 (12%)
 Frame = +1

Query: 37  IVSDEFPKELRTKGQN---------LKRKILYIASEDEENKESDSVINEQDDLTKFTEGI 189
           +  + FP+ L     N         L R+++ I S++ +    ++V++   D  K     
Sbjct: 10  VAENIFPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNVLSYYKDNVKC---- 65

Query: 190 GSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKK 369
              +L+  L+ILDNNLG  Y + S +IY N   WK+NK+VEMKS GL+YV Y   +   K
Sbjct: 66  -DVVLNKLLDILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIY--NDDITK 122

Query: 370 TCALFLSFMLTEEDFVV----DDIRKFS-----VIYLYEIQLIEKYRGCQLGTRLIKG-L 519
              LF+SFM+T++  +V    +D  + S     VIYLYEIQL+E  R  +LGT LI   L
Sbjct: 123 EPLLFMSFMITDDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTILITNYL 182

Query: 520 SNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTR 699
               +I     +    +I ++LTVFS+N  AI FY++IGM +T  SP+D++   + R+TR
Sbjct: 183 KKTIEILNKDYQK--NIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTR 240

Query: 700 T----------------SVNRKTLKVVRKPIYYLLYLPV 768
           +                + ++   K+++KP YYLL+LP+
Sbjct: 241 STTIALESKNNEPSSRLTTSKPIKKIIKKPDYYLLFLPI 279

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score =  131 bits (329), Expect = 4e-36
 Identities = 95/266 (35%), Positives = 143/266 (53%), Gaps = 16/266 (6%)
 Frame = +1

Query: 16  IFNGFLKIVSDEFPKELRTKGQN---------LKRKILYIASEDEENKESDSVINEQDDL 168
           +F  FL +  ++FP+ +  K  +         L+R+I+YI  +D ++   DSV + +   
Sbjct: 32  MFQHFLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDS--IDSVDSLKCIN 89

Query: 169 TKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYW 348
            K  +  G ++LD+ ++++D +LG KY + SR +Y N   WK NKL EMKS GL+YV YW
Sbjct: 90  YKLHKSRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYW 149

Query: 349 KEEAEKKTCALFLSFMLTEEDFVV--DDIRKFS--VIYLYEIQLIEKYRGCQLGTRLIKG 516
               +      F SFMLTEE  +V  D + + S  VIYLYE+ +   +RG  +G RL++ 
Sbjct: 150 ----DNGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLE- 204

Query: 517 LSNVCQ-IAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRK 693
              +C  +A+   R      G+ LTVFSDN RA + YE +G     GSP      I  R 
Sbjct: 205 -HALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTI--RH 261

Query: 694 TRTSVNRKTLKVVRKPIYYL--LYLP 765
           TR    R  + V   P+YY+  L++P
Sbjct: 262 TRHGGGR--VVVPCDPLYYVYCLHMP 285

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score =  119 bits (298), Expect = 6e-32
 Identities = 85/231 (36%), Positives = 115/231 (49%), Gaps = 15/231 (6%)
 Frame = +1

Query: 13  EIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIG 192
           E  N  +K  +  FP  +   G  L RK+L I +E E   E+D  I+      +      
Sbjct: 4   ESLNDVVKYANQNFPTTINAAGIQLTRKLLAIDTE-EYPVETDQCISYVHSPRE-----A 57

Query: 193 SKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKT 372
            KLL   LEILD NLG KY   SR +Y N   W+ NK  EM +PGL+YV Y        T
Sbjct: 58  EKLLWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTAT 117

Query: 373 --------CALFLSFMLTEEDFVV--DDIRKFSVIYLYEIQLIEKYRGCQLGTRLI---- 510
                     LFLSFMLTEED +V  D    ++V+YLYE+QL+ + R   L  RL+    
Sbjct: 118 QRRNAPFSPLLFLSFMLTEEDGLVADDPTEVWTVLYLYELQLLPRVRRLGLAARLLGDHL 177

Query: 511 -KGLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSP 660
            +    +C  ++          G++LTVF+DN  AI+ YE +GM+    SP
Sbjct: 178 AQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP 228

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score =  116 bits (291), Expect = 1e-31
 Identities = 68/187 (36%), Positives = 102/187 (54%)
 Frame = +1

Query: 196 KLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTC 375
           K+L+  L++++ NLG+ Y K ++ IY NN  W+ NK  EM S  L +VSYW  E+ +  C
Sbjct: 19  KILEKQLQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSYWNVESNELVC 78

Query: 376 ALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIR 555
             F S M  EE  V  ++   ++IYLYEI +  ++R  + G  ++  L         K+ 
Sbjct: 79  --FCSIMPCEESIVEGEMS--NIIYLYEIHVAPEWRNQKFGKSILNALKE-------KLC 127

Query: 556 PAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKTLKVVR 735
           P   L GI+LTVFS N+RAI FY   G   +Y SP D     + R+TRT +       + 
Sbjct: 128 PKAHLSGIELTVFSSNERAINFYRNNGFTLSYDSPSD-----KRRRTRTGIR------II 176

Query: 736 KPIYYLL 756
           +P YY++
Sbjct: 177 RPTYYIM 183

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score =  118 bits (295), Expect = 2e-31
 Identities = 79/221 (35%), Positives = 119/221 (53%), Gaps = 17/221 (7%)
 Frame = +1

Query: 16  IFNGFLKIVSDEFPKELRTKGQN----------LKRKILYIASEDEENKESDSVINEQDD 165
           +F  FL I  +EFP+ L   G +          L+R+++Y+  +D +    D  I+  + 
Sbjct: 1   MFQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGD----DGGIDTPEC 56

Query: 166 LT-KFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVS 342
           +  K  +  G + L S ++++D +LG KY + SR +Y N   WK NKL EMKS GL+YV 
Sbjct: 57  MNYKLHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVC 116

Query: 343 YWKEEAE-KKTCALFLSFMLTEEDFVVD----DIRKFSVIYLYEIQLIEKYRGCQLGTRL 507
           YW  +A+ ++    F SFMLTEE  +V+      +   VIYLYE+    + RG  LG RL
Sbjct: 117 YWGNDAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHRGRG--LGRRL 174

Query: 508 IKGLSNVCQIAQVKI-RPAFPLIGIQLTVFSDNKRAIKFYE 627
           +     +C+    ++ R    L G+ LTVF DN RA + YE
Sbjct: 175 L--AKALCEGVAARVRRTCDDLFGVALTVFGDNTRARRLYE 213

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score =  101 bits (252), Expect = 3e-25
 Identities = 83/249 (33%), Positives = 126/249 (50%), Gaps = 7/249 (2%)
 Frame = +1

Query: 40  VSDEFPKELR-TKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFL 216
           V+D FP  L    GQ ++R +  +                 D +    E     LL+  L
Sbjct: 13  VTDSFPTTLTLASGQRIQRAVYGVP---------------MDTVRSRAEIPDPCLLEQLL 57

Query: 217 EILDNNLGNKYEKISREIY-DNNDSWKKNKLVEMKSPGLIYVSYWK--EEAEKKTCAL-F 384
            ++D+NLG  Y + ++ +Y D   SWK+ K  EM +PGL+YV Y    EE  K+   L F
Sbjct: 58  ALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEGLPLAF 117

Query: 385 LSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIK-GLSNVCQIAQVKIRPA 561
           LS +LT+E  +       +V+YL EI + +  RG  LG  L++ G++   + A    R A
Sbjct: 118 LSLLLTDEPELGP--APAAVVYLMEIHVADIIRGLGLGGTLLREGVAGTVRGA----RRA 171

Query: 562 FPLI-GIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKTLKVVRK 738
            P I G +LTVF+DN+ A++ Y R+GM+    SP+D   ++     RT   R   + V +
Sbjct: 172 HPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVH---RRTRATRYESRKVTR 228

Query: 739 PIYYLLYLP 765
           P YYLL+ P
Sbjct: 229 PTYYLLFWP 237

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score =  100 bits (248), Expect = 2e-24
 Identities = 64/190 (33%), Positives = 105/190 (55%), Gaps = 1/190 (0%)
 Frame = +1

Query: 199 LLDSFLEILDNNLGNKYEKISREIYD-NNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTC 375
           LLD  L ++  NLG  Y + +R IY     SW   K  EM++PGL+YV Y    ++    
Sbjct: 77  LLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSDSHSQP--- 133

Query: 376 ALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIR 555
            +F+S +LT+E  +  ++    V+YL+EI + +  RG  LGT L++        +  +  
Sbjct: 134 LVFMSLLLTDEPELGQELAA-RVLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLASLSRAS 192

Query: 556 PAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKTLKVVR 735
           P+  ++G +LTVFS+N+RA++ Y  +GM     SP+D   ++  R+TR      +L  V 
Sbjct: 193 PS--VLGAELTVFSENQRALRLYLALGMHVAAWSPQDRRAQVR-RRTRAIAYDSSL--VT 247

Query: 736 KPIYYLLYLP 765
           +P YY+L+ P
Sbjct: 248 RPAYYILFWP 257

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 50.1 bits (118), Expect = 1e-06
 Identities = 45/159 (28%), Positives = 74/159 (46%), Gaps = 10/159 (6%)
 Frame = +1

Query: 202 LDSFLEILDNNLGNKYEKISREIYD--------NNDSWKKNKLVEMKSPGLIYVSYWKEE 357
           L   L I+  NL   YE     IY+         N+ W + K  EM    L+Y+  +K +
Sbjct: 49  LPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRD 108

Query: 358 AEKKTCALFLSFMLTEEDFVVDDIRKFS--VIYLYEIQLIEKYRGCQLGTRLIKGLSNVC 531
             K     F S  L++      D  K +   ++LYEI L+ +Y+   LG+ +  GL  + 
Sbjct: 109 TTK--IVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGL--LI 164

Query: 532 QIAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFT 648
            +A+    P+     I+L VF+ N  A ++Y+R+G + T
Sbjct: 165 PLARDLTCPS-----IELCVFTANDVACRWYKRLGFQLT 198

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 38.9 bits (89), Expect = 0.007
 Identities = 23/68 (33%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +1

Query: 442 VIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFP-LIGIQLTVFSDNKRAIK 618
           V+Y+ EI +   ++   LG+ ++     + Q  Q    P+FP L G++LTVF+ N++A+ 
Sbjct: 159 VVYVMEIHVSPSFQNQGLGSCMLLCARQLVQHMQ----PSFPQLKGLELTVFTGNRQALA 214

Query: 619 FYERIGMK 642
            Y R G K
Sbjct: 215 LYRRQGFK 222

>NDAI0J01740 Chr10 (426321..428618) [2298 bp, 765 aa] {ON} Anc_4.135
           YLR319C
          Length = 765

 Score = 38.1 bits (87), Expect = 0.020
 Identities = 35/142 (24%), Positives = 60/142 (42%), Gaps = 8/142 (5%)
 Frame = +1

Query: 22  NGFLKIVSDEFPKELRTKGQNLKRK-----ILYIASEDEENKESDSVINEQDDLTKFTEG 186
           N F K + D   K  + K  +   K     +    S++E  + SDS+++  DDL    E 
Sbjct: 505 NDFTKAIEDILEKITKFKSMSFNTKTSANRVYMDKSQNELGEVSDSLLSRVDDLQDIIEV 564

Query: 187 IGSKLLDSFLEILDNNLGNKYEKISREIYD-NNDSWKKNKLVEMKSPGLIYVSYWKE--E 357
           I   + D   +        K E + +E+ D NND  K  + + ++ P      +WK+  E
Sbjct: 565 IRKDVADRGAK----PSKKKLESVQQELLDANNDMKKMEQFIAIEKP------HWKKIWE 614

Query: 358 AEKKTCALFLSFMLTEEDFVVD 423
            E         F+  +E+ V+D
Sbjct: 615 TELDKVCEEQQFLTLQEELVLD 636

>TBLA0A05840 Chr1 complement(1440357..1446428) [6072 bp, 2023 aa] {ON}
            Anc_1.127 YJL207C
          Length = 2023

 Score = 38.1 bits (87), Expect = 0.022
 Identities = 38/153 (24%), Positives = 65/153 (42%), Gaps = 3/153 (1%)
 Frame = +1

Query: 79   QNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKI 258
            Q  +RKI   +          +++ + D+L  FT+G  + L+  ++  L   +  KYE I
Sbjct: 1492 QKARRKIELSSLNAWAQIVEKALLTKNDELITFTKGYWNTLIYLWIISLREYVMVKYESI 1551

Query: 259  SREIYDNNDSWKKNKLVEMKSPGL-IYVSYWKEEAEKKTCALFLSFMLTEEDFVVDDIRK 435
                  +N S  KN L E+K+  L +Y   W    E   C L  +  +  E    D+I  
Sbjct: 1552 QE--ISSNTSQSKNVLTEIKNSKLELYKPVWLNFVETLGCLLEENKDMILECLNEDEIES 1609

Query: 436  FSVIYLYEI--QLIEKYRGCQLGTRLIKGLSNV 528
            F  I L +    +I+      +  R++  L N+
Sbjct: 1610 FMFILLTQCLEAIIKNIDNHSVKKRVLPALHNI 1642

>ZYRO0A08294g Chr1 complement(667023..668105) [1083 bp, 360 aa] {ON}
           some similarities with uniprot|P40214 Saccharomyces
           cerevisiae YMR144W Hypothetical ORF
          Length = 360

 Score = 36.6 bits (83), Expect = 0.051
 Identities = 37/156 (23%), Positives = 70/156 (44%), Gaps = 8/156 (5%)
 Frame = +1

Query: 40  VSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLE 219
           VS+E  +     G  L R       +D EN+ S S + +Q++  +   GI     D F+ 
Sbjct: 33  VSNEELQMAIASGMKLMR---VFEQQDSENETSSSNLQDQENSKQVLNGILDAKYDKFIP 89

Query: 220 ILDNN--LGNKYEKISREIYDNNDSWKKNKLVEMKSPGL-----IYVSYWKEEAEKKTCA 378
             D N  + +    +++ +  N     KN +++  S  +     +  +  K++ E+K C 
Sbjct: 90  PRDINAVVSSLIHVLNQSVRQNQQLKLKNMILKSNSGDVQSRYEVEENLKKQQFERKKCQ 149

Query: 379 LFLSFMLTEEDFVVDDIR-KFSVIYLYEIQLIEKYR 483
           LFL     E + ++  I+ K   +  Y+ ++IEK R
Sbjct: 150 LFL-----EREHLIKRIQTKDGKVAKYKNKIIEKNR 180

>NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {ON}
           Anc_8.604 YOR195W
          Length = 791

 Score = 36.6 bits (83), Expect = 0.063
 Identities = 24/69 (34%), Positives = 41/69 (59%), Gaps = 7/69 (10%)
 Frame = +1

Query: 115 EDEENKESDSV---INEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDN-- 279
           E+E N+   ++     E+DDLT+  + + +K+ +S  EIL   + N+ +KI +E YDN  
Sbjct: 318 ENEVNERESTIKEITQERDDLTEKRDKLKAKIKNSKDEIL---MLNQNQKILQEKYDNLS 374

Query: 280 --NDSWKKN 300
             ND+W+ N
Sbjct: 375 NENDTWRNN 383

>Smik_9.43 Chr9 (95836..99915) [4080 bp, 1359 aa] {ON} YIL126W (REAL)
          Length = 1359

 Score = 36.2 bits (82), Expect = 0.089
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 8/94 (8%)
 Frame = +1

Query: 67   RTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNK 246
            + +    KR I  +A+ED+EN E +SV  E  D       +  +   S +EI++ +   K
Sbjct: 1145 KRRSSRRKRTIAIVAAEDKENVEEESVPKENGDAK-----VEEEQKSSSVEIINGSESKK 1199

Query: 247  YE-------KISR-EIYDNNDSWKKNKLVEMKSP 324
             +       K+ +  + DNNDS +  +  E KSP
Sbjct: 1200 KKTKLTVKIKLKKTAVSDNNDSKQTEETSEAKSP 1233

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score = 35.0 bits (79), Expect = 0.100
 Identities = 28/119 (23%), Positives = 53/119 (44%)
 Frame = +1

Query: 286 SWKKNKLVEMKSPGLIYVSYWKEEAEKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQ 465
           +W + K  E+  P  +++ Y ++ A +  C  F+S +L              V+Y+ E+ 
Sbjct: 72  AWPRCKRAELLDPAALHILY-RDPAGRLAC--FISLLLPGP--------ADPVLYILELH 120

Query: 466 LIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMK 642
           +   +R         +GL+     A  +   A  L  ++LTVF+ N+ A+  Y R G +
Sbjct: 121 VAAPFRR--------RGLAAALLDAATRTARAAGLTRLELTVFTANRPALALYARAGFR 171

>NDAI0C01310 Chr3 complement(268904..269701) [798 bp, 265 aa] {ON}
          Length = 265

 Score = 35.4 bits (80), Expect = 0.10
 Identities = 38/181 (20%), Positives = 72/181 (39%), Gaps = 12/181 (6%)
 Frame = +1

Query: 112 SEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSW 291
           +ED      D  + E +++ +  EG+G        E        +YE    E     +  
Sbjct: 12  NEDRNLNRDDQTMQEDEEIKRMVEGLGKSSYRKRYE-------QQYEDAIVECLKKENLS 64

Query: 292 KKNKLVEMKSPGL-IYVSYWKEEAEKKTCALFLSFMLTEEDFVVDDIRKFS--------- 441
             + ++  K   L  + SY K+  E+    +++   LT+ +  ++ +R+F          
Sbjct: 65  AISGIINQKFATLNNHYSYIKDYLER---LVYMYADLTDRETAINSLRRFYEGEHKEPNL 121

Query: 442 -VIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPA-FPLIGIQLTVFSDNKRAI 615
              Y++ I  +  + GCQLG   +       +     I P+ F  I + + +F D K AI
Sbjct: 122 WTDYVFIIVFMGFFFGCQLGFLTLLNSREEEEEEAALIYPSYFSFIFVNMIIFPDYKTAI 181

Query: 616 K 618
           K
Sbjct: 182 K 182

>Smik_7.165 Chr7 complement(296887..298758) [1872 bp, 623 aa] {ON}
           YGL110C (REAL)
          Length = 623

 Score = 35.4 bits (80), Expect = 0.14
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 3/84 (3%)
 Frame = +1

Query: 34  KIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTK---FTEGIGSKLL 204
           K++S+  P ELR K      K+LY A EDE +   D     + DL+K   F +    ++ 
Sbjct: 404 KVISEGVPDELRNKTLTRALKLLYEADEDERDDTYDEADVSRTDLSKKIGFQDDENDEID 463

Query: 205 DSFLEILDNNLGNKYEKISREIYD 276
           D   +  +   G+KY  +   +++
Sbjct: 464 D---DAKEKQQGDKYSAVESYLWN 484

>KLTH0D11748g Chr4 (960571..961059) [489 bp, 162 aa] {ON} similar to
           uniprot|Q08689 Saccharomyces cerevisiae YOR253W NAT5
           Subunit of the N-terminal acetyltransferase NatA (Nat1p
           Ard1p Nat5p) N-terminally acetylates many proteins which
           influences multiple processes such as the cell cycle
           heat-shock resistance mating sporulation and telomeric
           silencing
          Length = 162

 Score = 33.1 bits (74), Expect = 0.37
 Identities = 20/70 (28%), Positives = 37/70 (52%)
 Frame = +1

Query: 433 KFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRA 612
           K S +Y+    ++E YRG  +G++L+K +   C+        A     I + V  DN++ 
Sbjct: 75  KASGVYIQIFAVLENYRGKGVGSQLLKFVEEQCK--------AHFQHNIYVHVAVDNEKG 126

Query: 613 IKFYERIGMK 642
           I++Y+R G +
Sbjct: 127 IQWYQRKGFE 136

>TPHA0M00410 Chr13 complement(79537..80919) [1383 bp, 460 aa] {ON}
           Anc_3.149 YOL069W
          Length = 460

 Score = 33.9 bits (76), Expect = 0.41
 Identities = 26/104 (25%), Positives = 49/104 (47%), Gaps = 4/104 (3%)
 Frame = +1

Query: 151 NEQDDLTKFTEGIGS----KLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMK 318
           NE D+++ F + I +    K LDS    L+  L  K   +  ++ +N D++K+ K     
Sbjct: 175 NELDNVSPFVDSINNEEELKRLDSENAALEIEL-KKLTAVQEQLKNNYDNYKRTKNDLFT 233

Query: 319 SPGLIYVSYWKEEAEKKTCALFLSFMLTEEDFVVDDIRKFSVIY 450
               +   Y + E+EKK    F +  + + +  +DD++    IY
Sbjct: 234 GLESVNFKYIELESEKKKLEKFTNANIVDINRKIDDVKSQIKIY 277

>TPHA0K01940 Chr11 (408375..410996) [2622 bp, 873 aa] {ON} Anc_4.56
           YGL049C
          Length = 873

 Score = 33.9 bits (76), Expect = 0.46
 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 6/81 (7%)
 Frame = +1

Query: 142 SVINEQDDLTKFTEGI----GSKLLDSFLEILDN--NLGNKYEKISREIYDNNDSWKKNK 303
           + + EQ +  KF  G     GS LLDS  EIL N    GN   +I  ++ +  +S  KN 
Sbjct: 711 TTVGEQFETDKFNAGQAVLEGSVLLDSLFEILQNIIETGNILSRIKFKLVEIKESRDKNW 770

Query: 304 LVEMKSPGLIYVSYWKEEAEK 366
               K  G   +S   EE E+
Sbjct: 771 SGSKKDEGPKTISQIHEEEER 791

>Suva_7.158 Chr7 complement(296305..298173) [1869 bp, 622 aa] {ON}
           YGL110C (REAL)
          Length = 622

 Score = 33.5 bits (75), Expect = 0.58
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = +1

Query: 34  KIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTK 174
           KI+S   P ELR K      K+LY   EDE +   D     + DL+K
Sbjct: 406 KIISGHVPDELRNKTLTRALKLLYEGDEDERDDTYDEADVSRSDLSK 452

>Suva_7.371 Chr7 (633643..636471) [2829 bp, 942 aa] {ON} YGR089W
            (REAL)
          Length = 942

 Score = 33.5 bits (75), Expect = 0.62
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 2/82 (2%)
 Frame = +1

Query: 58   KELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILD--N 231
            KEL  + + LKRK L++ +E E +K  +S+ N+     K +E   +KL   F ++    +
Sbjct: 809  KELDLEEEYLKRKDLHLKNELEYSKLEESLSND----LKNSEKKSNKLNQDFSQLTSKLD 864

Query: 232  NLGNKYEKISREIYDNNDSWKK 297
             L  + EK+ +E+ +N +  +K
Sbjct: 865  KLNARNEKLKKEVDENEEYIEK 886

>Kpol_1076.8 s1076 complement(16733..18307) [1575 bp, 524 aa] {ON}
           complement(16733..18307) [1575 nt, 525 aa]
          Length = 524

 Score = 33.1 bits (74), Expect = 0.74
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 4/62 (6%)
 Frame = +1

Query: 112 SEDEENKE----SDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDN 279
           S  E+NK+    +D+V  E DD   +   IG+ L  S      NN  NK  K+  +I  N
Sbjct: 2   STTEKNKDIVIINDNVSEENDDYDDYDGHIGNPLTISDSSAESNNGDNKVPKLRSDIDTN 61

Query: 280 ND 285
           ND
Sbjct: 62  ND 63

>KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} similar
           to uniprot|Q5WCY3 Bacillus clausii ABC3243 paiA
           Septation and degradation transcriptional repressor of
           sporulation
          Length = 181

 Score = 32.3 bits (72), Expect = 0.76
 Identities = 20/68 (29%), Positives = 35/68 (51%)
 Frame = +1

Query: 445 IYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFY 624
           + L  I +++KY+G  LG  L+  + ++ Q    K         I L V+  N++AI FY
Sbjct: 100 VELQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKK--------KIWLGVWEHNQKAIDFY 151

Query: 625 ERIGMKFT 648
           ++ G + T
Sbjct: 152 KKFGFEIT 159

>CAGL0H06281g Chr8 (620236..622056) [1821 bp, 606 aa] {ON} highly
           similar to uniprot|P31383 Saccharomyces cerevisiae
           YAL016w TPD3
          Length = 606

 Score = 32.7 bits (73), Expect = 1.0
 Identities = 28/118 (23%), Positives = 53/118 (44%), Gaps = 15/118 (12%)
 Frame = +1

Query: 10  IEIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESD---------SVINEQD 162
           ++++N F+ +V+DE P   R  G+NL   I  +    E   + D         +VIN+Q 
Sbjct: 164 VDLWNLFMTLVNDETPMVRRAVGKNLPILIDLLTENPEFCTDKDLEFISTTFQTVINDQQ 223

Query: 163 DLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDN------NDSWKKNKLVEMK 318
           D  KF        +D  + I+       Y+  SR++ ++      +++W+   +V  K
Sbjct: 224 DSVKFL------AVDCLISIVKFFNKKGYDTHSRDLLNSALSLAGDEAWRVRYVVADK 275

>YGL110C Chr7 complement(301537..303411) [1875 bp, 624 aa] {ON}
           CUE3Protein of unknown function; has a CUE domain that
           binds ubiquitin, which may facilitate intramolecular
           monoubiquitination
          Length = 624

 Score = 32.7 bits (73), Expect = 1.0
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +1

Query: 34  KIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTK 174
           KI+S+  P ELR K      K+LY A EDE +   D     + D +K
Sbjct: 405 KIISEGVPDELRNKTLTRALKLLYEADEDERDDTYDEADVNRSDPSK 451

>Kpol_1018.23 s1018 complement(59840..61795) [1956 bp, 651 aa] {ON}
           complement(59840..61795) [1956 nt, 652 aa]
          Length = 651

 Score = 32.7 bits (73), Expect = 1.0
 Identities = 40/143 (27%), Positives = 64/143 (44%), Gaps = 1/143 (0%)
 Frame = +1

Query: 58  KELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNL 237
           KEL  K +NLK++   +  EDE N +    I+ + ++    +   S      LE   + L
Sbjct: 268 KELEAKKENLKKENENL--EDEINNKVQMCIDIEKEIESLNQNFAS------LENKLSPL 319

Query: 238 GNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCALFLSFMLTEE-DF 414
            N YEK+S+E     ++ +KN L  +++  L     + EE +K          L    D 
Sbjct: 320 NNDYEKVSKEF----ETAEKN-LKSVQAKALEKEILYNEEFDKMEQEQIRRRKLENSIDE 374

Query: 415 VVDDIRKFSVIYLYEIQLIEKYR 483
           +   IR F+  YL E  L E Y+
Sbjct: 375 LKGSIRCFA--YLSESTLTESYK 395

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {ON}
            Anc_7.17
          Length = 1161

 Score = 32.7 bits (73), Expect = 1.1
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +1

Query: 409  DFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRP---AFPLIGI 579
            DF +DDI +     LYE + IE+Y+  Q  T +   + +  Q +QV + P     PL   
Sbjct: 928  DFTMDDITELRQKILYESEGIERYQRKQKPTNMDNTMISTNQSSQVSLNPPQTTMPLQQQ 987

Query: 580  QLTVFSDN 603
            Q T  ++N
Sbjct: 988  QETPMNNN 995

>Kpol_1057.15 s1057 complement(28361..29569) [1209 bp, 402 aa] {ON}
           complement(28361..29569) [1209 nt, 403 aa]
          Length = 402

 Score = 32.3 bits (72), Expect = 1.2
 Identities = 24/83 (28%), Positives = 45/83 (54%), Gaps = 4/83 (4%)
 Frame = +1

Query: 67  RTKGQNLKRKILYIASEDEENKESDSVINEQDD-LTKFTEGIGSKLLDSFLEILDNNLGN 243
           ++KGQ  K+KI    +  ++ KE+ S I+E++D L+K  E    K +    + LD +   
Sbjct: 298 KSKGQRRKKKITQETTSSDKQKENVSPISEREDKLSKSNEKGEFKFMFKVGDELDGSEDE 357

Query: 244 KYEK---ISREIYDNNDSWKKNK 303
           K  K    S+++ +N ++ K +K
Sbjct: 358 KRVKRKPKSKQLNENTNTKKNDK 380

>TBLA0D02610 Chr4 (641823..642734) [912 bp, 303 aa] {ON} Anc_8.63
           YPL018W
          Length = 303

 Score = 32.0 bits (71), Expect = 1.5
 Identities = 30/108 (27%), Positives = 52/108 (48%), Gaps = 7/108 (6%)
 Frame = +1

Query: 211 FLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPG----LIYVSYWKEEAEKKTCA 378
           F + L N +  K + I+ EI +NN   K N+L+    P     L    YW  + +  T  
Sbjct: 194 FFQRLSNKISQKNQNINIEIIENNSCLKLNRLIFRNFPNENIKLDLYIYWNIQLDTTTNE 253

Query: 379 LFLSFM--LTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGT-RLIK 513
           +   +   L + D ++ +    +VI+    +LI++Y G ++GT  LIK
Sbjct: 254 INTDWFIKLNKNDQLLKNKIDLNVIWR---KLIKEY-GIEVGTEELIK 297

>KAFR0C03320 Chr3 complement(675037..678657) [3621 bp, 1206 aa] {ON}
            Anc_8.113 YPR010C
          Length = 1206

 Score = 32.3 bits (72), Expect = 1.5
 Identities = 52/216 (24%), Positives = 81/216 (37%), Gaps = 18/216 (8%)
 Frame = +1

Query: 46   DEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEIL 225
            DE+  +    G N    ++ + S    + +   +IN+  D   F  G   K+     E +
Sbjct: 761  DEYGMDNFPNGTNA---VVAVISYTGYDMDDAMIINKSADERGFAYGTMYKV-----EKV 812

Query: 226  DNNLG-NKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCALFLSFM-- 396
            D  L  N+ + I++     ND W K  L ++   GL Y+  + EE +   CA F   +  
Sbjct: 813  DLALNRNRGDPITQHFGFGNDEWPKEWLDKLDDDGLPYIGTYVEEGD-PICAYFDDTLNK 871

Query: 397  -------------LTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIK--GLSNVC 531
                         + E + + DD  KF  +    I+   + R  Q+G +     G   VC
Sbjct: 872  TKTKTYHSSEPAYIEEVNLIGDDSNKFQELQTVSIKYRIR-RTPQIGDKFSSRHGQKGVC 930

Query: 532  QIAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGM 639
                  I   F   GIQ  V   N  A      IGM
Sbjct: 931  SRKWPTIDMPFSETGIQPDVII-NPHAFPSRMTIGM 965

>KLLA0C09845g Chr3 complement(850737..851228) [492 bp, 163 aa] {ON}
           similar to uniprot|Q08689 Saccharomyces cerevisiae
           YOR253W NAT5 Subunit of the N-terminal acetyltransferase
           NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
           proteins which influences multiple processes such as the
           cell cycle heat- shock resistance mating sporulation and
           telomeric silencing
          Length = 163

 Score = 31.2 bits (69), Expect = 1.7
 Identities = 27/134 (20%), Positives = 62/134 (46%), Gaps = 11/134 (8%)
 Frame = +1

Query: 268 IYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCALFLSFMLTEEDFVVDDIR----- 432
           +Y NN    + K++++  P      Y++E  +K    +F + +    +  +  ++     
Sbjct: 11  VYANNLGTFR-KIIDVVLPVQYPGEYFEEVVDKNAKGVFYAQLAYYGEIAIGAVKSRLIA 69

Query: 433 ------KFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQLTVF 594
                 K + +Y+  + ++E YRG   G+ ++K + + C+ +            I + V 
Sbjct: 70  NKTGGVKPAGMYIEVLAVLEAYRGKTAGSLMLKYIEDKCKESFQH--------DIYVHVA 121

Query: 595 SDNKRAIKFYERIG 636
           +DN+ AI++YE+ G
Sbjct: 122 TDNETAIEWYEKNG 135

>TBLA0I01240 Chr9 (265144..266556) [1413 bp, 470 aa] {ON} Anc_2.467
           YMR094W
          Length = 470

 Score = 32.0 bits (71), Expect = 1.7
 Identities = 22/68 (32%), Positives = 35/68 (51%)
 Frame = +1

Query: 124 ENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNK 303
           E K  D+ +N+Q  L  F +    KL DSF +I D N+    E ++R +   N + +  K
Sbjct: 209 ETKHEDTRVNKQKILENFHK---KKLRDSFYDISDTNIELVGEYLNRMLRLTNINIQGEK 265

Query: 304 LVEMKSPG 327
            VE+ + G
Sbjct: 266 YVEILANG 273

>NDAI0J01130 Chr10 complement(259506..261080) [1575 bp, 524 aa] {ON}
           Anc_8.299 YDR132C
          Length = 524

 Score = 32.0 bits (71), Expect = 1.7
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = -1

Query: 621 KFNSSLIITKYGQLNTNQWESWSYLNLRNLTNI 523
           K  SSL+ T  G  NTN  + W + +L+NLT +
Sbjct: 448 KMISSLLNTGSGNANTNDEQVWDFTDLKNLTRV 480

>Suva_14.84 Chr14 complement(152787..155078) [2292 bp, 763 aa] {ON}
           YNL258C (REAL)
          Length = 763

 Score = 32.0 bits (71), Expect = 1.9
 Identities = 29/104 (27%), Positives = 46/104 (44%), Gaps = 4/104 (3%)
 Frame = +1

Query: 19  FNGFLK----IVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEG 186
           F  F+K    I+ D     L+    +   K++ +ASE +    S S   E  DL    + 
Sbjct: 289 FTKFVKNNASIILDSLDSPLKNLVSSTNNKLIRLASETKTENWSYSG-KEIQDLLMNKQL 347

Query: 187 IGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMK 318
             + LLD  LE+  N + + +E       D N SWK  + +E+K
Sbjct: 348 YYNLLLDKILELHINKIRDIFE-------DPNKSWKTLETIELK 384

>AFR224C Chr6 complement(840633..842051) [1419 bp, 472 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR034C
           (SMF3)
          Length = 472

 Score = 31.6 bits (70), Expect = 2.3
 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 1/83 (1%)
 Frame = +1

Query: 511 KGLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESR 690
           KG+SN+  ++QV +    P++   L  F+ +K+ +   +  G +     P +  + +  +
Sbjct: 371 KGISNILNLSQVVLSLILPIVSAPLIYFTSSKKIMTVVDHDGNEDDLDEPSERTNLVTIK 430

Query: 691 KTRTSV-NRKTLKVVRKPIYYLL 756
           K      N K L  V   I+ L+
Sbjct: 431 KPFVDYSNDKWLAYVSVGIWALI 453

>KLTH0H16060g Chr8 (1383120..1384904) [1785 bp, 594 aa] {ON} weakly
           similar to uniprot|P03874 Saccharomyces cerevisiae
           YHL038C CBP2 Protein required for splicing of COB aI5
           intron Cytochrome B pre-mRNA processing protein
          Length = 594

 Score = 31.6 bits (70), Expect = 2.4
 Identities = 48/198 (24%), Positives = 84/198 (42%), Gaps = 23/198 (11%)
 Frame = +1

Query: 220 ILDNNLGNKYEK--ISREIYDNNDSWKKNKLVEMKSPGLIYVSYWK-------EEAEKKT 372
           I D+ L  +Y K  +   +Y+N    +K  + E K    +Y+S W        EE  K T
Sbjct: 330 ICDSQLKEEYCKATVLYNLYENAQRIQKRLISENKLTHEVYLSLWDELILLRLEELNKLT 389

Query: 373 CALFLSFML---TEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTR---LIKGLSNV-C 531
               L+ M+   T+ D  + D+  ++ I   E++   K  G Q   R   ++  LS V  
Sbjct: 390 LVEDLNTMIRGKTKFDEFLLDLNLYNTIVNAELRGKMKPNGHQKNDRQQAILYVLSIVLT 449

Query: 532 QIAQVK-IRPAFPLIGIQLTVFSDNKRAIKFYERIG------MKFTYGSPKDEVDKIESR 690
           Q   +K I P+   +  +L VF+   R +K ++R G        F   +   E+D I + 
Sbjct: 450 QCKSLKNIYPSLSFVFRELEVFA---REVKIFKRTGNIESAQEMFATANAIVELDNIATA 506

Query: 691 KTRTSVNRKTLKVVRKPI 744
           K     N + + + +  +
Sbjct: 507 KQEPLKNHRIILLAKSRV 524

>Skud_13.366 Chr13 (633641..635425) [1785 bp, 594 aa] {ON} YMR198W
           (REAL)
          Length = 594

 Score = 31.6 bits (70), Expect = 2.4
 Identities = 20/88 (22%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query: 40  VSDEFPKELRTKGQNLKRKILYIASEDEEN-KESDSVINEQDDLTKFTEGIGSKLLDSFL 216
           ++DE  ++L+T+ +++ RK+  + +E+E+N +E ++ +N++  + K T+       D+ +
Sbjct: 208 LTDEM-RQLKTEFEDVNRKLFILQNENEKNCREHENELNKKFGVFKKTKD------DARI 260

Query: 217 EILDNNLGNKYEKISREIYDNNDSWKKN 300
           E+L+     +  K  +E+ + +D  ++N
Sbjct: 261 ELLEEQ--ERLSKTLKELQNTHDKLEEN 286

>NCAS0J01000 Chr10 (166339..168546) [2208 bp, 735 aa] {ON} Anc_4.135
           YLR319C
          Length = 735

 Score = 31.6 bits (70), Expect = 2.5
 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 3/113 (2%)
 Frame = +1

Query: 94  KILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIY 273
           K+    S+ E  + SDS+++  DDL    E +   + D   E        K E + + + 
Sbjct: 504 KVYMEKSQAELGEVSDSLLSRVDDLQDLIEVLRKDVADRGAE----PSKKKLESVQKILE 559

Query: 274 D-NNDSWKKNKLVEMKSPGLIYVSYWKE--EAEKKTCALFLSFMLTEEDFVVD 423
           D  ND  K  K +  + P       WK+  EAE         F+  +ED V+D
Sbjct: 560 DAENDLEKMKKFISTEKP------QWKKIWEAELDKVCEEQQFLTLQEDLVLD 606

>Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {ON}
           complement(86642..88900) [2259 nt, 753 aa]
          Length = 752

 Score = 31.6 bits (70), Expect = 2.5
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)
 Frame = +1

Query: 43  SDEFPKELRTKGQNLKRKILYIASE----DEENKESDSVINEQDDLTKFTEGIGSKLLD 207
           +D + K+L T+   +  +I  I       DEE+ E+  + NE++DL K  E I  KL+D
Sbjct: 279 ADVWRKQLLTEEVKINERIQEIEKLSDEFDEESLETRKLENEREDLEKHLEQISEKLVD 337

>KLLA0F06204g Chr6 (602989..605622) [2634 bp, 877 aa] {ON} similar to
            uniprot|P20095 Saccharomyces cerevisiae YNR011C PRP2
            RNA-dependent ATPase in the DEAH-box family required for
            activation of the spliceosome before the first
            transesterification step in RNA splicing
          Length = 877

 Score = 31.6 bits (70), Expect = 2.5
 Identities = 25/105 (23%), Positives = 47/105 (44%), Gaps = 5/105 (4%)
 Frame = +1

Query: 130  KESDSVINEQDDLTKFTEG-----IGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWK 294
            ++ D ++    +LT+  E      I +K++  F+     N+     K+S++ Y N     
Sbjct: 764  RKQDFLLKHDQNLTQLKENMPRSVIEAKIIKCFISGFPTNIA----KLSKQGYTNI---- 815

Query: 295  KNKLVEMKSPGLIYVSYWKEEAEKKTCALFLSFMLTEEDFVVDDI 429
            K  L     P  +  +  K+E +     L+ S MLT ++F+ D I
Sbjct: 816  KQDLSVSVHPSSVIFNRMKQEGKPMKYILYQSLMLTSKEFIRDCI 860

>NCAS0C01230 Chr3 complement(227981..228568) [588 bp, 195 aa] {ON}
           Anc_8.697 YOR253W
          Length = 195

 Score = 30.8 bits (68), Expect = 2.7
 Identities = 20/66 (30%), Positives = 36/66 (54%)
 Frame = +1

Query: 445 IYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFY 624
           IY+  + + +++R  +LG  L+K + + CQ         + L  I + V ++NKRAIK+Y
Sbjct: 111 IYIETLVVAKEWRSHRLGKLLLKFIEDECQ--------NYFLHNIIVHVSTNNKRAIKWY 162

Query: 625 ERIGMK 642
              G +
Sbjct: 163 FSNGFR 168

>NDAI0F01390 Chr6 (340262..345952) [5691 bp, 1896 aa] {ON} Anc_6.257
          Length = 1896

 Score = 31.6 bits (70), Expect = 2.7
 Identities = 17/62 (27%), Positives = 29/62 (46%)
 Frame = +1

Query: 130 KESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLV 309
           KE D+V + QD L   TE +G        E   N L   + +    ++D++ +W K  L+
Sbjct: 366 KEKDTVKSLQDQLDFLTEELG--------EFFVNGLSTSFSRKKARVFDSSWNWAKQSLL 417

Query: 310 EM 315
            +
Sbjct: 418 HL 419

>YLR453C Chr12 complement(1041799..1042986) [1188 bp, 395 aa] {ON}
           RIF2Protein that binds to the Rap1p C-terminus and acts
           synergistically with Rif1p to help control telomere
           length and establish telomeric silencing; deletion
           results in telomere elongation
          Length = 395

 Score = 31.2 bits (69), Expect = 2.9
 Identities = 23/75 (30%), Positives = 34/75 (45%)
 Frame = +1

Query: 37  IVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFL 216
           ++S    K+L TK    +  IL  A E E  K+          + KFT   GSKLL S+ 
Sbjct: 261 LLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKK----------MIKFTFDSGSKLLQSYN 310

Query: 217 EILDNNLGNKYEKIS 261
            ++   L NK   ++
Sbjct: 311 SLVTCQLNNKESNLA 325

>Smik_7.110 Chr7 (195430..197145) [1716 bp, 571 aa] {ON} YGL160W
           (REAL)
          Length = 571

 Score = 31.2 bits (69), Expect = 3.1
 Identities = 30/100 (30%), Positives = 42/100 (42%), Gaps = 2/100 (2%)
 Frame = +1

Query: 28  FLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESD--SVINEQDDLTKFTEGIGSKL 201
           FL  +S E+ +E R  G           S D+EN E +  S  NE +DL+          
Sbjct: 440 FLVFISGEYSEETRLNGTT--------TSIDDENSEYEMGSFNNEDEDLS---------- 481

Query: 202 LDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKS 321
                 I  NN  N Y   SRE  D + + +   L+E+KS
Sbjct: 482 ------ISKNNSKNAYRNKSRETSD-DPTGENGDLIEVKS 514

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score = 31.2 bits (69), Expect = 3.2
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +1

Query: 94  KILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFL-EILDNNLGN 243
           K  Y  S+DE +   + +INE+   T   E   ++  DS++ E +DNN GN
Sbjct: 520 KKAYNTSDDESSLIKNQLINEEPQSTLKNESESAQRKDSYVQEAIDNNNGN 570

>NDAI0G00500 Chr7 (106930..109815) [2886 bp, 961 aa] {ON} Anc_2.273
           YNL041C
          Length = 961

 Score = 31.2 bits (69), Expect = 3.4
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = +1

Query: 88  KRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKI 258
           K K +    E +E+  +DS+   QD   +F  G+  KLL+  ++ L N++  + E+I
Sbjct: 521 KFKQILQQEEAQEDAHNDSISYLQDKNLEFLTGLDLKLLNEIIQSLSNSIKLRIEQI 577

>YIL126W Chr9 (117992..122071) [4080 bp, 1359 aa] {ON}  STH1ATPase
            component of the RSC chromatin remodeling complex;
            required for expression of early meiotic genes; essential
            helicase-related protein homologous to Snf2p
          Length = 1359

 Score = 31.2 bits (69), Expect = 3.5
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 15/132 (11%)
 Frame = +1

Query: 22   NGFLKIVSDEFPKELRTKGQNLKRK-------ILYIASEDEENKESDSVINEQDDLTKFT 180
            N F   V +E   +  T     KR+       I  + +ED+EN + +S  ++++   K  
Sbjct: 1123 NSFTAAVDEETNADKETTASRSKRRSSRKKRTISIVTAEDKENTQEEST-SQENGGAKVE 1181

Query: 181  EGIGSKLLDSFLEILDNNLGNKYE-------KISR-EIYDNNDSWKKNKLVEMKSPGLIY 336
            E + S    S +EI++ +   K +       K+++  + +NND  +  +  E KSP    
Sbjct: 1182 EEVKS----SSVEIINGSESKKKKPKLTVKIKLNKTTVLENNDGKRAEEKPESKSPA--- 1234

Query: 337  VSYWKEEAEKKT 372
                K+ A KKT
Sbjct: 1235 ----KKTAAKKT 1242

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score = 31.2 bits (69), Expect = 3.5
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
 Frame = +1

Query: 4    ENIEIFNGFLKIVSDEFPKELRT-KGQNLKRKILYIASEDEENK-ESDSVINEQDDLTKF 177
            E I+  N  LK+V+ +   + +T +    ++K+L    ++ E K +S  V+N+ DD+   
Sbjct: 846  EKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQ 905

Query: 178  TEGIGSKLLDSFLEILD 228
            TE +  +L  S +++ D
Sbjct: 906  TEALRMELEKSKIKLQD 922

>Skud_10.9 Chr10 complement(15406..21501) [6096 bp, 2031 aa] {ON}
            YJL207C (REAL)
          Length = 2031

 Score = 31.2 bits (69), Expect = 3.5
 Identities = 20/69 (28%), Positives = 39/69 (56%)
 Frame = -2

Query: 458  SYRYITLNFLMSSTTKSSSVNINDKNKAQVFFSASSFQ*LT*INPGLFISTNLFFFQESL 279
            S+R ITL+ L+S+   SS  +I      ++F + ++F+    +N G+FIS++    + S+
Sbjct: 1134 SFRNITLSLLISNNILSSITSI------KIFENIATFKMNNILNYGIFISSSKSIIKSSI 1187

Query: 278  LSYISREIF 252
            ++ I    F
Sbjct: 1188 VTGIGSSYF 1196

>Smik_10.350 Chr10 (537706..538758) [1053 bp, 350 aa] {ON} YJR060W
           (REAL)
          Length = 350

 Score = 30.8 bits (68), Expect = 3.6
 Identities = 26/82 (31%), Positives = 36/82 (43%)
 Frame = +1

Query: 13  EIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIG 192
           E  N  + I+SD  P    +K   L R   YI    ++ KE+D    E+  L K      
Sbjct: 235 ENINTAINILSDLLPVRESSKAAILARAAEYI----QKLKETDEANIEKWTLQKLLSEQN 290

Query: 193 SKLLDSFLEILDNNLGNKYEKI 258
           +  L S  E L   LGN Y++I
Sbjct: 291 ASQLASANEKLQEELGNAYKEI 312

>NDAI0E03480 Chr5 complement(746985..748274) [1290 bp, 429 aa] {ON}
           Anc_8.429 YLR226W
          Length = 429

 Score = 30.8 bits (68), Expect = 3.9
 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 1/105 (0%)
 Frame = +1

Query: 13  EIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASE-DEENKESDSVINEQDDLTKFTEGI 189
           E+F  + +I+ D F      KG+ L+  +  I S  DEE+K S   + +Q D++ F E  
Sbjct: 323 ELFTDY-RILEDNFFDLKSNKGEKLQISVEAIESIIDEESKHSGDDVLQQSDISSFYEYN 381

Query: 190 GSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSP 324
             K  D   ++LD ++G + E + ++     +S K+N    ++ P
Sbjct: 382 LIKSGDVKQKLLD-HIGTRVEDLIKKTI--AESKKRNSPDSVEPP 423

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score = 30.8 bits (68), Expect = 4.3
 Identities = 19/85 (22%), Positives = 37/85 (43%)
 Frame = +1

Query: 13  EIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIG 192
           +++   L I+  E P+  + K    K K+  +  ++E+  ESD+   E+D+  +    + 
Sbjct: 83  QVYGALLTILKSEHPEPKKQK----KEKVNKVLLDNEQQDESDASEEEEDETQQIENALM 138

Query: 193 SKLLDSFLEILDNNLGNKYEKISRE 267
               D   E  D   G+  E+   E
Sbjct: 139 GSHADDASEDDDKEHGDDNEESDEE 163

>Skud_13.199 Chr13 (339148..339693) [546 bp, 181 aa] {ON} YMR042W
           (REAL)
          Length = 181

 Score = 30.0 bits (66), Expect = 4.5
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%)
 Frame = +1

Query: 37  IVSDEFPKELRTK--GQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEG 186
           +V D    +L T    ++++R    +  +D+E+ E D  + E DD  KF+ G
Sbjct: 12  LVEDSIAGDLETNDPSESVRRLSTPLLEQDQEDDEDDGDVEEDDDNDKFSVG 63

>Smik_3.187 Chr3 (267024..272141) [5118 bp, 1705 aa] {ON} YCR089W
           (REAL)
          Length = 1705

 Score = 30.8 bits (68), Expect = 4.6
 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 11/81 (13%)
 Frame = -2

Query: 473 SINWISYRYITLNFLMSSTTKSSSVN-----INDKNKAQ------VFFSASSFQ*LT*IN 327
           S +WIS   +  NF++S+TT +SS N     +ND   ++       F S SS       +
Sbjct: 168 SHSWISLSSVESNFIISTTTSASSANTGPKSLNDSKSSEAADTITTFLSDSSSS----FS 223

Query: 326 PGLFISTNLFFFQESLLSYIS 264
            G F  T L    E L ++ S
Sbjct: 224 SGSFTQTLLSSLSEPLSNFSS 244

>SAKL0G13134g Chr7 (1127910..1133723) [5814 bp, 1937 aa] {ON}
           similar to uniprot|P19812 Saccharomyces cerevisiae
           YGR184C UBR1 Ubiquitin-protein ligase (E3) that
           interacts with Rad6p/Ubc2p to ubiquitinate substrates of
           the N-end rule pathway binds to the Rpn2p Rpt1p and
           Rpt6p proteins of the 19S particle of the 26S proteasome
          Length = 1937

 Score = 30.8 bits (68), Expect = 4.7
 Identities = 12/46 (26%), Positives = 28/46 (60%)
 Frame = +1

Query: 100 LYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNL 237
           L+  +E+EE +     I + D+L++  E + S++ D F+++ + N+
Sbjct: 177 LHCKAEEEEEEVDSDYIFQSDELSQLFELVLSEVFDHFIDVFNQNI 222

>TDEL0C03780 Chr3 complement(664822..665877) [1056 bp, 351 aa] {ON}
           Anc_1.176 YJL167W
          Length = 351

 Score = 30.4 bits (67), Expect = 4.9
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 8/62 (12%)
 Frame = +1

Query: 202 LDSFLEILDNNL-----GNKYEKISREIYDNNDSWKKNKLVEMKSP---GLIYVSYWKEE 357
           L  + +I D+ L       +  KI  +I DN  SW  NK +++ SP    L+  +Y K++
Sbjct: 231 LGEYFQIQDDYLDCFGTAEQIGKIGTDIQDNKCSWVVNKALQLASPEQRKLLDENYGKKD 290

Query: 358 AE 363
           AE
Sbjct: 291 AE 292

>Skud_10.284 Chr10 (506276..507337) [1062 bp, 353 aa] {ON} YJR060W
           (REAL)
          Length = 353

 Score = 30.4 bits (67), Expect = 4.9
 Identities = 25/82 (30%), Positives = 36/82 (43%)
 Frame = +1

Query: 13  EIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIG 192
           E  N  + ++SD  P    +K   L R   YI    ++ KE+D    E+  L K      
Sbjct: 238 ENINTAINVLSDLLPVRESSKAAILARAAEYI----QKLKETDEANIEKWTLQKLLSEQN 293

Query: 193 SKLLDSFLEILDNNLGNKYEKI 258
           +  L S  E L   LGN Y++I
Sbjct: 294 ASQLASANEKLQEELGNAYKEI 315

>Suva_12.149 Chr12 (226538..227611) [1074 bp, 357 aa] {ON} YJR060W
           (REAL)
          Length = 357

 Score = 30.4 bits (67), Expect = 4.9
 Identities = 25/82 (30%), Positives = 36/82 (43%)
 Frame = +1

Query: 13  EIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIG 192
           E  N  + ++SD  P    +K   L R   YI    ++ KE+D    E+  L K      
Sbjct: 242 ENINTAINVLSDLLPVRESSKAAILARAAEYI----QKLKETDEANIEKWTLQKLLSEQN 297

Query: 193 SKLLDSFLEILDNNLGNKYEKI 258
           +  L S  E L   LGN Y++I
Sbjct: 298 ASQLASANEKLQEELGNAYKEI 319

>TBLA0E04270 Chr5 (1089254..1090384) [1131 bp, 376 aa] {ON} 
          Length = 376

 Score = 30.4 bits (67), Expect = 5.0
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 4/75 (5%)
 Frame = +1

Query: 106 IASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSF--LEILDNNLGNKYEKISRE--IY 273
           +++ED +  E+  +IN+ +    F E +  K +     L+     L  K EK++ E  + 
Sbjct: 5   LSNEDLDTDEAQEIINKINKSKAFLEDLKEKCMKDLKNLQSQQQRLAKK-EKVNTELKVE 63

Query: 274 DNNDSWKKNKLVEMK 318
           DNN +   NK VE K
Sbjct: 64  DNNKNKLNNKTVENK 78

>Kpol_479.14 s479 (28306..28977) [672 bp, 223 aa] {ON}
           (28306..28977) [672 nt, 224 aa]
          Length = 223

 Score = 30.0 bits (66), Expect = 5.2
 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 3/59 (5%)
 Frame = +1

Query: 16  IFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVIN---EQDDLTKFTE 183
           I  GF K+ +++  KELR     L +++  ++ + ++ K+S  ++N   EQD   K  E
Sbjct: 38  INKGFNKVNANDSSKELRILNNELSKELAEVSKKIDQLKQSIKILNRYEEQDKNLKLIE 96

>KNAG0E03390 Chr5 complement(676662..677141) [480 bp, 159 aa] {ON}
           Anc_8.58 YFL017C
          Length = 159

 Score = 29.6 bits (65), Expect = 5.3
 Identities = 35/137 (25%), Positives = 57/137 (41%), Gaps = 6/137 (4%)
 Frame = +1

Query: 250 EKISREIYDNNDSWKKNKLVE--MKSPGLIYVSYWKEEAEKKTCA----LFLSFMLTEED 411
           E ++++ ++N  ++ K +LV   +K+  +  + +   E  +   A    LFL   L    
Sbjct: 32  EPLTKQSFENVVTFWKTQLVRNTIKTYNVYVIVHLDNEGREDGIAAVGTLFLEQKLIHGG 91

Query: 412 FVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQLTV 591
            +V  I   SV         E Y+G  LG  LI  LSNV + A           G    +
Sbjct: 92  GLVGHIEDISVS--------ENYQGKSLGKHLIAHLSNVGRDA-----------GCYKVI 132

Query: 592 FSDNKRAIKFYERIGMK 642
               ++ I FYE+ G K
Sbjct: 133 LDCAEKNIGFYEKCGYK 149

>TBLA0A06330 Chr1 complement(1555490..1557406) [1917 bp, 638 aa]
           {ON} Anc_4.268 YDL074C
          Length = 638

 Score = 30.4 bits (67), Expect = 5.6
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 6/55 (10%)
 Frame = +1

Query: 229 NNLGNKYEKISREIYDNNDSWKKNKLVEMKS--PGLIYVSY----WKEEAEKKTC 375
           N+L +K E++ + +Y  ND+   N+L+E  +    L+Y S     WK  A  KTC
Sbjct: 548 NHLQSKLERLEKSLYSTNDNSPNNQLIEELNNFRNLVYCSLCSKNWKNMA-IKTC 601

>TBLA0C04350 Chr3 complement(1044965..1045714) [750 bp, 249 aa] {ON}
           Anc_4.63 YGR158C
          Length = 249

 Score = 30.0 bits (66), Expect = 5.6
 Identities = 32/137 (23%), Positives = 55/137 (40%), Gaps = 16/137 (11%)
 Frame = +1

Query: 7   NIEIFNGFLKIVSDEFPKELRTKGQNLKRKILYIA----------------SEDEENKES 138
           NI++ NG L+  S    KE+     N+ + ++ +                  E + N++S
Sbjct: 95  NIQLKNGSLEKYSSSQLKEVGNFLTNIFKSVINLPRYAKSGIDIFIYLIYDKEIQSNEKS 154

Query: 139 DSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMK 318
           DS  +    L     GI   L+D+ +EI+D   G  Y              K N    +K
Sbjct: 155 DSTNSITSILPHCITGITLALVDAGIEIIDMAAGGIY--------------KGNVFAFIK 200

Query: 319 SPGLIYVSYWKEEAEKK 369
           S G   + +WK+E  ++
Sbjct: 201 S-GEEIIGFWKDEGNRE 216

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score = 30.4 bits (67), Expect = 5.7
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 4/72 (5%)
 Frame = +1

Query: 49  EFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFT----EGIGSKLLDSFL 216
           + P++ R K + LK KI   + E  +N      + EQ +   FT    +G+   ++D F 
Sbjct: 188 QLPEDKRDKVKQLKIKIAANSLEFSKN------LGEQKEFVAFTKEELDGVSESVMDQFE 241

Query: 217 EILDNNLGNKYE 252
           +  D N   KY+
Sbjct: 242 QFKDENGTTKYK 253

>TDEL0C04170 Chr3 (740380..744582) [4203 bp, 1400 aa] {ON} Anc_2.201
           YNL088W
          Length = 1400

 Score = 30.4 bits (67), Expect = 6.1
 Identities = 26/81 (32%), Positives = 38/81 (46%)
 Frame = +1

Query: 85  LKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISR 264
           LKR   YI S + + ++      E D + + T  I   L   F EIL N   NK    S 
Sbjct: 22  LKRPDTYIGSVESQEQQQWIHDEETDCMIEKTVNIVPGLYKIFDEILVNAADNKVRDPSM 81

Query: 265 EIYDNNDSWKKNKLVEMKSPG 327
           +  + N   +KN L+E+K+ G
Sbjct: 82  KKIEVNIQREKN-LIEVKNDG 101

>Kpol_541.3 s541 complement(7377..11672) [4296 bp, 1431 aa] {ON}
            complement(7377..11672) [4296 nt, 1432 aa]
          Length = 1431

 Score = 30.4 bits (67), Expect = 6.1
 Identities = 17/50 (34%), Positives = 30/50 (60%)
 Frame = -1

Query: 345  ITNVNQSWTLHFN*FVLLPGIIIIVYLSGNLLIFIAKIVI*NFQKTIEQL 196
            +T++  S+ L  N + +L GI++ +Y  GNL+  +A  VI   Q T ++L
Sbjct: 1108 VTHILNSYDLSKNEYSILSGILLEMYHEGNLMPELAAKVILALQGTKDEL 1157

>Ecym_6074 Chr6 (139563..141023) [1461 bp, 486 aa] {ON} similar to
           Ashbya gossypii AFR224C
          Length = 486

 Score = 30.0 bits (66), Expect = 7.0
 Identities = 18/79 (22%), Positives = 38/79 (48%), Gaps = 3/79 (3%)
 Frame = +1

Query: 511 KGLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESR 690
           KG+SN+  ++QV +    P++   L  F+ N++ +   +     +   S  ++ ++I S 
Sbjct: 371 KGISNMLNLSQVVLSLILPIVSAPLVYFTSNRKIMTVVD-----YDESSSPEQTERIGSE 425

Query: 691 KT---RTSVNRKTLKVVRK 738
           +T   R+     T  V+ K
Sbjct: 426 QTERMRSEPTENTSLVLNK 444

>CAGL0C00407g Chr3 (40815..42467) [1653 bp, 550 aa] {ON} similar to
           uniprot|Q12418 Saccharomyces cerevisiae YLR094c GIS3
          Length = 550

 Score = 30.0 bits (66), Expect = 7.2
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +1

Query: 217 EILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSP 324
           +I+D+NL  K + I+ +  D ND WK ++L E+  P
Sbjct: 229 KIIDDNLAPKLKIINIDDLDLNDHWKVDELSEVLPP 264

>Kpol_309.7 s309 complement(13389..16040) [2652 bp, 883 aa] {ON}
           complement(13389..16040) [2652 nt, 884 aa]
          Length = 883

 Score = 30.0 bits (66), Expect = 7.7
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 2/47 (4%)
 Frame = +1

Query: 58  KELRTKGQNLKRKILYIASEDEE--NKESDSVINEQDDLTKFTEGIG 192
           +E+  +G+ L+ KIL I SEDE+  N+ SD   ++ DD     + +G
Sbjct: 471 EEMLKQGEKLREKILDINSEDEDKRNRLSDLEDDDSDDDAAVKDKVG 517

>YPR010C Chr16 complement(577585..581196) [3612 bp, 1203 aa] {ON}
            RPA135RNA polymerase I second largest subunit A135
          Length = 1203

 Score = 30.0 bits (66), Expect = 8.0
 Identities = 22/80 (27%), Positives = 37/80 (46%)
 Frame = +1

Query: 145  VINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSP 324
            +IN+  D   F  G G+      +++  N   N+ + I++     ND W K  L ++   
Sbjct: 788  IINKSADERGF--GYGTMYKTEKVDLALNR--NRGDPITQHFGFGNDEWPKEWLEKLDED 843

Query: 325  GLIYVSYWKEEAEKKTCALF 384
            GL Y+  + EE +   CA F
Sbjct: 844  GLPYIGTYVEEGD-PICAYF 862

>Kpol_1006.9 s1006 (38965..42843) [3879 bp, 1292 aa] {ON}
           (38965..42843) [3879 nt, 1293 aa]
          Length = 1292

 Score = 30.0 bits (66), Expect = 8.0
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 9/100 (9%)
 Frame = +1

Query: 217 EILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCALF---- 384
           E+    LG +YE++   +  + DS+K+      K P L  +  +  E+  K  + +    
Sbjct: 463 EVETTELGLQYEEMKNVLKKHKDSYKEFHSTPDKLPKLDKLDEFNNESFTKMKSSYYLRK 522

Query: 385 LSFMLTEEDFVVDDIRKFS-----VIYLYEIQLIEKYRGC 489
           LS  +T+E+ V D  + +      V+Y Y       YRGC
Sbjct: 523 LSIDITDEEKVTDLAKNYVEGLQWVMYYY-------YRGC 555

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 30.0 bits (66), Expect = 8.0
 Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +1

Query: 79   QNLKRKILYIASEDEENK-ESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEK 255
            + L+  ++ I +  +E + E D ++NE+DDLT   E +  K+ D     ++ ++ N+Y+ 
Sbjct: 1018 ETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKD-----MEESM-NEYKS 1071

Query: 256  ISREIYDNNDSWKKNKLVEMKS 321
               EI        KNKL ++ S
Sbjct: 1072 FEIEI--------KNKLEKLNS 1085

>KLLA0F26312g Chr6 (2438840..2439745) [906 bp, 301 aa] {ON} similar
           to uniprot|P50110 Saccharomyces cerevisiae YMR060C SAM37
           Component of the mitochondrial outer membrane sorting
           and assembly machinery (SAM) complex required for the
           sorting of some proteins to the outer membrane after
           import by the TOM complex
          Length = 301

 Score = 29.6 bits (65), Expect = 8.1
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = +1

Query: 55  PKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLT-KFTEGIGSKL 201
           P   R++ + L R I+    EDEEN   +S  N QD+L+ K TE   SK+
Sbjct: 134 PLSARSRARELCRDIMVTIPEDEEN---ESTSNHQDELSEKATELAQSKV 180

>YJL207C Chr10 complement(41389..47433) [6045 bp, 2014 aa] {ON}
            LAA1AP-1 accessory protein; colocalizes with clathrin to
            the late-Golgi apparatus; involved in TGN-endosome
            transport; physically interacts with AP-1; similar to the
            mammalian p200; may interact with ribosomes; YJL207C is a
            non-essential gene
          Length = 2014

 Score = 30.0 bits (66), Expect = 8.2
 Identities = 27/99 (27%), Positives = 40/99 (40%), Gaps = 1/99 (1%)
 Frame = +1

Query: 88   KRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISRE 267
            KRKI     +        S+ +  D L  FT    S L+  ++  L   +  KY      
Sbjct: 1483 KRKIELAVLDAWAEVVQRSITSSNDALFSFTRKYWSILVPLWIISLREYMMIKYNDNDST 1542

Query: 268  IYDNNDSWKKNKLVEMKSPGL-IYVSYWKEEAEKKTCAL 381
            +   NDS K+N L+E +S  + +Y   W    E   C L
Sbjct: 1543 VQVKNDS-KENSLIEPRSTKIELYEPVWLNFVEALGCTL 1580

>KLLA0D13904g Chr4 complement(1195920..1196236,1196332..1196350)
           [336 bp, 111 aa] {ON} similar to uniprot|P40005 YEL003w
           Saccharomyces cerevisiae GIM4 subunit of the
           heterohexameric cochaperone prefoldin complex
          Length = 111

 Score = 28.5 bits (62), Expect = 8.4
 Identities = 24/112 (21%), Positives = 51/112 (45%), Gaps = 10/112 (8%)
 Frame = +1

Query: 10  IEIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGI 189
           +E  +  L++  +EF   L    + L+ KI+ +  + +E+      +NE D   K    +
Sbjct: 1   MEQASNVLQLKYNEFKGTL----EELQSKIIELGRDKDEHDIVLKTLNETDPERKCYRMV 56

Query: 190 GSKLLD----SFLEILDNNLGNKYEKISR------EIYDNNDSWKKNKLVEM 315
           GS L+D    + + +L NN     + +S       +  +  + WKK+  +++
Sbjct: 57  GSALVDTDVKTTIPVLQNNRDKLEQTVSTLKGQLIKTAEEFEKWKKDNKIQV 108

>Ecym_7375 Chr7 (782285..783577) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii ACL118C
          Length = 430

 Score = 29.6 bits (65), Expect = 9.1
 Identities = 27/101 (26%), Positives = 47/101 (46%), Gaps = 8/101 (7%)
 Frame = +1

Query: 88  KRKILYIASEDEE--NKESDSVINEQDDLTKF-----TEGIG-SKLLDSFLEILDNNLGN 243
           + KI Y+A +D    + +SD +     ++ KF     TEGI  S ++   ++  D  L  
Sbjct: 231 QHKIDYVAHDDIPYVSADSDDIYKPIKEMGKFLTTQRTEGISTSDIITKIIKDYDKYLMR 290

Query: 244 KYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEK 366
            + + +    + N SW K   +E K     + SY+K+  EK
Sbjct: 291 NFARGATR-QELNVSWLKKNELEFKKHIQDFRSYFKKNQEK 330

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 29.6 bits (65), Expect = 9.8
 Identities = 19/58 (32%), Positives = 27/58 (46%)
 Frame = +1

Query: 115 EDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDS 288
           +DEE +E +    E+D+LTK    +  K      E  D N  NK +K  +    NN S
Sbjct: 510 DDEEEEEEEE--EEEDELTKILASLTEKKFQVSDEEEDWNTNNKNKKKKKSKKQNNKS 565

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,479,694
Number of extensions: 1620565
Number of successful extensions: 6584
Number of sequences better than 10.0: 88
Number of HSP's gapped: 6509
Number of HSP's successfully gapped: 88
Length of query: 257
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 150
Effective length of database: 41,212,137
Effective search space: 6181820550
Effective search space used: 6181820550
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 33 (17.3 bits)