Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A018502.532ON25625613260.0
NCAS0D026402.532ON2602715404e-68
NDAI0I022702.532ON2772764816e-59
KNAG0C058202.532ON2712694033e-47
TPHA0C041802.532ON2642604014e-47
Skud_13.2252.532ON2542673865e-45
Smik_13.2482.532ON2552703857e-45
SAKL0A09460g2.532ON2402523812e-44
CAGL0K02981g2.532ON2782813607e-41
YMR069W (NAT4)2.532ON2852663591e-40
TDEL0A030602.532ON2442313185e-35
TBLA0G022202.532ON2782753181e-34
Kpol_1018.342.532ON2922833007e-32
Suva_13.2442.532ON2572202786e-29
ZYRO0B01980g2.532ON1881572683e-28
KLTH0D06820g2.532ON2602442639e-27
Kwal_26.80162.532ON2402492262e-21
KLLA0E18569g2.532ON2152021206e-07
Ecym_72562.532ON2432381128e-06
Agos_YGOB_Anc_2.5322.532ON187145910.003
KLLA0A12089gsingletonON18168740.42
KLTH0D11748g8.697ON16270720.56
NDAI0H019907.17ON116171750.62
NCAS0B018008.604ON79156740.66
NCAS0C012308.697ON19574701.3
Smik_7.1656.145ON62347693.1
CAGL0H06281g7.88ON60665683.5
KLLA0F26312g2.626ON30150673.8
KNAG0E033908.58ON159137664.1
TBLA0A058401.127ON2023138684.5
Suva_7.1586.145ON62247674.7
KAFR0C033208.113ON1206187675.0
YPR010C (RPA135)8.113ON1203154666.4
KLLA0C09845g8.697ON16365637.8
NDAI0C01310na 1ON265182648.5
YGL110C (CUE3)6.145ON62444659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A01850
         (256 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   515   0.0  
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   212   4e-68
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   189   6e-59
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...   159   3e-47
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...   159   4e-47
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...   153   5e-45
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...   152   7e-45
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   151   2e-44
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   143   7e-41
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...   142   1e-40
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...   127   5e-35
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...   127   1e-34
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...   120   7e-32
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...   111   6e-29
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...   107   3e-28
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...   105   9e-27
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    92   2e-21
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    51   6e-07
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    48   8e-06
Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...    40   0.003
KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} simil...    33   0.42 
KLTH0D11748g Chr4 (960571..961059) [489 bp, 162 aa] {ON} similar...    32   0.56 
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    33   0.62 
NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {O...    33   0.66 
NCAS0C01230 Chr3 complement(227981..228568) [588 bp, 195 aa] {ON...    32   1.3  
Smik_7.165 Chr7 complement(296887..298758) [1872 bp, 623 aa] {ON...    31   3.1  
CAGL0H06281g Chr8 (620236..622056) [1821 bp, 606 aa] {ON} highly...    31   3.5  
KLLA0F26312g Chr6 (2438840..2439745) [906 bp, 301 aa] {ON} simil...    30   3.8  
KNAG0E03390 Chr5 complement(676662..677141) [480 bp, 159 aa] {ON...    30   4.1  
TBLA0A05840 Chr1 complement(1440357..1446428) [6072 bp, 2023 aa]...    31   4.5  
Suva_7.158 Chr7 complement(296305..298173) [1869 bp, 622 aa] {ON...    30   4.7  
KAFR0C03320 Chr3 complement(675037..678657) [3621 bp, 1206 aa] {...    30   5.0  
YPR010C Chr16 complement(577585..581196) [3612 bp, 1203 aa] {ON}...    30   6.4  
KLLA0C09845g Chr3 complement(850737..851228) [492 bp, 163 aa] {O...    29   7.8  
NDAI0C01310 Chr3 complement(268904..269701) [798 bp, 265 aa] {ON}      29   8.5  
YGL110C Chr7 complement(301537..303411) [1875 bp, 624 aa] {ON}  ...    30   9.9  

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  515 bits (1326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/256 (100%), Positives = 256/256 (100%)

Query: 1   MENIEIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFT 60
           MENIEIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFT
Sbjct: 1   MENIEIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFT 60

Query: 61  EGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEA 120
           EGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEA
Sbjct: 61  EGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEA 120

Query: 121 EKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIA 180
           EKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIA
Sbjct: 121 EKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIA 180

Query: 181 QVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKT 240
           QVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKT
Sbjct: 181 QVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKT 240

Query: 241 LKVVRKPIYYLLYLPV 256
           LKVVRKPIYYLLYLPV
Sbjct: 241 LKVVRKPIYYLLYLPV 256

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  212 bits (540), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 130/271 (47%), Positives = 167/271 (61%), Gaps = 31/271 (11%)

Query: 4   IEIFNGFLKIVSDEFPKELRTKGQN----LKRKILYIASEDEENKESDSVINEQDDL-TK 58
           +  F  F  ++ +EFP  L    Q     LKRKIL I     E     S  N QD +  K
Sbjct: 1   MHAFEAFSHMILEEFPLTLEVTLQEQLKCLKRKILII-----EPDNCTSGKNSQDVVYMK 55

Query: 59  FTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKE 118
            +   G K+LD FL+ILD NLG KY K+S++IY+N   WK NKL EM+SPGL+YVSYW E
Sbjct: 56  CSTDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDE 115

Query: 119 EAEKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQ 178
           E+++    LFLSFMLTEED   +D +  SV+YLYEIQ++   R  +LGTRL   L+   Q
Sbjct: 116 ESDEP--MLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRL---LAEHLQ 170

Query: 179 IAQVKIRP------AFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKT 232
            A  ++R        +PLIGI+LTVFSDN+ AIKFY+ IGM+ T  SP+D V  +E R+T
Sbjct: 171 DACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRT 230

Query: 233 R-------TSVNRKTLKVVRKPIYYLLYLPV 256
           R       TSV R    +V+KPIYYL YLP+
Sbjct: 231 RGMAQNISTSVGR---TIVQKPIYYLFYLPL 258

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  189 bits (481), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 121/276 (43%), Positives = 160/276 (57%), Gaps = 34/276 (12%)

Query: 8   NGFLKIVSDEFPKELRTKG--QNLKRKILYIASEDEEN---KESDSVINEQDDLTKFTEG 62
           +  L IV +EFP  L++       +R+I +  S DE +   + S  V N   D  +    
Sbjct: 7   DALLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQQ---- 62

Query: 63  IGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEK 122
             S +L+ FL ILD NLG KY K+S+ IY+N+ SWK NKL EM SPGLIYVSYW E+ ++
Sbjct: 63  -RSDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQE 121

Query: 123 KTCALFLSFMLTEEDFVV------DDIRK-----FSVIYLYEIQLIEKYRGCQLGTRLIK 171
               LFLSFMLTE D  +      DD  +      SVIYLYEIQ++ + RG  +GT+L+ 
Sbjct: 122 P--LLFLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLS 179

Query: 172 -GLSNVCQIAQVKIRPAF---PLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKI 227
             L   C     K    F   PL+GI+LTVFSDN +AI FY+ IGMK T  SP DEV +I
Sbjct: 180 VHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQI 239

Query: 228 ESRKTR-------TSVNRKTLKVVRKPIYYLLYLPV 256
           E R+TR             T ++++KP+YYL YLP+
Sbjct: 240 EKRQTRNLRRINNAGTREVTKQIIKKPVYYLYYLPI 275

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score =  159 bits (403), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 104/269 (38%), Positives = 152/269 (56%), Gaps = 32/269 (11%)

Query: 10  FLKIVSDEFPK----ELRTKGQNLKRKILYIASEDEENKESDSVI------------NEQ 53
           FL+ V  +FP     +L     +LKR+I YI    +++ ES + I               
Sbjct: 9   FLQTVDRQFPTVIGCDLNGTAVSLKRRIHYIEGVGDDDDESHNKIMSYPGGLPPLPPTTD 68

Query: 54  DDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYV 113
           D+ T   +    + L  FLEILDNNLG  Y ++SR+IY N+  W++NK +EM S  L+YV
Sbjct: 69  DNPTAKEDNTCERCLRIFLEILDNNLGPVYARLSRKIYGNSKHWRENKWLEMLSAQLVYV 128

Query: 114 SYWKEEAEKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGL 173
           SYW  ++E     L+ SFMLTEE+ +        V+YLYEIQLIE  R  +LG  ++  L
Sbjct: 129 SYWVSDSEP---VLYTSFMLTEENGISSIESTDRVVYLYEIQLIEAIRRQKLGQAIVSYL 185

Query: 174 SNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKT- 232
           +  C +   ++        + LTVFSDN++A+KFYER+   +T  SP+DEV +   R+T 
Sbjct: 186 TE-CALESPEV------AAVALTVFSDNEKALKFYERLNFTYTIDSPRDEVTEKPRRRTA 238

Query: 233 -RTSVN---RKTLKV-VRKPIYYLLYLPV 256
            RT+++      +KV ++KP YYLLYL V
Sbjct: 239 ARTALDPARDSDVKVTIKKPTYYLLYLEV 267

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score =  159 bits (401), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 111/260 (42%), Positives = 147/260 (56%), Gaps = 15/260 (5%)

Query: 10  FLKIVSDEFPKELRTKGQ--NLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKL 67
           F+KIV   +P E+        L +KI+ + SE E+ K S  + N +       +      
Sbjct: 7   FVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDIKNSAELYNGRYLTYSQNKEECEIE 66

Query: 68  LDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCAL 127
               L ILDNNLG+ Y   ++++Y N+  WK+NK+ EMK+ GLIYV Y  E+ EKKT +L
Sbjct: 67  FSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLED-EKKTVSL 125

Query: 128 FLSFMLTEEDFVVDDIRKFS-VIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRP 186
           +LSF LT+E   + DI  FS VIYLYEIQL  + R   LGT+LI G    C +  V    
Sbjct: 126 YLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDC-LVDVHENI 184

Query: 187 AFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESR-KTRTSVNR------- 238
              +IGI+LTVFSDN  AI+FYE IGMK T  SP D+      R KTR+  +        
Sbjct: 185 HKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIKTRSQNSSKKGSSSD 244

Query: 239 --KTLKVVRKPIYYLLYLPV 256
              +L VV+KP YYL YLP+
Sbjct: 245 KPTSLSVVKKPDYYLYYLPL 264

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score =  153 bits (386), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 106/267 (39%), Positives = 139/267 (52%), Gaps = 30/267 (11%)

Query: 6   IFNGFLKIVSDEFPKELRTKGQN----------LKRKILYIASEDEENKESDSVINEQDD 55
           +F  FL I  DEFP+ L     N          LKR+I+YI    EEN E DS+   Q  
Sbjct: 1   MFKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIP---EENGEVDSIDGPQCT 57

Query: 56  LTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSY 115
                +  G  +LDS ++++D +LG+KY + SR +Y N   WK NKL EMKS GL+YVSY
Sbjct: 58  NYNLHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSY 117

Query: 116 WKEEAEKKTCALFLSFMLTEEDFVV--DDIRKFS--VIYLYEIQLIEKYRGCQLGTRLIK 171
           W   A       F SFMLTEE  +V  D   + S  VIYLYEI +   +RG  LG RL++
Sbjct: 118 WGNGA----LGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLE 173

Query: 172 GLSNVCQ-IAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESR 230
               +C+ +A+   R      G+ LTVF DN RA + YE IG  F              R
Sbjct: 174 --RALCEGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIG--FCRAPGSPAPAAPALR 229

Query: 231 KTRTSVNRKTLKVVRKPIYYL--LYLP 255
            TR    RK + V R P+YY+  L++P
Sbjct: 230 PTRHG--RKRVVVARDPLYYVYCLHMP 254

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score =  152 bits (385), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 102/270 (37%), Positives = 146/270 (54%), Gaps = 35/270 (12%)

Query: 6   IFNGFLKIVSDEFPKEL---RTKGQN-------LKRKILYIASED---EENKESDSVINE 52
           +F+ FLKI   +FP+ L    T G N       LKR++L+I   D   ++N E  + +N 
Sbjct: 1   MFHQFLKICMQDFPETLEYTNTDGNNGTATTTVLKREMLFIPEGDSNSQDNIEIPTCVN- 59

Query: 53  QDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIY 112
                +  +  G+ +LDS ++++D +LG KY + SR +Y N   WK NKL EMKSP L+Y
Sbjct: 60  ----YRLHKSRGNHILDSCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVY 115

Query: 113 VSYWKEEAEKKTCALFLSFMLTEEDFVV--DDIRKFS--VIYLYEIQLIEKYRGCQLGTR 168
           VSYW   A     A F SFMLTEE  +V  D   + S  VIYLYE+ +   +RG  +G R
Sbjct: 116 VSYWDNGA----LAAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRR 171

Query: 169 LIKGLSNVCQIAQVKIRPAF-PLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKI 227
           L++    +C+     +R  +    G+ LTVFSDN RA + YE +G     GSP       
Sbjct: 172 LLE--RALCEGVARHVRCLYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSPA--AGAP 227

Query: 228 ESRKTRTSVNRKTLKVVRKPIYYL--LYLP 255
            +R TR    R  + V R P+YY+  L++P
Sbjct: 228 TTRPTRHGGER--VVVPRDPLYYVYCLHMP 255

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  151 bits (381), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 141/252 (55%), Gaps = 21/252 (8%)

Query: 8   NGFLKIVSDEFPKELRTKGQNLK-RKILYIASEDEENKESDSVINEQDDLTKFTEGIGSK 66
           N  L  V D FP  +  K  +L  RK+L I         S  V     D         + 
Sbjct: 7   NVLLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQVCTWSGDRQS-----SNS 61

Query: 67  LLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCA 126
           LL  FL++LD NLG+KY  +S  +Y N  SW +NKL EM++ GL+YV Y+    +  +  
Sbjct: 62  LLIQFLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYF----QGVSPL 117

Query: 127 LFLSFMLTEE-DFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKG-LSNVCQIAQVKI 184
           +FLSF+LT+E DF+ D ++   V+YLYEIQL+ + +G +LGT++++  L N    +  ++
Sbjct: 118 MFLSFLLTDEPDFLPDPVK---VVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVH-SLSRL 173

Query: 185 RPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKTLKVV 244
            P   L GI+LTVFSDN  A+  Y  IGM    GSP DE+     R+TR S     L+ V
Sbjct: 174 DPL--LKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEI-ATSQRRTRHSTTD--LQTV 228

Query: 245 RKPIYYLLYLPV 256
            +P YYL++LPV
Sbjct: 229 SRPDYYLMFLPV 240

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  143 bits (360), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 103/281 (36%), Positives = 149/281 (53%), Gaps = 29/281 (10%)

Query: 1   MENIEIF-----NGFLKIVSDEFPKELRTKGQ--------NLKRKILYIASEDE--ENKE 45
           M N E++     + FL  V D FPK + TK           L+RK+L I  +D    NK 
Sbjct: 1   MTNNELYGTNVNDSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANK- 59

Query: 46  SDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEM 105
             ++ NE    +K  +     +L S LE+LD NLG KYE  S+E+Y N   WK+NK+ EM
Sbjct: 60  --ALTNEVVLRSKHIKE-SKNILSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEM 116

Query: 106 KSPGLIYVSYW-KEEAEKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQ 164
            + G+IYVSYW K + E     LFLSFMLTEE+ +  +    SVI+LYEIQ+ ++ R   
Sbjct: 117 NTEGMIYVSYWTKVDDEHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQG 176

Query: 165 LGTRLIKGLSNVCQ---IAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPK 221
           LG   +      C    +    +   FP  GI+LTVF+DN  AI  Y+++GM  T  SPK
Sbjct: 177 LGQYFLSNCLFQCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPK 236

Query: 222 D---EVDKIESRKTRTSVNRKTLK---VVRKPIYYLLYLPV 256
           D   + +     +    +N K      +++KP+YY+ + P+
Sbjct: 237 DVLYDQNTRRRTRNSRKINNKNESPRILIKKPLYYMYWKPI 277

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score =  142 bits (359), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/266 (35%), Positives = 142/266 (53%), Gaps = 28/266 (10%)

Query: 6   IFNGFLKIVSDEFPKELRTKGQN---------LKRKILYIASEDEENKESDSVINEQDDL 56
           +F  FL +  ++FP+ +  K  +         L+R+I+YI  +D ++   DSV + +   
Sbjct: 32  MFQHFLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDS--IDSVDSLKCIN 89

Query: 57  TKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYW 116
            K  +  G ++LD+ ++++D +LG KY + SR +Y N   WK NKL EMKS GL+YV YW
Sbjct: 90  YKLHKSRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYW 149

Query: 117 KEEAEKKTCALFLSFMLTEEDFVV--DDIRKFS--VIYLYEIQLIEKYRGCQLGTRLIKG 172
               +      F SFMLTEE  +V  D + + S  VIYLYE+ +   +RG  +G RL++ 
Sbjct: 150 ----DNGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLE- 204

Query: 173 LSNVCQ-IAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRK 231
              +C  +A+   R      G+ LTVFSDN RA + YE +G     GSP      I  R 
Sbjct: 205 -HALCDGVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTI--RH 261

Query: 232 TRTSVNRKTLKVVRKPIYYL--LYLP 255
           TR    R  +     P+YY+  L++P
Sbjct: 262 TRHGGGRVVVPC--DPLYYVYCLHMP 285

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score =  127 bits (318), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 115/231 (49%), Gaps = 21/231 (9%)

Query: 5   EIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIG 64
           E  N  +K  +  FP  +   G  L RK+L I +E E   E+D  I+      +      
Sbjct: 4   ESLNDVVKYANQNFPTTINAAGIQLTRKLLAIDTE-EYPVETDQCISYVHSPRE-----A 57

Query: 65  SKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSY--------W 116
            KLL   LEILD NLG KY   SR +Y N   W+ NK  EM +PGL+YV Y         
Sbjct: 58  EKLLWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTAT 117

Query: 117 KEEAEKKTCALFLSFMLTEEDFVV--DDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLS 174
           +      +  LFLSFMLTEED +V  D    ++V+YLYE+QL+ + R   L  RL+    
Sbjct: 118 QRRNAPFSPLLFLSFMLTEEDGLVADDPTEVWTVLYLYELQLLPRVRRLGLAARLLGDHL 177

Query: 175 NVC--QIAQVKIRPAFP---LIGIQLTVFSDNKRAIKFYERIGMKFTYGSP 220
             C  Q+        F      G++LTVF+DN  AI+ YE +GM+    SP
Sbjct: 178 AQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP 228

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score =  127 bits (318), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 93/275 (33%), Positives = 149/275 (54%), Gaps = 30/275 (10%)

Query: 10  FLKIVSDEFPKELRTK-GQNLKRKILYIASEDEENKESDSVINEQDDLTKF------TEG 62
            +++V + FPK + TK G  L+RKI  I   +  +  SD   N  DD   +         
Sbjct: 6   LVQLVDNAFPKSISTKQGITLERKIYIIGDSENNSLLSDQNNNSNDDEIYWYFKDRKNPT 65

Query: 63  IGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEK 122
           + + +     +++D NLG  Y+K S++IY+N+  W  NK  EM +  +IY++YW  + ++
Sbjct: 66  VENIIKTQIFQLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITYW--DCKQ 123

Query: 123 KTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQV 182
            + ALFLS +  EE +++++  +  V+YLYEI + ++Y+   +G RLIK       I  +
Sbjct: 124 NSVALFLSILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPL 183

Query: 183 KI-RPAFPLIGIQLTVFSDNKRAIKFY-ERIGMKFTYGSPKDEVDKIESRKTRT------ 234
           KI R     IG++LTVFS+N  A  FY  +I M++T+GSP+DE+  +  R TR+      
Sbjct: 184 KIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSFDEKLG 243

Query: 235 ---------SVNRKT----LKVVRKPIYYLLYLPV 256
                    S+N K      K +RKP YY+L  PV
Sbjct: 244 EHCEDNKLPSLNDKKKQLYRKSIRKPEYYILVFPV 278

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score =  120 bits (300), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 148/283 (52%), Gaps = 44/283 (15%)

Query: 9   GFLKIVSDEFPKELRTKGQN---------LKRKILYIASEDEENKESDSVINEQDDLTKF 59
             + +  + FP+ L     N         L R+++ I S++ +    ++V++   D  K 
Sbjct: 6   HLVDVAENIFPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNVLSYYKDNVK- 64

Query: 60  TEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEE 119
                  +L+  L+ILDNNLG  Y + S +IY N   WK+NK+VEMKS GL+YV Y   +
Sbjct: 65  ----CDVVLNKLLDILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIY--ND 118

Query: 120 AEKKTCALFLSFMLTEEDFVV----DDIRKFS-----VIYLYEIQLIEKYRGCQLGTRLI 170
              K   LF+SFM+T++  +V    +D  + S     VIYLYEIQL+E  R  +LGT LI
Sbjct: 119 DITKEPLLFMSFMITDDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTILI 178

Query: 171 KG-LSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIES 229
              L    +I     +    +I ++LTVFS+N  AI FY++IGM +T  SP+D++   + 
Sbjct: 179 TNYLKKTIEILNKDYQKN--IIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQK 236

Query: 230 RKTRTSV-------NRKTLKVVRKPI---------YYLLYLPV 256
           R+TR++        N  + ++              YYLL+LP+
Sbjct: 237 RRTRSTTIALESKNNEPSSRLTTSKPIKKIIKKPDYYLLFLPI 279

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score =  111 bits (278), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 72/220 (32%), Positives = 111/220 (50%), Gaps = 23/220 (10%)

Query: 6   IFNGFLKIVSDEFPKELRTKGQN----------LKRKILYIASEDEENKESDSVINEQDD 55
           +F  FL I  +EFP+ L   G +          L+R+++Y+    E++ +   +   +  
Sbjct: 1   MFQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMP---EDDGDDGGIDTPECM 57

Query: 56  LTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSY 115
             K  +  G + L S ++++D +LG KY + SR +Y N   WK NKL EMKS GL+YV Y
Sbjct: 58  NYKLHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCY 117

Query: 116 WKEEAE-KKTCALFLSFMLTEEDFVVD----DIRKFSVIYLYEIQLIEKYRGCQLGTRLI 170
           W  +A+ ++    F SFMLTEE  +V+      +   VIYLYE+    +      G    
Sbjct: 118 WGNDAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHR----GRGLGRR 173

Query: 171 KGLSNVCQIAQVKIRPAF-PLIGIQLTVFSDNKRAIKFYE 209
                +C+    ++R     L G+ LTVF DN RA + YE
Sbjct: 174 LLAKALCEGVAARVRRTCDDLFGVALTVFGDNTRARRLYE 213

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score =  107 bits (268), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 61/157 (38%), Positives = 89/157 (56%), Gaps = 11/157 (7%)

Query: 66  KLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTC 125
           K+L+  L++++ NLG+ Y K ++ IY NN  W+ NK  EM S  L +VSYW  E+ +  C
Sbjct: 19  KILEKQLQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSYWNVESNELVC 78

Query: 126 ALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIR 185
             F S M  EE  V  ++   ++IYLYEI +  ++R  + G  ++  L       + K+ 
Sbjct: 79  --FCSIMPCEESIVEGEMS--NIIYLYEIHVAPEWRNQKFGKSILNAL-------KEKLC 127

Query: 186 PAFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKD 222
           P   L GI+LTVFS N+RAI FY   G   +Y SP D
Sbjct: 128 PKAHLSGIELTVFSSNERAINFYRNNGFTLSYDSPSD 164

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score =  105 bits (263), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 122/244 (50%), Gaps = 27/244 (11%)

Query: 27  QNLKRKILYI---ASEDEENKESDSV----------INEQDDLTKFTEGIGSKLLDSFLE 73
           Q L R +  I   A++ EE +E  +            +E D + +      + LLD  L 
Sbjct: 28  QQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASECDSVPRPP----ADLLDQLLS 83

Query: 74  ILDNNLGNKYEKISREIYD-NNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCALFLSFM 132
           ++  NLG  Y + +R IY     SW   K  EM++PGL+YV Y    ++     +F+S +
Sbjct: 84  LVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSDSHSQPL---VFMSLL 140

Query: 133 LTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIG 192
           LT+E  +  ++    V+YL+EI + +  RG  LGT L++        +  +  P+  ++G
Sbjct: 141 LTDEPELGQELAA-RVLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLASLSRASPS--VLG 197

Query: 193 IQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKTLKVVRKPIYYLL 252
            +LTVFS+N+RA++ Y  +GM     SP+D   ++  R    + +     +V +P YY+L
Sbjct: 198 AELTVFSENQRALRLYLALGMHVAAWSPQDRRAQVRRRTRAIAYDS---SLVTRPAYYIL 254

Query: 253 YLPV 256
           + P 
Sbjct: 255 FWPA 258

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 91.7 bits (226), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/249 (32%), Positives = 125/249 (50%), Gaps = 31/249 (12%)

Query: 14  VSDEFPKELR-TKGQNLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFL 72
           V+D FP  L    GQ ++R +  +                 D +    E     LL+  L
Sbjct: 13  VTDSFPTTLTLASGQRIQRAVYGV---------------PMDTVRSRAEIPDPCLLEQLL 57

Query: 73  EILDNNLGNKYEKISREIY-DNNDSWKKNKLVEMKSPGLIYVSYW---KEEAEKKTCALF 128
            ++D+NLG  Y + ++ +Y D   SWK+ K  EM +PGL+YV Y    +E  ++     F
Sbjct: 58  ALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEGLPLAF 117

Query: 129 LSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIK-GLSNVCQIAQVKIRPA 187
           LS +LT+E  +       +V+YL EI + +  RG  LG  L++ G++   + A    R A
Sbjct: 118 LSLLLTDEPEL--GPAPAAVVYLMEIHVADIIRGLGLGGTLLREGVAGTVRGA----RRA 171

Query: 188 FPLI-GIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKTLKVVRK 246
            P I G +LTVF+DN+ A++ Y R+GM+    SP+D   ++     RT   R   + V +
Sbjct: 172 HPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVHR---RTRATRYESRKVTR 228

Query: 247 PIYYLLYLP 255
           P YYLL+ P
Sbjct: 229 PTYYLLFWP 237

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 90/202 (44%), Gaps = 22/202 (10%)

Query: 27  QNLKRKILYIASEDEENKESDSVINEQDDLTKFTEG--IGSKLLDSFLEILDNNLGNKYE 84
           +NL+R    +  E     +SD V     +     +   +GS L    L I+  NL   YE
Sbjct: 7   RNLRRVAGVLCQELNSTGDSDVVCEVFSNRVHSGDPNYLGSTL-PKCLAIIKQNLSTFYE 65

Query: 85  KISREIYD--------NNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCALFLSFMLTEE 136
                IY+         N+ W + K  EM    L+Y+  +K +  K     F S  L++ 
Sbjct: 66  LHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRDTTKIVG--FTSVALSDP 123

Query: 137 DFVVDDIRKFS--VIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQ 194
                D  K +   ++LYEI L+ +Y+   LG+ +  GL  +  +A+    P+     I+
Sbjct: 124 LNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGL--LIPLARDLTCPS-----IE 176

Query: 195 LTVFSDNKRAIKFYERIGMKFT 216
           L VF+ N  A ++Y+R+G + T
Sbjct: 177 LCVFTANDVACRWYKRLGFQLT 198

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 99/238 (41%), Gaps = 64/238 (26%)

Query: 14  VSDEFPKELRTK-GQNLKRKI-----LYIASEDEENKESDSVINEQDDLTKFTEGIGSKL 67
           ++D FP++L  + G  L R I     L +A+  +  K+  ++I               + 
Sbjct: 12  INDAFPEQLACRNGCTLSRDIIITDRLSVAARQKFAKQLTAIIE--------------RT 57

Query: 68  LDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCAL 127
           L  F ++  + L   Y +++R     +  W+ +K  E++  G  +V Y KE       A 
Sbjct: 58  LGCFYDVHAHLL---YPRLTR-----SRPWQAHKRAELQGLGTCHVLYRKENPGGAI-AG 108

Query: 128 FLSFMLTEEDF------------VVDDIRKFS------------------VIYLYEIQLI 157
           F+S +  +E                +  R  S                  V+Y+ EI + 
Sbjct: 109 FVSLLFCDEPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVMEIHVS 168

Query: 158 EKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFP-LIGIQLTVFSDNKRAIKFYERIGMK 214
             ++   LG+ ++     + Q     ++P+FP L G++LTVF+ N++A+  Y R G K
Sbjct: 169 PSFQNQGLGSCMLLCARQLVQ----HMQPSFPQLKGLELTVFTGNRQALALYRRQGFK 222

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 63/145 (43%), Gaps = 22/145 (15%)

Query: 73  EILDNNLGNKYEKISREIYD---NNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCALFL 129
            ++   L   Y   +R +Y    +  +W + K  E+  P  +++ Y ++ A +  C  F+
Sbjct: 46  ALVAAGLAPLYRAHARLLYPRLRDPAAWPRCKRAELLDPAALHILY-RDPAGRLAC--FI 102

Query: 130 SFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFP 189
           S +L       D      V+Y+ E+ +   +R         +GL+     A  +   A  
Sbjct: 103 SLLLPGP---AD-----PVLYILELHVAAPFRR--------RGLAAALLDAATRTARAAG 146

Query: 190 LIGIQLTVFSDNKRAIKFYERIGMK 214
           L  ++LTVF+ N+ A+  Y R G +
Sbjct: 147 LTRLELTVFTANRPALALYARAGFR 171

>KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} similar
           to uniprot|Q5WCY3 Bacillus clausii ABC3243 paiA
           Septation and degradation transcriptional repressor of
           sporulation
          Length = 181

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 149 IYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFY 208
           + L  I +++KY+G  LG  L+  + ++ Q        ++    I L V+  N++AI FY
Sbjct: 100 VELQRIYILQKYQGKGLGRVLMDKVHDIAQ--------SYGKKKIWLGVWEHNQKAIDFY 151

Query: 209 ERIGMKFT 216
           ++ G + T
Sbjct: 152 KKFGFEIT 159

>KLTH0D11748g Chr4 (960571..961059) [489 bp, 162 aa] {ON} similar to
           uniprot|Q08689 Saccharomyces cerevisiae YOR253W NAT5
           Subunit of the N-terminal acetyltransferase NatA (Nat1p
           Ard1p Nat5p) N-terminally acetylates many proteins which
           influences multiple processes such as the cell cycle
           heat-shock resistance mating sporulation and telomeric
           silencing
          Length = 162

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 8/70 (11%)

Query: 145 KFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRA 204
           K S +Y+    ++E YRG  +G++L+K +   C+        A     I + V  DN++ 
Sbjct: 75  KASGVYIQIFAVLENYRGKGVGSQLLKFVEEQCK--------AHFQHNIYVHVAVDNEKG 126

Query: 205 IKFYERIGMK 214
           I++Y+R G +
Sbjct: 127 IQWYQRKGFE 136

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {ON}
           Anc_7.17
          Length = 1161

 Score = 33.5 bits (75), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 137 DFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRP---AFPLIGI 193
           DF +DDI +     LYE + IE+Y+  Q  T +   + +  Q +QV + P     PL   
Sbjct: 928 DFTMDDITELRQKILYESEGIERYQRKQKPTNMDNTMISTNQSSQVSLNPPQTTMPLQQQ 987

Query: 194 QLTVFSDNKRA 204
           Q T  ++N  +
Sbjct: 988 QETPMNNNSPS 998

>NCAS0B01800 Chr2 complement(296677..299052) [2376 bp, 791 aa] {ON}
           Anc_8.604 YOR195W
          Length = 791

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 7/56 (12%)

Query: 49  VINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDN----NDSWKKN 100
           +  E+DDLT+  + + +K+ +S  EIL   + N+ +KI +E YDN    ND+W+ N
Sbjct: 331 ITQERDDLTEKRDKLKAKIKNSKDEIL---MLNQNQKILQEKYDNLSNENDTWRNN 383

>NCAS0C01230 Chr3 complement(227981..228568) [588 bp, 195 aa] {ON}
           Anc_8.697 YOR253W
          Length = 195

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 13/74 (17%)

Query: 149 IYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFY 208
           IY+  + + +++R  +LG  L+K + + CQ         + L  I + V ++NKRAIK+Y
Sbjct: 111 IYIETLVVAKEWRSHRLGKLLLKFIEDECQ--------NYFLHNIIVHVSTNNKRAIKWY 162

Query: 209 -----ERIGMKFTY 217
                 ++G + T+
Sbjct: 163 FSNGFRQVGAELTH 176

>Smik_7.165 Chr7 complement(296887..298758) [1872 bp, 623 aa] {ON}
           YGL110C (REAL)
          Length = 623

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%)

Query: 12  KIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTK 58
           K++S+  P ELR K      K+LY A EDE +   D     + DL+K
Sbjct: 404 KVISEGVPDELRNKTLTRALKLLYEADEDERDDTYDEADVSRTDLSK 450

>CAGL0H06281g Chr8 (620236..622056) [1821 bp, 606 aa] {ON} highly
           similar to uniprot|P31383 Saccharomyces cerevisiae
           YAL016w TPD3
          Length = 606

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 4   IEIFNGFLKIVSDEFPKELRTKGQNLKRKILYIASEDEENKESD---------SVINEQD 54
           ++++N F+ +V+DE P   R  G+NL   I  +    E   + D         +VIN+Q 
Sbjct: 164 VDLWNLFMTLVNDETPMVRRAVGKNLPILIDLLTENPEFCTDKDLEFISTTFQTVINDQQ 223

Query: 55  DLTKF 59
           D  KF
Sbjct: 224 DSVKF 228

>KLLA0F26312g Chr6 (2438840..2439745) [906 bp, 301 aa] {ON} similar
           to uniprot|P50110 Saccharomyces cerevisiae YMR060C SAM37
           Component of the mitochondrial outer membrane sorting
           and assembly machinery (SAM) complex required for the
           sorting of some proteins to the outer membrane after
           import by the TOM complex
          Length = 301

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 19  PKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLT-KFTEGIGSKL 67
           P   R++ + L R I+    EDEEN   +S  N QD+L+ K TE   SK+
Sbjct: 134 PLSARSRARELCRDIMVTIPEDEEN---ESTSNHQDELSEKATELAQSKV 180

>KNAG0E03390 Chr5 complement(676662..677141) [480 bp, 159 aa] {ON}
           Anc_8.58 YFL017C
          Length = 159

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 57/137 (41%), Gaps = 25/137 (18%)

Query: 84  EKISREIYDNNDSWKKNKLVE--MKSPGLIYVSYWKEEAEKKTCA----LFLSFMLTEED 137
           E ++++ ++N  ++ K +LV   +K+  +  + +   E  +   A    LFL   L    
Sbjct: 32  EPLTKQSFENVVTFWKTQLVRNTIKTYNVYVIVHLDNEGREDGIAAVGTLFLEQKLIHGG 91

Query: 138 FVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQLTV 197
            +V  I   SV         E Y+G  LG  LI  LSNV + A           G    +
Sbjct: 92  GLVGHIEDISVS--------ENYQGKSLGKHLIAHLSNVGRDA-----------GCYKVI 132

Query: 198 FSDNKRAIKFYERIGMK 214
               ++ I FYE+ G K
Sbjct: 133 LDCAEKNIGFYEKCGYK 149

>TBLA0A05840 Chr1 complement(1440357..1446428) [6072 bp, 2023 aa] {ON}
            Anc_1.127 YJL207C
          Length = 2023

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 65/138 (47%), Gaps = 7/138 (5%)

Query: 48   SVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKS 107
            +++ + D+L  FT+G  + L+  ++  L   +  KYE I +EI  +N S  KN L E+K+
Sbjct: 1513 ALLTKNDELITFTKGYWNTLIYLWIISLREYVMVKYESI-QEI-SSNTSQSKNVLTEIKN 1570

Query: 108  PGL-IYVSYWKEEAEKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEI--QLIEKYRGCQ 164
              L +Y   W    E   C L  +  +  E    D+I  F  I L +    +I+      
Sbjct: 1571 SKLELYKPVWLNFVETLGCLLEENKDMILECLNEDEIESFMFILLTQCLEAIIKNIDNHS 1630

Query: 165  LGTRLIKGLSNV--CQIA 180
            +  R++  L N+  C ++
Sbjct: 1631 VKKRVLPALHNILKCGVS 1648

>Suva_7.158 Chr7 complement(296305..298173) [1869 bp, 622 aa] {ON}
           YGL110C (REAL)
          Length = 622

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%)

Query: 12  KIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSVINEQDDLTK 58
           KI+S   P ELR K      K+LY   EDE +   D     + DL+K
Sbjct: 406 KIISGHVPDELRNKTLTRALKLLYEGDEDERDDTYDEADVSRSDLSK 452

>KAFR0C03320 Chr3 complement(675037..678657) [3621 bp, 1206 aa] {ON}
           Anc_8.113 YPR010C
          Length = 1206

 Score = 30.4 bits (67), Expect = 5.0,   Method: Composition-based stats.
 Identities = 50/187 (26%), Positives = 71/187 (37%), Gaps = 34/187 (18%)

Query: 49  VINEQDDLTKFTEGIGSKLLDSFLEILDNNLG-NKYEKISREIYDNNDSWKKNKLVEMKS 107
           +IN+  D   F  G   K+     E +D  L  N+ + I++     ND W K  L ++  
Sbjct: 791 IINKSADERGFAYGTMYKV-----EKVDLALNRNRGDPITQHFGFGNDEWPKEWLDKLDD 845

Query: 108 PGLIYVSYWKEEAEKKTCALFLSFM---------------LTEEDFVVDDIRKFSVIYLY 152
            GL Y+  + EE +   CA F   +               + E + + DD  KF      
Sbjct: 846 DGLPYIGTYVEEGD-PICAYFDDTLNKTKTKTYHSSEPAYIEEVNLIGDDSNKFQ----- 899

Query: 153 EIQLIE-KY---RGCQLGTRLIK--GLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIK 206
           E+Q +  KY   R  Q+G +     G   VC      I   F   GIQ  V   N  A  
Sbjct: 900 ELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVII-NPHAFP 958

Query: 207 FYERIGM 213
               IGM
Sbjct: 959 SRMTIGM 965

>YPR010C Chr16 complement(577585..581196) [3612 bp, 1203 aa] {ON}
           RPA135RNA polymerase I second largest subunit A135
          Length = 1203

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 58/154 (37%), Gaps = 28/154 (18%)

Query: 81  NKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCALFLSFM-------- 132
           N+ + I++     ND W K  L ++   GL Y+  + EE +   CA F   +        
Sbjct: 816 NRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGD-PICAYFDDTLNKTKIKTY 874

Query: 133 -------LTEEDFVVDDIRKFSVIYLYEIQLIE-KY---RGCQLGTRLI--KGLSNVCQI 179
                  + E + + D+  KF      E+Q +  KY   R  Q+G +     G   VC  
Sbjct: 875 HSSEPAYIEEVNLIGDESNKFQ-----ELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSR 929

Query: 180 AQVKIRPAFPLIGIQLTVFSDNKRAIKFYERIGM 213
               I   F   GIQ  +   N  A      IGM
Sbjct: 930 KWPTIDMPFSETGIQPDIII-NPHAFPSRMTIGM 962

>KLLA0C09845g Chr3 complement(850737..851228) [492 bp, 163 aa] {ON}
           similar to uniprot|Q08689 Saccharomyces cerevisiae
           YOR253W NAT5 Subunit of the N-terminal acetyltransferase
           NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
           proteins which influences multiple processes such as the
           cell cycle heat- shock resistance mating sporulation and
           telomeric silencing
          Length = 163

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 8/65 (12%)

Query: 149 IYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIGIQLTVFSDNKRAIKFY 208
           +Y+  + ++E YRG   G+ ++K + + C       + +F    I + V +DN+ AI++Y
Sbjct: 80  MYIEVLAVLEAYRGKTAGSLMLKYIEDKC-------KESFQH-DIYVHVATDNETAIEWY 131

Query: 209 ERIGM 213
           E+ G 
Sbjct: 132 EKNGF 136

>NDAI0C01310 Chr3 complement(268904..269701) [798 bp, 265 aa] {ON}
          Length = 265

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 72/182 (39%), Gaps = 22/182 (12%)

Query: 37  ASEDEENKESDSVINEQDDLTKFTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDS 96
            +ED      D  + E +++ +  EG+G        E        +YE    E     + 
Sbjct: 11  TNEDRNLNRDDQTMQEDEEIKRMVEGLGKSSYRKRYE-------QQYEDAIVECLKKENL 63

Query: 97  WKKNKLVEMKSPGL-IYVSYWKEEAEKKTCALFLSFMLTEEDFVVDDIRKFS-------- 147
              + ++  K   L  + SY K+  E+    +++   LT+ +  ++ +R+F         
Sbjct: 64  SAISGIINQKFATLNNHYSYIKDYLER---LVYMYADLTDRETAINSLRRFYEGEHKEPN 120

Query: 148 --VIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPA-FPLIGIQLTVFSDNKRA 204
               Y++ I  +  + GCQLG   +       +     I P+ F  I + + +F D K A
Sbjct: 121 LWTDYVFIIVFMGFFFGCQLGFLTLLNSREEEEEEAALIYPSYFSFIFVNMIIFPDYKTA 180

Query: 205 IK 206
           IK
Sbjct: 181 IK 182

>YGL110C Chr7 complement(301537..303411) [1875 bp, 624 aa] {ON}
           CUE3Protein of unknown function; has a CUE domain that
           binds ubiquitin, which may facilitate intramolecular
           monoubiquitination
          Length = 624

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 12  KIVSDEFPKELRTKGQNLKRKILYIASEDEENKESDSV-INEQD 54
           KI+S+  P ELR K      K+LY A EDE +   D   +N  D
Sbjct: 405 KIISEGVPDELRNKTLTRALKLLYEADEDERDDTYDEADVNRSD 448

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.138    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,989,400
Number of extensions: 1405770
Number of successful extensions: 6662
Number of sequences better than 10.0: 119
Number of HSP's gapped: 6821
Number of HSP's successfully gapped: 119
Length of query: 256
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 149
Effective length of database: 41,212,137
Effective search space: 6140608413
Effective search space used: 6140608413
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)