Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A018402.531ON41441422270.0
NCAS0J00640na 1ON102542554e-26
NDAI0B030808.116ON4601872554e-23
NDAI0C06260na 1ON582762512e-22
NCAS0B05750singletonON505602413e-21
Ecym_1383na 2ON381702374e-21
Kpol_1018.352.531ON517592371e-20
AEL077Wna 2ON336612302e-20
KNAG0D022808.117ON435642323e-20
TBLA0B064102.531ON449782253e-19
SAKL0H20394g8.117ON359632224e-19
TPHA0A04530singletonON501682235e-19
Kpol_495.20singletonON486652236e-19
SAKL0A09438g2.531ON441622226e-19
TDEL0F011708.116ON162732009e-18
Suva_16.3388.117ON247672061e-17
NCAS0F009202.531ON354652101e-17
TBLA0E039308.116ON462622121e-17
Smik_16.2558.117ON247672051e-17
Skud_16.3008.117ON249672051e-17
YPR015C8.117ON247672042e-17
KAFR0C031408.117ON370662082e-17
ZYRO0E02684g8.116ON133691952e-17
KNAG0G011408.117ON5191492103e-17
NCAS0B046708.116ON2661062009e-17
KAFR0B019908.116ON410642049e-17
NDAI0B019408.116ON336632021e-16
CAGL0L05786g8.116ON348652021e-16
KAFR0B020008.117ON303631992e-16
NCAS0F00910singletonON350832002e-16
SAKL0H20416g8.116ON317621992e-16
Skud_16.2988.116ON317681966e-16
NDAI0B02080singletonON273691946e-16
YPR013C8.116ON317701957e-16
Ecym_8387na 3ON179621879e-16
Suva_16.3358.116ON317611941e-15
KLLA0F11682g3.298ON374591951e-15
SAKL0D02618g3.298ON321701941e-15
NCAS0C042308.117ON338571941e-15
Smik_16.2538.116ON317691931e-15
KNAG0D022908.116ON435611951e-15
KLTH0D06798g2.531ON111541802e-15
CAGL0J01595g8.117ON344651913e-15
Kpol_1052.83.298ON386581897e-15
KLLA0A04609gsingletonON423551898e-15
ADR308Cna 4ON278551841e-14
NCAS0B046608.117ON256661822e-14
KNAG0J022503.296ON296581822e-14
TPHA0A039103.298ON351581843e-14
Ecym_8011na 4ON276921813e-14
Kwal_26.80112.531ON190791763e-14
Ecym_26733.298ON301551814e-14
KLLA0F20636gsingletonON285621796e-14
Kwal_14.22068.117ON254611777e-14
Kpol_1065.483.298ON364561808e-14
KLTH0H08800g8.117ON168551719e-14
AGL207W3.298ON277621779e-14
KNAG0H010703.298ON322691781e-13
ADL040Wna 5ON330721781e-13
ADL050Wna 3ON146621682e-13
Ecym_8377na 5ON310571762e-13
KLTH0C04884g3.298ON342621772e-13
Kpol_541.398.116ON291661752e-13
CAGL0M01870g3.298ON315531743e-13
KAFR0C003403.298ON394581764e-13
SAKL0A10582gsingletonON288741734e-13
Kwal_27.104673.298ON302551726e-13
TBLA0G032403.298ON511911756e-13
NDAI0A075403.298ON370561746e-13
SAKL0D15136gsingletonON271591707e-13
KAFR0H012903.298ON330711701e-12
TBLA0I020603.298ON833841703e-12
NCAS0I014603.298ON330531656e-12
Ecym_4128na 6ON312771647e-12
Ecym_8389singletonON251571627e-12
AGR186Cna 6ON287771621e-11
ADL051Wna 7ON173511524e-11
Ecym_8388na 7ON223581536e-11
SAKL0A10648gsingletonON261621493e-10
Ecym_8379na 8ON305571495e-10
ADL042Wna 8ON281511478e-10
Smik_14.3032.303ON673861482e-09
NCAS0A091601.326ON773791482e-09
CAGL0K12078g3.281ON463641462e-09
Kpol_1035.221.326ON7971271472e-09
CAGL0A01628g4.80ON424851434e-09
ZYRO0G20526g1.326ON849651437e-09
AGR031W3.281ON140591311e-08
Ecym_26543.281ON257731352e-08
Suva_7.2404.80ON515811382e-08
NDAI0G058001.326ON836541374e-08
Suva_14.3182.303ON681771365e-08
KNAG0D037104.80ON459811355e-08
TBLA0F013001.326ON9851171356e-08
Skud_14.3012.303ON682701357e-08
TDEL0D019501.326ON7551191349e-08
SAKL0H20988g4.80ON548511331e-07
YNL027W (CRZ1)2.303ON678561321e-07
KAFR0C004903.281ON224701272e-07
Smik_10.1841.326ON885811312e-07
KLTH0G12254g8.326ON746751312e-07
Kpol_1026.84.80ON412941292e-07
Kwal_14.25431.326ON711681302e-07
Skud_7.2494.80ON502511303e-07
Smik_7.2514.80ON505511293e-07
Suva_6.1321.326ON878811303e-07
TDEL0F026904.80ON350771283e-07
KAFR0F036004.80ON335781283e-07
KLLA0E08713g2.303ON596561293e-07
KNAG0I020702.162ON572921293e-07
Skud_10.1521.326ON879811293e-07
YGL035C (MIG1)4.80ON504551293e-07
YJL056C (ZAP1)1.326ON880811293e-07
ZYRO0G09438g4.80ON329511273e-07
TPHA0A039803.281ON314581274e-07
KNAG0J008703.281ON280651254e-07
Ecym_54242.162ON775521284e-07
ACR264W2.162ON769521285e-07
ZYRO0A02288g2.303ON619681275e-07
AFR471C4.80ON389771266e-07
KLLA0E11023g4.80ON474511266e-07
KLLA0F18524g3.281ON357721256e-07
CAGL0J05060g1.326ON7131191277e-07
Kwal_27.10167na 9ON2851101247e-07
KLTH0H10538g1.326ON682681267e-07
KLTH0H09196g4.80ON460861257e-07
Smik_4.2813.281ON231621228e-07
NCAS0G037302.303ON571561259e-07
Kpol_1003.502.303ON614681251e-06
Ecym_62951.326ON663551251e-06
KNAG0E026101.326ON7461221251e-06
CAGL0M06831g2.303ON645561251e-06
NDAI0G007202.303ON708561251e-06
Kpol_1052.183.281ON357811231e-06
SAKL0E10714g2.162ON819521251e-06
ZYRO0B16148g2.162ON930831241e-06
TDEL0G023302.303ON506681232e-06
NCAS0A018204.80ON455711222e-06
KLLA0F22319gsingletonON203471182e-06
NCAS0F037403.518ON288531202e-06
NDAI0I029003.518ON524781222e-06
TDEL0B052502.162ON714831232e-06
KNAG0E016003.518ON338521212e-06
KLTH0G10802g2.303ON526841222e-06
Smik_5.1513.518ON3881021212e-06
Klac_YGOB_Anc_3.5183.518ON239581192e-06
TPHA0G008202.303ON532681222e-06
SAKL0D06776g1.326ON767601232e-06
Suva_2.2003.281ON232591192e-06
KAFR0B057408.326ON619511222e-06
KLTH0C07172g3.281ON265631192e-06
TPHA0A058203.518ON276521192e-06
Kwal_56.239258.326ON745751222e-06
KAFR0B045802.162ON729791222e-06
Kwal_47.178882.162ON786521223e-06
TPHA0M011803.281ON350851203e-06
KLTH0E09724g2.162ON768521223e-06
ZYRO0E08426g3.518ON171751153e-06
Skud_4.2973.281ON231591183e-06
NCAS0B036008.326ON635751213e-06
TPHA0O014401.326ON778571213e-06
KAFR0H032402.303ON519791203e-06
SAKL0E07216g2.303ON548681203e-06
TPHA0C008008.326ON6801091214e-06
TBLA0B060502.303ON762681214e-06
Suva_7.523.518ON400891194e-06
TBLA0A089104.80ON390511194e-06
KNAG0H019302.303ON618561204e-06
YDR043C (NRG1)3.281ON231591164e-06
SAKL0D03146g3.281ON157581134e-06
SAKL0F01980g3.518ON385811194e-06
Kpol_1050.116singletonON329581185e-06
CAGL0E01331g8.326ON689531195e-06
YBR066C (NRG2)3.281ON220651155e-06
Ecym_33412.303ON560561195e-06
Kpol_1036.708.326ON674681195e-06
Suva_4.3053.281ON220651156e-06
KLTH0G01826g3.518ON307691176e-06
TPHA0D034003.518ON338731176e-06
Ecym_14154.80ON504511186e-06
TPHA0B029102.162ON717541196e-06
Skud_2.1893.281ON220651156e-06
Smik_2.1993.281ON220651156e-06
Kpol_1050.193.518ON221511156e-06
KLLA0F23782g2.162ON782511196e-06
Kwal_47.190453.518ON266651157e-06
CAGL0C02519g3.518ON318731168e-06
Kwal_27.109253.281ON264591158e-06
NCAS0E006103.518ON401521178e-06
SAKL0H15488g8.326ON798751188e-06
TBLA0I032803.518ON330681169e-06
KAFR0F041503.518ON416941169e-06
KAFR0A008001.326ON753521171e-05
TBLA0B012802.162ON823721171e-05
NDAI0B060203.518ON426531161e-05
NDAI0D037504.80ON493511161e-05
Skud_4.4058.326ON707911161e-05
CAGL0I02816gsingletonOFF291541141e-05
TDEL0D034303.281ON175601111e-05
ZYRO0C13508g3.281ON189601111e-05
Kpol_1072.582.162ON794531161e-05
Kwal_27.114602.303ON531561161e-05
NDAI0A056503.281ON330611141e-05
TDEL0D058603.518ON330791142e-05
KNAG0G024708.326ON736531152e-05
NCAS0A129102.598ON822561152e-05
Smik_15.2912.162ON909581152e-05
Skud_15.2762.162ON917581152e-05
Kwal_14.22784.80ON463511142e-05
CAGL0L07480g3.281ON314871132e-05
YOR113W (AZF1)2.162ON914581152e-05
Suva_8.1662.162ON948621152e-05
Smik_4.3908.326ON7081061142e-05
KAFR0C04550singletonON467521142e-05
ADL198W2.303ON547561142e-05
Suva_2.3078.326ON691921142e-05
Smik_7.543.518ON382891132e-05
CAGL0K09372g3.518ON396681132e-05
YGL209W (MIG2)3.518ON382731132e-05
KNAG0H011803.281ON254581113e-05
Kwal_23.54007.543ON429541123e-05
Skud_5.1373.518ON394831123e-05
KNAG0A051708.326ON645531123e-05
NDAI0B042902.162ON1064521133e-05
TPHA0K017704.80ON518511124e-05
Kpol_1065.153.281ON220571094e-05
YDR146C (SWI5)8.326ON709531124e-05
KLLA0F01463g1.326ON781551124e-05
CAGL0L03916g2.162ON642521124e-05
Skud_7.593.518ON383631114e-05
NDAI0G025608.326ON794531124e-05
KNAG0H034802.162ON796521124e-05
ZYRO0F10428g8.326ON813511124e-05
SAKL0A09482g2.533ON3881221114e-05
NCAS0A106503.281ON293581104e-05
CAGL0H04213g4.351ON1321821124e-05
KLLA0D16456g8.326ON854601115e-05
NCAS0I015603.281ON266591085e-05
NCAS0C032408.326ON620621116e-05
AER159C4.351ON1191891116e-05
KAFR0I023703.518ON391911106e-05
CAGL0M04323g8.326ON703661107e-05
CAGL0M00594g4.351ON1020831107e-05
Kpol_505.152.162ON510711098e-05
KLLA0B03454g7.543ON472541098e-05
AGL197W8.326ON844671099e-05
KLTH0A00682g7.543ON433531089e-05
TDEL0D006704.351ON1199731091e-04
TDEL0F045108.326ON743531091e-04
NCAS0B069602.162ON839671091e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A01840
         (414 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...   862   0.0  
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}      102   4e-26
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...   102   4e-23
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}            101   2e-22
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    97   3e-21
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    96   4e-21
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    96   1e-20
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    93   2e-20
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               94   3e-20
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    91   3e-19
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    90   4e-19
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             91   5e-19
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    91   6e-19
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    90   6e-19
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    82   9e-18
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    84   1e-17
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     86   1e-17
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    86   1e-17
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    84   1e-17
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    84   1e-17
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    83   2e-17
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               85   2e-17
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    80   2e-17
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    86   3e-17
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                82   9e-17
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    83   9e-17
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    82   1e-16
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    82   1e-16
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    81   2e-16
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               82   2e-16
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    81   2e-16
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    80   6e-16
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                79   6e-16
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    80   7e-16
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    77   9e-16
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    79   1e-15
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    80   1e-15
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    79   1e-15
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               79   1e-15
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    79   1e-15
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    80   1e-15
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    74   2e-15
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    78   3e-15
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    77   7e-15
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    77   8e-15
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    75   1e-14
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                75   2e-14
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               75   2e-14
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    75   3e-14
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    74   3e-14
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    72   3e-14
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    74   4e-14
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    74   6e-14
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    73   7e-14
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    74   8e-14
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    70   9e-14
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    73   9e-14
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    73   1e-13
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    73   1e-13
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    69   2e-13
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    72   2e-13
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    73   2e-13
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    72   2e-13
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    72   3e-13
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    72   4e-13
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    71   4e-13
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    71   6e-13
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     72   6e-13
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    72   6e-13
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    70   7e-13
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    70   1e-12
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     70   3e-12
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    68   6e-12
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    68   7e-12
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    67   7e-12
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    67   1e-11
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    63   4e-11
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    64   6e-11
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    62   3e-10
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    62   5e-10
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    61   8e-10
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    62   2e-09
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    62   2e-09
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    61   2e-09
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    61   2e-09
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    60   4e-09
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    60   7e-09
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    55   1e-08
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    57   2e-08
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    58   2e-08
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    57   4e-08
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    57   5e-08
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    57   5e-08
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    57   6e-08
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    57   7e-08
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    56   9e-08
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    56   1e-07
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    55   1e-07
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    54   2e-07
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    55   2e-07
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    55   2e-07
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    54   2e-07
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    55   2e-07
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    55   3e-07
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    54   3e-07
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    55   3e-07
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    54   3e-07
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    54   3e-07
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    54   3e-07
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    54   3e-07
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    54   3e-07
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    54   3e-07
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    54   3e-07
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    54   3e-07
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    54   4e-07
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    53   4e-07
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    54   4e-07
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    54   5e-07
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    54   5e-07
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    53   6e-07
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    53   6e-07
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    53   6e-07
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    54   7e-07
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    52   7e-07
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    53   7e-07
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    53   7e-07
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    52   8e-07
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     53   9e-07
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    53   1e-06
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    53   1e-06
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    53   1e-06
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    53   1e-06
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    53   1e-06
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    52   1e-06
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    53   1e-06
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    52   1e-06
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    52   2e-06
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      52   2e-06
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    50   2e-06
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    51   2e-06
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    52   2e-06
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    52   2e-06
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    51   2e-06
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    52   2e-06
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    51   2e-06
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    50   2e-06
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    52   2e-06
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    52   2e-06
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    50   2e-06
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    52   2e-06
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    50   2e-06
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    50   2e-06
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    52   2e-06
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    52   2e-06
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    52   3e-06
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    51   3e-06
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    52   3e-06
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    49   3e-06
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    50   3e-06
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    51   3e-06
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    51   3e-06
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    51   3e-06
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    51   3e-06
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    51   4e-06
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    51   4e-06
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    50   4e-06
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    50   4e-06
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    51   4e-06
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    49   4e-06
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    48   4e-06
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    50   4e-06
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    50   5e-06
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    50   5e-06
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    49   5e-06
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    50   5e-06
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    50   5e-06
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    49   6e-06
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    50   6e-06
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    50   6e-06
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    50   6e-06
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    50   6e-06
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    49   6e-06
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    49   6e-06
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    49   6e-06
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    50   6e-06
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    49   7e-06
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    49   8e-06
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    49   8e-06
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     50   8e-06
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    50   8e-06
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    49   9e-06
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    49   9e-06
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    50   1e-05
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    50   1e-05
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    49   1e-05
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      49   1e-05
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    49   1e-05
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    49   1e-05
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    47   1e-05
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    47   1e-05
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    49   1e-05
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    49   1e-05
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    49   1e-05
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    49   2e-05
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    49   2e-05
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    49   2e-05
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    49   2e-05
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    49   2e-05
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    49   2e-05
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    48   2e-05
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    49   2e-05
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    49   2e-05
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    49   2e-05
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               49   2e-05
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    49   2e-05
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    49   2e-05
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    48   2e-05
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    48   2e-05
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    48   2e-05
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    47   3e-05
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    48   3e-05
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    48   3e-05
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    48   3e-05
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    48   3e-05
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    48   4e-05
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    47   4e-05
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    48   4e-05
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    48   4e-05
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    48   4e-05
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    47   4e-05
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     48   4e-05
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    48   4e-05
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    48   4e-05
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...    47   4e-05
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    47   4e-05
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    48   4e-05
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    47   5e-05
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      46   5e-05
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     47   6e-05
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    47   6e-05
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    47   6e-05
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    47   7e-05
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    47   7e-05
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    47   8e-05
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    47   8e-05
AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic ho...    47   9e-05
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    46   9e-05
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    47   1e-04
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    47   1e-04
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    47   1e-04
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    46   1e-04
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    46   1e-04
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    45   1e-04
KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some s...    46   1e-04
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    46   2e-04
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    45   2e-04
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    45   2e-04
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    44   2e-04
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    45   2e-04
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    45   2e-04
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    44   3e-04
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    45   3e-04
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    45   3e-04
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    45   3e-04
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    44   4e-04
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    43   4e-04
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    44   4e-04
TPHA0G03750 Chr7 complement(794102..795142) [1041 bp, 346 aa] {O...    44   4e-04
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    45   4e-04
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    44   5e-04
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    44   5e-04
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    44   5e-04
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    44   5e-04
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    44   5e-04
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    44   5e-04
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    44   6e-04
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    42   6e-04
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    44   6e-04
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...    44   6e-04
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    44   6e-04
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    44   6e-04
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    42   7e-04
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    44   7e-04
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    43   7e-04
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    44   8e-04
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    44   9e-04
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    44   9e-04
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    43   0.001
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    43   0.001
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    44   0.001
Kwal_47.16577 s47 complement(9960..12605) [2646 bp, 881 aa] {ON}...    43   0.001
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    43   0.001
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    42   0.001
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    43   0.001
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    43   0.001
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    43   0.001
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    41   0.002
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    42   0.002
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    42   0.002
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    43   0.002
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    42   0.002
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    42   0.002
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    42   0.002
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    42   0.002
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     42   0.002
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    42   0.002
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    42   0.003
NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4....    42   0.003
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...    41   0.003
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       41   0.003
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    42   0.003
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    42   0.003
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    42   0.003
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...    42   0.003
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    42   0.003
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    42   0.003
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...    42   0.003
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    42   0.003
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    40   0.003
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    42   0.003
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    42   0.003
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    42   0.003
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    41   0.003
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    41   0.003
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    42   0.004
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    42   0.004
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    41   0.004
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    40   0.004
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    41   0.004
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    41   0.004
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    42   0.004
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    42   0.004
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    41   0.004
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    41   0.004
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...    41   0.004
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    42   0.004
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    41   0.004
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    41   0.004
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    41   0.004
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    41   0.004
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                40   0.005
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    41   0.005
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    41   0.005
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    41   0.005
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    41   0.005
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    41   0.005
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    41   0.006
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    41   0.006
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    40   0.007
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    40   0.007
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    41   0.007
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     40   0.008
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  40   0.008
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    40   0.008
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    40   0.008
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...    40   0.009
KLTH0D13618g Chr4 (1112089..1113333) [1245 bp, 414 aa] {ON} simi...    40   0.009
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...    40   0.009
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    40   0.010
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    40   0.010
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...    40   0.011
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    40   0.011
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    40   0.011
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    40   0.012
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    40   0.012
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    39   0.012
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    40   0.013
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    39   0.014
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...    39   0.015
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    39   0.015
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    39   0.016
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    39   0.016
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    39   0.017
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    39   0.017
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    39   0.019
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    39   0.019
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...    39   0.020
KLTH0E03124g Chr5 complement(280411..283056) [2646 bp, 881 aa] {...    39   0.021
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...    39   0.022
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    39   0.022
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    38   0.022
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    39   0.023
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    39   0.023
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    39   0.023
TDEL0E01520 Chr5 complement(297717..298916) [1200 bp, 399 aa] {O...    39   0.024
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...    39   0.024
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    39   0.028
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    38   0.028
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    39   0.029
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    38   0.031
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    38   0.033
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    38   0.034
YLR375W Chr12 (871697..872728) [1032 bp, 343 aa] {ON}  STP3Zinc-...    38   0.036
Smik_12.462 Chr12 (810413..811438) [1026 bp, 341 aa] {ON} YLR375...    38   0.036
Skud_12.460 Chr12 (811208..812242) [1035 bp, 344 aa] {ON} YLR375...    38   0.037
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    38   0.037
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    38   0.041
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     38   0.041
Suva_10.491 Chr10 (836816..837094,837128..837883) [1035 bp, 344 ...    38   0.042
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    38   0.042
CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some ...    38   0.042
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    38   0.043
NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222     38   0.045
Smik_7.7 Chr7 (16965..17897) [933 bp, 310 aa] {ON} YGL254W (REAL)      37   0.045
TBLA0A08200 Chr1 complement(2024809..2025861) [1053 bp, 350 aa] ...    38   0.046
Smik_4.190 Chr4 complement(347829..349298) [1470 bp, 489 aa] {ON...    38   0.047
Kwal_26.9300 s26 (1156241..1157155) [915 bp, 304 aa] {ON} YLR375...    37   0.047
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    37   0.048
Suva_7.7 Chr7 (16721..17614) [894 bp, 297 aa] {ON} YGL254W (REAL)      37   0.053
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    38   0.054
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    37   0.057
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    37   0.058
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    38   0.058
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    38   0.063
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    36   0.064
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    37   0.066
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    37   0.068
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    37   0.069
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    37   0.072
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    37   0.072
Suva_4.201 Chr4 complement(354498..356009) [1512 bp, 503 aa] {ON...    37   0.073
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    37   0.074
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    37   0.074
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    37   0.078
Skud_4.206 Chr4 complement(361956..363416) [1461 bp, 486 aa] {ON...    37   0.079
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    37   0.081
Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON} com...    37   0.082
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     37   0.088
YDL048C Chr4 complement(366739..368211) [1473 bp, 490 aa] {ON}  ...    37   0.094
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    37   0.095
TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.2...    37   0.095
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    37   0.095
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    37   0.098
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    37   0.11 
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    36   0.11 
SAKL0H03894g Chr8 complement(357602..358678) [1077 bp, 358 aa] {...    37   0.11 
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    37   0.11 
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    36   0.12 
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    36   0.13 
KNAG0B05940 Chr2 (1165682..1166815) [1134 bp, 377 aa] {ON} Anc_4...    36   0.13 
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    36   0.13 
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    35   0.14 
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    35   0.14 
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    35   0.15 
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    36   0.16 
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...    35   0.17 
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    35   0.17 
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    36   0.17 
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    35   0.18 
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    35   0.18 
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    36   0.19 
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    36   0.19 
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    36   0.19 
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    36   0.20 
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    36   0.20 
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  35   0.20 
NDAI0D04510 Chr4 complement(1057468..1059150) [1683 bp, 560 aa] ...    36   0.20 
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    36   0.21 
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    36   0.22 
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    36   0.26 
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    36   0.26 
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    35   0.27 
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    35   0.27 
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    35   0.27 
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    35   0.28 
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    35   0.30 
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      35   0.31 
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    35   0.34 
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    35   0.35 
YGL254W Chr7 (22304..23203) [900 bp, 299 aa] {ON}  FZF1Transcrip...    35   0.36 
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    35   0.36 
ZYRO0B07436g Chr2 complement(581225..582256) [1032 bp, 343 aa] {...    35   0.39 
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    34   0.40 
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    34   0.40 
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    34   0.41 
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      34   0.42 
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    35   0.44 
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    35   0.46 
KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}...    35   0.46 
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    35   0.47 
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    34   0.48 
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    35   0.50 
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    35   0.51 
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    33   0.52 
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      34   0.54 
AFR588W Chr6 (1496952..1497911) [960 bp, 319 aa] {ON} Syntenic h...    34   0.54 
KAFR0A06120 Chr1 complement(1238549..1239577) [1029 bp, 342 aa] ...    34   0.54 
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    34   0.54 
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     34   0.56 
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    35   0.57 
KLTH0E05962g Chr5 (539474..540739) [1266 bp, 421 aa] {ON} weakly...    34   0.62 
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    34   0.63 
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    34   0.65 
Kwal_55.20634 s55 (498959..500218) [1260 bp, 419 aa] {ON} YHL027...    34   0.65 
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    34   0.68 
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    34   0.71 
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    34   0.74 
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    34   0.78 
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    34   0.80 
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    34   0.81 
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    33   0.82 
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    34   0.85 
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    34   0.89 
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    34   0.91 
SAKL0H25674g Chr8 complement(2249157..2250503) [1347 bp, 448 aa]...    33   0.91 
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    34   0.98 
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    33   0.99 
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    34   1.00 
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    33   1.0  
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    33   1.0  
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      33   1.0  
NCAS0C05820 Chr3 complement(1197669..1199426) [1758 bp, 585 aa] ...    33   1.1  
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    33   1.2  
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    33   1.2  
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    33   1.2  
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    33   1.3  
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    33   1.3  
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    33   1.3  
CAGL0H04873g Chr8 complement(465069..466424) [1356 bp, 451 aa] {...    33   1.3  
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    33   1.3  
Ecym_2768 Chr2 (1495608..1496903) [1296 bp, 431 aa] {ON} similar...    33   1.3  
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    33   1.4  
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    33   1.4  
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    33   1.5  
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    33   1.5  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    33   1.6  
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    33   1.7  
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    33   1.8  
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    32   1.8  
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    31   2.0  
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    32   2.0  
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    33   2.2  
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                32   2.2  
Kpol_388.8 s388 (25278..26939) [1662 bp, 553 aa] {ON} (25278..26...    32   2.2  
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    32   2.3  
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    32   2.6  
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    32   2.7  
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    32   2.8  
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    32   3.0  
Kpol_1031.73 s1031 complement(186968..187513) [546 bp, 181 aa] {...    31   3.0  
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    32   3.0  
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    32   3.3  
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 32   3.3  
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    32   3.8  
KNAG0F00730 Chr6 (127002..131831) [4830 bp, 1609 aa] {ON} Anc_2....    32   3.9  
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    32   4.4  
Ecym_4273 Chr4 (575663..590410) [14748 bp, 4915 aa] {ON} similar...    32   4.4  
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    32   4.6  
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    32   4.9  
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    31   5.9  
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    31   6.0  
NDAI0C04980 Chr3 complement(1158167..1160110) [1944 bp, 647 aa] ...    31   6.3  
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    31   6.9  
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    31   7.5  
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    31   7.8  
TPHA0B00710 Chr2 complement(160987..162735) [1749 bp, 582 aa] {O...    30   9.0  

>KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {ON}
           Anc_2.531
          Length = 414

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/414 (100%), Positives = 414/414 (100%)

Query: 1   MTRIHNDENLKSEKGSLNYLVNGPTILNDESDPLTKSSIVKPVLEKTQLPAKSFSIYQDH 60
           MTRIHNDENLKSEKGSLNYLVNGPTILNDESDPLTKSSIVKPVLEKTQLPAKSFSIYQDH
Sbjct: 1   MTRIHNDENLKSEKGSLNYLVNGPTILNDESDPLTKSSIVKPVLEKTQLPAKSFSIYQDH 60

Query: 61  KTEEFDNHIDLPRLVTNNRSFSESTVSEKLGLGRQSLPIAGKAYESIENQQAITLSNGLH 120
           KTEEFDNHIDLPRLVTNNRSFSESTVSEKLGLGRQSLPIAGKAYESIENQQAITLSNGLH
Sbjct: 61  KTEEFDNHIDLPRLVTNNRSFSESTVSEKLGLGRQSLPIAGKAYESIENQQAITLSNGLH 120

Query: 121 KPTLLHPVNNPSEMQAAQHLAYGAASEKYYNANGFDQTRRGNMLSLDNTGLLDNKLIRRA 180
           KPTLLHPVNNPSEMQAAQHLAYGAASEKYYNANGFDQTRRGNMLSLDNTGLLDNKLIRRA
Sbjct: 121 KPTLLHPVNNPSEMQAAQHLAYGAASEKYYNANGFDQTRRGNMLSLDNTGLLDNKLIRRA 180

Query: 181 TSFSPFLIYPSPTVYQSIDQCHVVGSHLPAYIANNTTGLLNEQNLSQSNAMVGFIENSLQ 240
           TSFSPFLIYPSPTVYQSIDQCHVVGSHLPAYIANNTTGLLNEQNLSQSNAMVGFIENSLQ
Sbjct: 181 TSFSPFLIYPSPTVYQSIDQCHVVGSHLPAYIANNTTGLLNEQNLSQSNAMVGFIENSLQ 240

Query: 241 QTSNSSKYGMNGDLDCDNVAFQNNQLMAGPIFQQSLNIPPHYRYSSNVQPVYLTPIQSCG 300
           QTSNSSKYGMNGDLDCDNVAFQNNQLMAGPIFQQSLNIPPHYRYSSNVQPVYLTPIQSCG
Sbjct: 241 QTSNSSKYGMNGDLDCDNVAFQNNQLMAGPIFQQSLNIPPHYRYSSNVQPVYLTPIQSCG 300

Query: 301 YANSPLSYQNGIFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGD 360
           YANSPLSYQNGIFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGD
Sbjct: 301 YANSPLSYQNGIFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGD 360

Query: 361 RPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQREQSDGVETAETLSPLQREQ 414
           RPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQREQSDGVETAETLSPLQREQ
Sbjct: 361 RPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQREQSDGVETAETLSPLQREQ 414

>NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON} 
          Length = 102

 Score =  102 bits (255), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 46/54 (85%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           QCPICGK VTRSSSL  HM VHTGDRP+ CKW  CGK FNVKSNMNRHYKLHLK
Sbjct: 41  QCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHLK 94

>NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {ON}
           Anc_8.116
          Length = 460

 Score =  102 bits (255), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 69/187 (36%), Positives = 99/187 (52%), Gaps = 38/187 (20%)

Query: 225 LSQSNAMVGFIENSLQQTSNSSKYGMNGDLDCDNVAFQNNQLMAGP---------IFQQS 275
           LSQ   +   I+++L    NS +Y   G+          NQ   GP         IF   
Sbjct: 274 LSQDTQLSTLIQSAL----NSFQYAPYGE----------NQQNLGPSPLINEMASIFNLP 319

Query: 276 LNIPPHYRYSSNVQPVYLTPIQSCGYANSPLSYQ---NGIFTSNNGLIPADNQVW-TKKV 331
           +N    ++ S+++  +++ P    G +NS +S+    +G  +  +   P  N V  T+++
Sbjct: 320 VNDNQFWQRSNSLPQLHVPP---TGSSNSIISHHMSVDGTQSMEDTTEPLSNDVLETERL 376

Query: 332 K--------KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRH 383
           K        ++ QCPICGK VTR +SL  HM +H+G RPY CKWP C K FNVKSNMNRH
Sbjct: 377 KLMLDLSTIRRRQCPICGKIVTRVNSLQTHMLIHSGYRPYKCKWPACEKMFNVKSNMNRH 436

Query: 384 YKLHLKK 390
           YK+HLKK
Sbjct: 437 YKIHLKK 443

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  101 bits (251), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 44/76 (57%), Positives = 53/76 (69%)

Query: 330 KVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           + +K  QC ICGK+VTR+S+L  HM VHTGDRP+ C W  C K FNVKSNMNRHYKLHLK
Sbjct: 486 RRRKSRQCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLK 545

Query: 390 KEKEQREQSDGVETAE 405
           K+      +D  +  E
Sbjct: 546 KQLANEVLADTTQKKE 561

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 97.4 bits (241), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (76%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKE 391
           K+K QC +CGK VTR+SSL  HM +HTG RP+ C WP C K FNVKSNMNRH KLHL KE
Sbjct: 444 KRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLHLIKE 503

>Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AEL077W
          Length = 381

 Score = 95.9 bits (237), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 52/70 (74%)

Query: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKE 393
           +NQCP+C K   R SSL  HM++HTG RP+LC+WP C K FNVKSNM RHY+LH  +E +
Sbjct: 295 RNQCPVCAKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQVQENK 354

Query: 394 QREQSDGVET 403
           ++ + +G ++
Sbjct: 355 EKSKREGEQS 364

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
           (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 37/59 (62%), Positives = 49/59 (83%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQ 394
           QCP+CGK+V+R+SSL  HMF+HT  RPY C+W  C K FNVKSN+NRH KLH+KK++++
Sbjct: 459 QCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK 517

>AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; No
           homolog in Saccharomyces cerevisiae'
          Length = 336

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 48/61 (78%), Gaps = 1/61 (1%)

Query: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH-LKKEK 392
           +NQCP+CGK   R SSL  HM++HTG RP+LC+WP C K FNVKSNM RHY+LH L++ K
Sbjct: 273 RNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQLQRGK 332

Query: 393 E 393
           E
Sbjct: 333 E 333

>KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 46/64 (71%)

Query: 330 KVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           K+++  QCP+CGK  +R S+L  H F+HTGD P+ C WP CG++FNVKSNM RH K H K
Sbjct: 347 KIRRTKQCPVCGKICSRPSTLKTHYFIHTGDTPFKCTWPNCGRSFNVKSNMMRHMKAHAK 406

Query: 390 KEKE 393
           K  E
Sbjct: 407 KAAE 410

>TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON}
           Anc_2.531
          Length = 449

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 53/78 (67%)

Query: 323 DNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNR 382
            N+   K+   ++QC ICGK +TRSSSL  HM+VHT  RP+ C W  CGK FNVKSN+NR
Sbjct: 369 SNKKLPKRKVARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNR 428

Query: 383 HYKLHLKKEKEQREQSDG 400
           H KLHL+++ +  +   G
Sbjct: 429 HCKLHLRRQAKTTDDGTG 446

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (74%)

Query: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKE 393
           +NQC ICGK  +R S+L  H+ VHTG +PY C+WP C ++FNVKSNM RHYK H KK KE
Sbjct: 284 RNQCHICGKVCSRPSTLRTHVLVHTGVKPYPCEWPGCNRSFNVKSNMIRHYKNHEKKTKE 343

Query: 394 QRE 396
            +E
Sbjct: 344 NQE 346

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 90.5 bits (223), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 4/68 (5%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKE---- 391
           QCPIC +  TRS SL  HM VHT D+P+ C+W  CGKAF++KSN++RH K+H+ K+    
Sbjct: 427 QCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKIHIHKQKKLN 486

Query: 392 KEQREQSD 399
           KE RE +D
Sbjct: 487 KETRETND 494

>Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON}
           (65876..67336) [1461 nt, 487 aa]
          Length = 486

 Score = 90.5 bits (223), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 45/65 (69%)

Query: 328 TKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           T   K   +C +CGK VTR+ SL  HM +HT  RPY C W  CGK FNVKSN+NRH K+H
Sbjct: 417 TSNKKATYECSVCGKRVTRAYSLHAHMLIHTKVRPYKCDWENCGKTFNVKSNLNRHVKIH 476

Query: 388 LKKEK 392
           LKK+K
Sbjct: 477 LKKQK 481

>SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 441

 Score = 90.1 bits (222), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 44/62 (70%)

Query: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKE 393
           KNQC  CGK  +RSSSL  H  VHTGDRP+ C WP C K FNVKSNM RHY+LH K+   
Sbjct: 380 KNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGA 439

Query: 394 QR 395
           +R
Sbjct: 440 KR 441

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 81.6 bits (200), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 45/73 (61%)

Query: 321 PADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNM 380
           P    V  + V+ + QCP+CGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM
Sbjct: 87  PVQGPVLNQAVRLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNM 146

Query: 381 NRHYKLHLKKEKE 393
            RH K H +K K 
Sbjct: 147 LRHLKSHERKLKR 159

>Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%)

Query: 331 VKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           VK + QCPICGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM RH + H KK
Sbjct: 181 VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCSKSFNVKSNMLRHLRTHQKK 240

Query: 391 EKEQREQ 397
             +++ Q
Sbjct: 241 IAKKKHQ 247

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%)

Query: 329 KKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHL 388
           KK  + ++CPIC K VTRS+SL  H+ +HTG++PY C WP C  + +VKSN+ RHYK HL
Sbjct: 290 KKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHL 349

Query: 389 KKEKE 393
           K + +
Sbjct: 350 KSQNQ 354

>TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {ON} 
          Length = 462

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (70%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQR 395
           QCP+CGK  +R S+L  H  +HTGD PY CKW  C K+FNVKSNM RH K H KK ++ +
Sbjct: 356 QCPVCGKVCSRPSTLKTHYLIHTGDTPYKCKWLNCTKSFNVKSNMLRHLKNHEKKLEKMK 415

Query: 396 EQ 397
           EQ
Sbjct: 416 EQ 417

>Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%)

Query: 331 VKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           VK + QCPICGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM RH + H KK
Sbjct: 181 VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240

Query: 391 EKEQREQ 397
             +++ Q
Sbjct: 241 IAKKKHQ 247

>Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {ON}
           YPR015C (REAL)
          Length = 249

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%)

Query: 331 VKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           VK + QCPICGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM RH + H KK
Sbjct: 183 VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 242

Query: 391 EKEQREQ 397
             +++ Q
Sbjct: 243 VAKKKHQ 249

>YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON}
           Putative protein of unknown function; overexpression
           causes a cell cycle delay or arrest
          Length = 247

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%)

Query: 331 VKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           VK + QCPICGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM RH + H KK
Sbjct: 181 VKLRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKK 240

Query: 391 EKEQREQ 397
             +++ Q
Sbjct: 241 IAKKKHQ 247

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%)

Query: 331 VKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           ++ + QCP+CGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM RH+K H KK
Sbjct: 294 IRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFKSHEKK 353

Query: 391 EKEQRE 396
              ++E
Sbjct: 354 AASKKE 359

>ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 133

 Score = 79.7 bits (195), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (66%)

Query: 331 VKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           ++ + QCP+CGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM RH K H ++
Sbjct: 62  IRLRKQCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWQNCQKSFNVKSNMLRHLKSHERR 121

Query: 391 EKEQREQSD 399
             +Q  Q++
Sbjct: 122 LAKQTSQTN 130

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 78/149 (52%), Gaps = 21/149 (14%)

Query: 264 NQLMAGPIFQQSLNIPPHYRYSSNVQP------VYLTPIQSCGYAN--SPLSYQNG---- 311
           NQL   P  QQ++       +S N+QP      + + P  S  Y N  SP++ Q      
Sbjct: 372 NQLSMAPPQQQNIGCGSTADHSPNLQPSGMGGAMQMMP-NSNAYRNTYSPVNVQTSNVNP 430

Query: 312 -IFTSNNGLIPADNQV---WTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKW 367
            +F  N   IP   ++    T   K + QCP+CGK  +R S+L  H  +HTGD P+ C W
Sbjct: 431 SVFDPN---IPTPAKIQSNLTLATKLRKQCPVCGKICSRPSTLKTHYMIHTGDTPFKCPW 487

Query: 368 PKCGKAFNVKSNMNRHYKLHLKKEKEQRE 396
             C K+FNVKSNM RH K H K++ EQR+
Sbjct: 488 EGCNKSFNVKSNMFRHLKSH-KRKLEQRQ 515

>NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON} 
          Length = 266

 Score = 81.6 bits (200), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 56/106 (52%), Gaps = 5/106 (4%)

Query: 288 VQPVYLTPIQSCGYANSPLSYQNGIFTSNNGLIPAD---NQVWTKKVKKKNQCPICGKTV 344
           V PV    +      +S L     I   N+  +P+    N+    K++K  QCP CGK  
Sbjct: 152 VNPVVTGSLLPTSSRSSSLQDVKPIINKNSSKVPSKKRANRTLLSKLRK--QCPACGKIC 209

Query: 345 TRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           +R S+L  H  +HTGD P+ C W  C KAFNVKSNM RH K H KK
Sbjct: 210 SRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKK 255

>KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {ON}
           Anc_8.116 YPR013C
          Length = 410

 Score = 83.2 bits (204), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 43/64 (67%)

Query: 327 WTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKL 386
           +T  VK + QCP+CGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM RH K 
Sbjct: 332 FTSAVKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEDCSKSFNVKSNMLRHLKS 391

Query: 387 HLKK 390
           H ++
Sbjct: 392 HERR 395

>NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/63 (55%), Positives = 43/63 (68%)

Query: 330 KVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           K+K K QC ICGK  +R S+L  H  +H+GD P+ C W  C KAFNVKSNM RH+K H K
Sbjct: 250 KIKNKKQCDICGKICSRPSTLKTHYLIHSGDTPFKCAWKGCTKAFNVKSNMLRHFKCHEK 309

Query: 390 KEK 392
           K +
Sbjct: 310 KAR 312

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 44/65 (67%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKE 391
           K + QCP+CGK  +R S+L  H  +HTGD P+ C W  C KAFNVKSNM RH K H +K+
Sbjct: 282 KLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKK 341

Query: 392 KEQRE 396
           + + +
Sbjct: 342 QAKAQ 346

>KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON}
           Anc_8.117 YPR015C
          Length = 303

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 45/63 (71%)

Query: 328 TKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +++++++ +CP+CGK  +R S+L  H  +HTGD P+ C W  C KAFNVKSNM RH K H
Sbjct: 224 SREIRQRKKCPVCGKMCSRPSTLKTHYLIHTGDTPFKCTWSGCPKAFNVKSNMLRHVKSH 283

Query: 388 LKK 390
            KK
Sbjct: 284 EKK 286

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 52/83 (62%), Gaps = 5/83 (6%)

Query: 314 TSNNGLIPADNQVWTKKVKKKNQ-----CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWP 368
           +SNN LI   +      VKK+       C +CGK++TRS+SL  HM +HTG RP+ C WP
Sbjct: 259 SSNNCLISKKSSNGKGNVKKRRGHKLHICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWP 318

Query: 369 KCGKAFNVKSNMNRHYKLHLKKE 391
            C  + +VKSN+ RH+K HLK +
Sbjct: 319 NCKASSSVKSNITRHFKSHLKGQ 341

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 41/62 (66%)

Query: 331 VKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
            + K QCPICGK  +R S+L  H  +HTG  P+ C W  C K+FNVKSNM RHYK H + 
Sbjct: 254 ARLKRQCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYKSHERN 313

Query: 391 EK 392
           EK
Sbjct: 314 EK 315

>Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 2/68 (2%)

Query: 324 NQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRH 383
           N++ + K++K  QCP+CGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM RH
Sbjct: 245 NRISSTKLRK--QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRH 302

Query: 384 YKLHLKKE 391
            K H +K 
Sbjct: 303 LKSHERKR 310

>NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON} 
          Length = 273

 Score = 79.3 bits (194), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (63%)

Query: 326 VWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYK 385
           +   KV+ + QC +CGK  +R S+L  H  +HTGD P+ C W  C KAFNVKSNM RH K
Sbjct: 200 ILKAKVRLRKQCSVCGKVCSRPSTLKTHFLIHTGDTPFKCSWEGCHKAFNVKSNMLRHMK 259

Query: 386 LHLKKEKEQ 394
            H ++  ++
Sbjct: 260 SHERRRNKK 268

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 46/70 (65%), Gaps = 2/70 (2%)

Query: 322 ADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMN 381
            D ++ + K++K  QCP+CGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM 
Sbjct: 243 TDTRISSTKLRK--QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNML 300

Query: 382 RHYKLHLKKE 391
           RH K H +K 
Sbjct: 301 RHLKSHERKR 310

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 76.6 bits (187), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQRE 396
           CP+C K  TR +SL  H+ +H   RPY CK+P C K FNVKSN+NRH K+H K+E +  E
Sbjct: 111 CPVCLKEFTRKTSLNTHLLIHADIRPYRCKYPDCKKTFNVKSNLNRHLKIHKKQELKGGE 170

Query: 397 QS 398
           +S
Sbjct: 171 KS 172

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 331 VKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
            K + QCP+CGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM RH K H +K
Sbjct: 250 AKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHERK 309

Query: 391 E 391
            
Sbjct: 310 R 310

>KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]
           {ON} weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 374

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 40/59 (67%)

Query: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           K +C  CGK   R SSL  HM +HTGD+PY C +P C K FN KSNM RHYKLHLK  K
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLKTPK 361

>SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 321

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 44/70 (62%)

Query: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKE 393
           K +CP CGK   R SSL  HM +HTGD+P++C +  CGK FN KSNM RH+KLH K    
Sbjct: 234 KYECPQCGKGFVRPSSLNTHMNIHTGDKPFVCPFKNCGKTFNAKSNMLRHHKLHFKTSSG 293

Query: 394 QREQSDGVET 403
                +GV T
Sbjct: 294 DYVLPNGVMT 303

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%)

Query: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           + QCP+CGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM RH K H KK
Sbjct: 269 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325

>Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 323 DNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNR 382
           D+++   K++K  QCP+CGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSNM R
Sbjct: 244 DSRISFTKLRK--QCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLR 301

Query: 383 HYKLHLKKE 391
           H K H +K 
Sbjct: 302 HLKSHERKR 310

>KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%)

Query: 327 WTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKL 386
           +T  VK + QCP+CGK  +R S+L  H  +HTGD P+ C W  C K+FNVKSN+ RH K 
Sbjct: 362 FTSAVKMRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCTWGDCTKSFNVKSNLMRHLKS 421

Query: 387 H 387
           H
Sbjct: 422 H 422

>KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 111

 Score = 73.9 bits (180), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%)

Query: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           + QC  C K  TRSS+L  H+ VHTGDRP++C    C K+FNVKSNMNRH+K H
Sbjct: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 42/65 (64%)

Query: 325 QVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY 384
           Q+     + + QCP+CGK  +R S+L  H+ +HTGD P+ C W  C KAFNVKSN+ RH 
Sbjct: 274 QLKKATTRLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHL 333

Query: 385 KLHLK 389
           K H K
Sbjct: 334 KSHEK 338

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 39/58 (67%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           K K  C ICGK   R SSL  HM +HTG++P+ C +  C K+FN KSNM RHYKLH K
Sbjct: 302 KIKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKLHFK 359

>KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C
          Length = 423

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (70%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           KKNQC ICG+  +R S+L  H+ +HTGD+PY C    C K FNVKSNM RHYK H
Sbjct: 339 KKNQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRH 393

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 38/55 (69%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           KKN C +CG+   R S+L  HM  HTG RP+ C+ P C K+FNV+SNM RH +LH
Sbjct: 202 KKNVCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLH 256

>NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON} 
          Length = 256

 Score = 74.7 bits (182), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (66%)

Query: 331 VKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           +K   +CP+CGK  +R S+L  H  +HTGD P+ C +  C K+FNVKSNM RH K H +K
Sbjct: 191 MKNTKECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERK 250

Query: 391 EKEQRE 396
           + ++ +
Sbjct: 251 KNKKLQ 256

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 74.7 bits (182), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (68%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           K+K +C +CGK   R SSL  H  +HTG +PY+C +  C K+FN KSNM RHYKLH K
Sbjct: 205 KRKFKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYENCHKSFNAKSNMFRHYKLHFK 262

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 37/58 (63%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           K K  C ICGK   R SSL  HM +HTG +PY C    C KAFN KSNM RHYKLH K
Sbjct: 267 KIKYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKLHFK 324

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 74.3 bits (181), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 50/92 (54%)

Query: 296 IQSCGYANSPLSYQNGIFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMF 355
           +Q   Y + P+S        + G+     +  +    +KN C +CG+   R S+L  HM 
Sbjct: 174 LQGKHYISPPMSSTVPTLPISPGMTSGTIEHSSPDGIRKNVCKVCGRECRRPSTLKTHML 233

Query: 356 VHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
            HTG RP+ C+ P C K+FNV+SNM RH +LH
Sbjct: 234 THTGQRPFCCRHPGCNKSFNVRSNMLRHERLH 265

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 72.4 bits (176), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 320 IPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSN 379
           +  D Q     V  K QC +C K  +RSS+L  H+  HTG RP+ C +  C K FNVKSN
Sbjct: 113 VTVDFQHAQPAVHPKYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSN 172

Query: 380 MNRHYKLHLKKEKEQREQS 398
           M RH K H  K+ E R  S
Sbjct: 173 MVRHLKTH--KQPEVRRSS 189

>Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AGL207W
          Length = 301

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 38/55 (69%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKE 391
           C  CGK   R+SSL  H  +HTGDRP+ C +  CGK+FN +SNM RH+KLH K +
Sbjct: 209 CSDCGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFKTD 263

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 73.6 bits (179), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 39/62 (62%)

Query: 326 VWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYK 385
           V  K   K + C  CGK  TR S+L  HM VH+GD+P+ C W  C K FNVKSN+ RH K
Sbjct: 223 VKGKANGKADICAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLK 282

Query: 386 LH 387
           LH
Sbjct: 283 LH 284

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 72.8 bits (177), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (65%)

Query: 335 NQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQ 394
           ++C ICGKT +R S L  H  +HTG +PY C  P CGK FNVKSN+ RH K+H K    +
Sbjct: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAKWRDIE 253

Query: 395 R 395
           R
Sbjct: 254 R 254

>Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa]
           {ON} complement(127243..128337) [1095 nt, 365 aa]
          Length = 364

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%)

Query: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           K  C +CGK   R SSL  H  +HTG++PY C   KC KAFN KSNM RHYKLH +
Sbjct: 275 KYSCDVCGKKFKRPSSLNTHTNIHTGNKPYSCPAAKCKKAFNAKSNMLRHYKLHFR 330

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 70.5 bits (171), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 29/55 (52%), Positives = 39/55 (70%)

Query: 335 NQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           ++C +CGKT +R S L  H  +HTG +P++C  P CGK FNVKSN+ RH K+H K
Sbjct: 111 HECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKKIHDK 165

>AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No
           homolog in Saccharomyces cerevisiae
          Length = 277

 Score = 72.8 bits (177), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 330 KVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           K  ++  C  CGK   R+SSL  H  +HTGDRP+ C +  CGK+FN +SNM RH+KLH +
Sbjct: 178 KAPQRYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFR 237

Query: 390 KE 391
            +
Sbjct: 238 TD 239

>KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON}
           Anc_3.298
          Length = 322

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 39/69 (56%)

Query: 321 PADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNM 380
           P +  ++    K +  C ICGK   R SSL  H+  HTGD+PY C    C K FN +SNM
Sbjct: 223 PTNVIIYQHSKKNRYGCSICGKRFARPSSLNTHLNTHTGDKPYTCPHGSCSKVFNARSNM 282

Query: 381 NRHYKLHLK 389
            RHYK H K
Sbjct: 283 TRHYKTHFK 291

>ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR013C
          Length = 330

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (59%)

Query: 319 LIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKS 378
           ++P      + + +    C +CG+  TR S+L  HM +HTG+ P+ C WP C K FNV+S
Sbjct: 242 VLPIVGPAASPRYETNKTCLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRS 301

Query: 379 NMNRHYKLHLKK 390
           NMNRH   H ++
Sbjct: 302 NMNRHVNSHKRR 313

>ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No
           homolog in Saccharomyces cerevisiae
          Length = 146

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 39/62 (62%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQRE 396
           CP+C K  TR +SL  H+ +H   RPYLC +  C K+FNVKSN+NRH ++H   E    +
Sbjct: 78  CPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIHRGHELHHEQ 137

Query: 397 QS 398
            S
Sbjct: 138 GS 139

>Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON}
           similar to Ashbya gossypii ADL040W
          Length = 310

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 37/57 (64%)

Query: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           K  C +CG+  TR S+L  HM +HTG+ P+ C WP C K FNV+SNM RH   H +K
Sbjct: 227 KKTCTVCGRHCTRPSTLKTHMLIHTGELPFECNWPGCRKRFNVRSNMKRHLNSHKRK 283

>KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {ON}
           conserved hypothetical protein
          Length = 342

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (61%)

Query: 330 KVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           K++ +  C  CGK   R SSL  H   HTGD+P+ C +  C K FN +SNM RHYKLH K
Sbjct: 233 KLQPRYVCASCGKCFNRPSSLATHNNTHTGDKPFTCPFENCDKQFNARSNMTRHYKLHFK 292

Query: 390 KE 391
            E
Sbjct: 293 TE 294

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 44/66 (66%)

Query: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKE 393
           + QC IC K  +R ++L  H+ +HTGD P+ C W  C K+FNVKSNM RH K H +K+ +
Sbjct: 148 RKQCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLKSHQRKQVK 207

Query: 394 QREQSD 399
             ++++
Sbjct: 208 LAKKTE 213

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 36/53 (67%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           C +C K   R SSL  HM +HTG++PY C +  C K+FN KSNM RHYKLH K
Sbjct: 175 CKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFK 227

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 37/58 (63%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           K K  C +C K   R SSL  HM +HTG +PY C +  C K+FN KSNM RHYKLH K
Sbjct: 275 KVKYCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKLHFK 332

>SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {ON}
           conserved hypothetical protein
          Length = 288

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (60%), Gaps = 5/74 (6%)

Query: 330 KVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           + K ++ CP CGK+  R S+L  H  +H G  PY C W  C K FNVK N+ RHY++H K
Sbjct: 213 RPKLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTK 272

Query: 390 KEKEQREQSDGVET 403
           K     +++ GV+T
Sbjct: 273 K-----KEASGVKT 281

>Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 36] FULL
          Length = 302

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 34/55 (61%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKE 391
           C  CGK   R SSL  H   HTGD+PY C +  C K FN +SNM RHYKLH K +
Sbjct: 200 CTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLHFKTD 254

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 48/91 (52%)

Query: 316 NNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFN 375
           N  L  A N ++      K  C IC K   R SSL  HM +HTG +PYLC +  C K FN
Sbjct: 396 NTSLYSASNCMYPNPKNFKYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFN 455

Query: 376 VKSNMNRHYKLHLKKEKEQREQSDGVETAET 406
            KSNM RH+KLH +         +G+ T +T
Sbjct: 456 AKSNMLRHFKLHYRLPNGIYVLPNGIVTWKT 486

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (67%)

Query: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           K  C  C K   R SSL  HM +HTG++PY+C + +C K+FN KSNM RHYKLH K
Sbjct: 257 KYGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKLHFK 312

>SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 271

 Score = 70.1 bits (170), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 35/59 (59%)

Query: 329 KKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           K+V     CP C K   R S L  HM +H G  P+ CKWP C K FNVKSN+ RHY+ H
Sbjct: 210 KRVSYTYCCPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSH 268

>KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 4/71 (5%)

Query: 319 LIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKS 378
           L+P  + ++    +KK  C +CGK   R SSL  H  +HTG +P+ C   KC K FN +S
Sbjct: 221 LLPGKDGLY----RKKYCCNVCGKRFKRPSSLSTHTNIHTGKKPFHCPLAKCTKTFNARS 276

Query: 379 NMNRHYKLHLK 389
           NM RHYK H K
Sbjct: 277 NMLRHYKAHFK 287

>TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298
          Length = 833

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 49/84 (58%), Gaps = 7/84 (8%)

Query: 312 IFTSNNGLIPADNQVWTKKVKK------KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLC 365
           +FT N   + A N   TK+ +K      KN+C  C K   R SSL  H+ +HTG +P+ C
Sbjct: 686 LFTKNKSHL-AKNNSSTKQEEKLENKLTKNKCEYCLKKFRRPSSLKTHLNIHTGIQPFKC 744

Query: 366 KWPKCGKAFNVKSNMNRHYKLHLK 389
              +C K+FN +SNM RHYKLH K
Sbjct: 745 PSKRCDKSFNARSNMLRHYKLHFK 768

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 35/53 (66%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           C +CGK   R SSL  H  + +G+RPY C +  C K+FN KSNM RHYKLH +
Sbjct: 241 CDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLHFR 293

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 48/77 (62%), Gaps = 13/77 (16%)

Query: 314 TSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKA 373
           +SN GLI      +  K+     CP+CGK+ TR S+L  H+ +HT  +P+ C +  C K 
Sbjct: 161 SSNRGLI------FVSKI-----CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CEKE 207

Query: 374 FNVKSNMNRHYKLHLKK 390
           FNVKSN+NRH ++H +K
Sbjct: 208 FNVKSNLNRHERIHRQK 224

>Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to
           Ashbya gossypii ADL050W
          Length = 251

 Score = 67.0 bits (162), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 35/57 (61%)

Query: 331 VKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +  +  CPIC KT TR  S+  HM VHT  +PY C +P C K FNVK N+ RH K H
Sbjct: 151 ISSEKTCPICYKTFTRKISVNIHMVVHTNLKPYACDYPGCKKKFNVKGNLQRHSKCH 207

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 48/77 (62%), Gaps = 13/77 (16%)

Query: 314 TSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKA 373
           +SN GLI      +  K+     CP+CGK+ TR S+L  H+ +HT  +P+ C +  C K 
Sbjct: 157 SSNRGLI------FVSKI-----CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKE 203

Query: 374 FNVKSNMNRHYKLHLKK 390
           FNVKSN+NRH ++H +K
Sbjct: 204 FNVKSNLNRHERIHRQK 220

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C IC K+ TR +SL  HM +HT  +PY C +  C K FNVKSN+ RH ++H
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIH 168

>Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON}
           similar to Ashbya gossypii ADL051W
          Length = 223

 Score = 63.5 bits (153), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 37/58 (63%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQ 394
           C IC K+ TR +SL  HM +HT  +PY C + +C K FNVKSN+ RH ++H +    Q
Sbjct: 161 CHICLKSFTRKTSLQTHMLIHTKVKPYRCSYQRCNKTFNVKSNLYRHERIHKRNNSRQ 218

>SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 261

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 35/62 (56%)

Query: 329 KKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHL 388
           KK +    CP C K   R S+L  H  +H G  PY+C+ P C K FNVKSN+ RH K H 
Sbjct: 193 KKKEHGYSCPECEKVFGRPSALRTHSIIHIGKSPYICQLPGCAKRFNVKSNLLRHVKSHY 252

Query: 389 KK 390
            +
Sbjct: 253 GR 254

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 35/57 (61%), Gaps = 4/57 (7%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKE 393
           C ICGK   R S+L  HM VH  D+PY C+   C K FNVKSNM R    H++K KE
Sbjct: 251 CEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLR----HMRKHKE 303

>ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR015C
          Length = 281

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 32/51 (62%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C ICGK   R S+L  HM VH  D+PY C+   C K FNVKSNM RH + H
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKH 277

>Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027W
           (REAL)
          Length = 673

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 309 QNGIFT--SNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCK 366
            NG+F+   N+ L   DN    +K      C +CGK  TR  +L  H+  HT +RP++C 
Sbjct: 536 DNGLFSLKKNDNLEKVDNTTNNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICS 595

Query: 367 WPKCGKAFNVKSNMNRHYKLHLKKEK 392
              CGKAF  + +  RH  LH  K++
Sbjct: 596 I--CGKAFARQHDRKRHEDLHTGKKR 619

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 15/80 (18%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCK--------WPKCGKAFNVKSNMNRHYKLHL 388
           C ICGK   R      H  +HTG + Y+C         W  CGK F     + RH+K   
Sbjct: 594 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFKTES 652

Query: 389 KKE------KEQREQSDGVE 402
            +       +E R++  G E
Sbjct: 653 GRRCITPLYEEARQEKSGQE 672

>NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON}
           Anc_1.326
          Length = 773

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 6/79 (7%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQR 395
           +C ICGK    SSSL  H+  HTG++P  CK   CGKAFN  SN+++H K HLK+ K ++
Sbjct: 696 KCDICGKRFAISSSLKIHIRTHTGEKPLHCKI--CGKAFNESSNLSKHMKTHLKRFKCEK 753

Query: 396 EQSDGVETAETLSPLQREQ 414
            ++    +  T+S L+  Q
Sbjct: 754 CEA----SFNTVSKLRSHQ 768

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C K  ++   L+ HM VH+G +P+ C    C K F+ +  + +H + H
Sbjct: 644 CHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERTH 689

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 40/64 (62%)

Query: 330 KVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           ++++K  C +CGK  T S  L  H  +HTG++ ++C +  CG+ FN   N  +HYK HLK
Sbjct: 397 ELRRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHLK 456

Query: 390 KEKE 393
           + KE
Sbjct: 457 RLKE 460

>Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON}
           (53205..55598) [2394 nt, 798 aa]
          Length = 797

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 56/127 (44%), Gaps = 18/127 (14%)

Query: 268 AGPIFQQSLNIPPHYRYSSNVQPVYLTPIQSCGYANSPLSYQNGIFTSNNGLIPADNQVW 327
            G  F Q   I  H R  S  +P      +SC          N  F S   LI       
Sbjct: 654 CGHKFTQRQKILRHIRVHSGFKPF---KCESC----------NKTFASEENLIQHKR--- 697

Query: 328 TKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           T   +K   C ICG   +  S L  H+ +HTG++P  CK   CGK F+  SN+N+HYK H
Sbjct: 698 THSGEKPFVCQICGSKFSSPSYLKVHIRIHTGEKPLSCK--VCGKKFSSSSNLNKHYKTH 755

Query: 388 LKKEKEQ 394
            KK K Q
Sbjct: 756 YKKYKCQ 762

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 42/85 (49%), Gaps = 3/85 (3%)

Query: 303 NSPLSYQNGIFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRP 362
           N+P S  NG  T N+G   A          + + CPICG+   R      HM  HTG++P
Sbjct: 14  NNPSSVTNGSSTPNSGKSKAGKG---DDAPRPHVCPICGRAFHRLEHQTRHMRTHTGEKP 70

Query: 363 YLCKWPKCGKAFNVKSNMNRHYKLH 387
           + C +P C K F+    + RH ++H
Sbjct: 71  HACDFPGCVKRFSRSDELTRHRRIH 95

>ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 849

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 41/65 (63%), Gaps = 2/65 (3%)

Query: 328 TKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           T   +K  +C +CGK+ + SSSL  H+  HTG++P  CK   CGK FN  SN+N+H K H
Sbjct: 756 THSGEKPFKCHLCGKSFSVSSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLNKHLKTH 813

Query: 388 LKKEK 392
            KK K
Sbjct: 814 RKKYK 818

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +C +C K+ +   +L  HM  H+G++P+ C    CGK+F+V S++  H + H
Sbjct: 736 KCQVCLKSFSSEDTLNQHMRTHSGEKPFKCHL--CGKSFSVSSSLKIHIRTH 785

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C +  T+   ++ H+ VH+G +P+ C+   C K+F+ +  +N+H + H
Sbjct: 712 CCRKFTQRQKMVRHLKVHSGYKPFKCQ--VCLKSFSSEDTLNQHMRTH 757

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 25/61 (40%)

Query: 327 WTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKL 386
           +TK   + + C  C       S+ L    +  G   Y C W  C + F  +  M RH K+
Sbjct: 669 FTKLQCQWDGCDQCFSGAEDLSNHLEKFHLPRGKSEYHCHWKGCCRKFTQRQKMVRHLKV 728

Query: 387 H 387
           H
Sbjct: 729 H 729

>AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR043C (NRG1) and
           YBR066C (NRG2)
          Length = 140

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 36/59 (61%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           ++K+ C  CGK  T S  L  H  +HTG++ + C +P CG+ F+   N  +HY+ HLK+
Sbjct: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKR 135

>Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar to
           Ashbya gossypii AGR031W
          Length = 257

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 318 GLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVK 377
           GL P    V  +K ++K++C  C K  T S  L  H  +HTG++ + C +P CG+ F+  
Sbjct: 177 GLDPGGAHVPIEK-RRKHRCQTCDKGFTTSGHLARHNRIHTGEKNHRCHFPGCGQRFSRH 235

Query: 378 SNMNRHYKLHLKK 390
            N  +HY+ HLKK
Sbjct: 236 DNCLQHYRTHLKK 248

>Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 bp,
           515 aa] {ON} YGL035C (REAL)
          Length = 515

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 312 IFTSNNGLIPADNQVWTKKVKKK-----NQCPICGKTVTRSSSLLPHMFVHTGDRPYLCK 366
           +  +++G +  DNQ  +K   K      + CPIC +   R      HM +HTG++P+ C 
Sbjct: 10  VSNADDGSLLRDNQSKSKTAMKSEAPRPHACPICQRAFHRLEHQTRHMRIHTGEKPHACD 69

Query: 367 WPKCGKAFNVKSNMNRHYKLH 387
           +P C K F+    + RH ++H
Sbjct: 70  FPGCVKRFSRSDELTRHRRIH 90

>NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa]
           {ON} Anc_1.326
          Length = 836

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           QC +C K  T +SSL  H+  HTG++P  CK   CGKAFN  SN+++H K H K
Sbjct: 767 QCHLCDKRFTIASSLKIHIRTHTGEKPLKCKI--CGKAFNESSNLSKHIKTHFK 818

 Score = 37.0 bits (84), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C K  T+   ++ H+ VH+G +P  CK P C K F+    + +H + H
Sbjct: 715 CSKKFTQRQKMVRHLKVHSGYKP--CKCPVCNKCFSNLETLKQHQRTH 760

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 7/79 (8%)

Query: 312 IFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHM---FVHTGDRPYLCKWP 368
           I  +++ ++P  N++ T K     +  +C +       L  H+    +  G   Y C W 
Sbjct: 658 IKNNDSTVLPISNKLGTIKC----EWGLCDQVFNSKEDLNTHLENDHLLKGQSQYQCHWH 713

Query: 369 KCGKAFNVKSNMNRHYKLH 387
            C K F  +  M RH K+H
Sbjct: 714 GCSKKFTQRQKMVRHLKVH 732

>Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 aa]
           {ON} YNL027W (REAL)
          Length = 681

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 316 NNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFN 375
           N+ L   DN    +K      C +CGK  TR  +L  H+  HT +RP++C    CGKAF 
Sbjct: 553 NDDLERLDNLTNNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFA 610

Query: 376 VKSNMNRHYKLHLKKEK 392
            + +  RH  LH  K++
Sbjct: 611 RQHDRKRHEDLHTGKKR 627

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 15/81 (18%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCK--------WPKCGKAFNVKSNMNRHYKLHL 388
           C ICGK   R      H  +HTG + Y+C         W  C K F     + RH+K   
Sbjct: 602 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCSKKFARSDALGRHFKTES 660

Query: 389 KKE------KEQREQSDGVET 403
            +       +E R++  G +T
Sbjct: 661 GRRCITPLYEEARQEKSGQDT 681

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 8/81 (9%)

Query: 309 QNGIFTSNNGL--IPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCK 366
           ++ +    +GL  IP +N        + + CP+CG+   R      HM  HTG++P+ C 
Sbjct: 21  ESDLMVEESGLKKIPGEN------APRPHVCPVCGRAFHRLEHQTRHMRTHTGEKPHACD 74

Query: 367 WPKCGKAFNVKSNMNRHYKLH 387
           +P C K F+    + RH ++H
Sbjct: 75  FPGCTKRFSRSDELTRHKRIH 95

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 54/117 (46%), Gaps = 18/117 (15%)

Query: 271 IFQQSLNIPPHYRYSSNVQPVYLTPIQSCGYANSPLSYQNGIFTSNNGLIPADNQVWTKK 330
           +F+Q   I  H +  S  +P        C             F+S   LI       T  
Sbjct: 880 VFKQRQKILRHLKTHSGFKPFKCDVCSRC-------------FSSKETLIQ---HYRTHS 923

Query: 331 VKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
            +K  +C ICGK+ + SSSL  H+  HTG++P+ CK   CGK F   SN ++H K+H
Sbjct: 924 GEKPYKCEICGKSFSISSSLKIHVRTHTGEKPFECKV--CGKRFVESSNYSKHMKVH 978

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C K   +   +L H+  H+G +P+ C    C + F+ K  + +HY+ H
Sbjct: 877 CHKVFKQRQKILRHLKTHSGFKPFKCDV--CSRCFSSKETLIQHYRTH 922

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 14/29 (48%)

Query: 359 GDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           G   Y CKW  C K F  +  + RH K H
Sbjct: 866 GKNSYECKWHNCHKVFKQRQKILRHLKTH 894

>Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027W
           (REAL)
          Length = 682

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 323 DNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNR 382
           DN    +K      C +CGK  TR  +L  H+  HT +RP++C    CGKAF  + +  R
Sbjct: 561 DNSANNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKR 618

Query: 383 HYKLHLKKEK 392
           H  LH  K++
Sbjct: 619 HEDLHTGKKR 628

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 9/57 (15%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCK--------WPKCGKAFNVKSNMNRHYK 385
           C ICGK   R      H  +HTG + Y+C         W  CGK F     + RH+K
Sbjct: 603 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFK 658

>TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {ON}
           Anc_1.326 YJL056C
          Length = 755

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 54/119 (45%), Gaps = 18/119 (15%)

Query: 272 FQQSLNIPPHYRYSSNVQPVYLTPIQSCGYANSPLSYQNGIFTSNNGLIPADNQVWTKKV 331
           F Q   +  H +  S  +P      Q CG            F+S + L        T   
Sbjct: 628 FAQRQKLVRHLKVHSGYKPY---KCQDCG----------KCFSSEDTLT---QHKRTHSG 671

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           +K  +C ICGK    SSSL  H+  HTG++P  CK   CG+ F+  SN+N+H K H KK
Sbjct: 672 EKPFECRICGKRFAVSSSLKIHIRTHTGEKPLQCKI--CGRRFSESSNLNKHMKSHQKK 728

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 16/114 (14%)

Query: 277 NIP-PHYRYSSNVQPVYLTPIQSCGYANSPLSYQNGIFTSNNGLIPADNQVWTKKVKKKN 335
           NIP P  + S N+      P  +C + +        +F S   L      +  +K K + 
Sbjct: 569 NIPQPKSQSSDNI------PYFACKWGDC-----TEVFDSAAALTTHLEALHLEKGKSEY 617

Query: 336 QCPI--CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
            C    C K   +   L+ H+ VH+G +PY C+   CGK F+ +  + +H + H
Sbjct: 618 HCHWHGCDKRFAQRQKLVRHLKVHSGYKPYKCQ--DCGKCFSSEDTLTQHKRTH 669

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           CPIC +   R      H+  HTG++P+ C++P CGK F+    + RH ++H
Sbjct: 36  CPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

>YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}
           CRZ1Transcription factor that activates transcription of
           genes involved in stress response; nuclear localization
           is positively regulated by calcineurin-mediated
           dephosphorylation
          Length = 678

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           C +CGK  TR  +L  H+  HT +RP++C    CGKAF  + +  RH  LH  K++
Sbjct: 571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKKR 624

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 15/81 (18%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCK--------WPKCGKAFNVKSNMNRHYKLHL 388
           C ICGK   R      H  +HTG + Y+C         W  CGK F     + RH+K   
Sbjct: 599 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFKTES 657

Query: 389 KKE------KEQREQSDGVET 403
            +       +E R++  G E+
Sbjct: 658 GRRCITPLYEEARQEKSGQES 678

>KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON}
           Anc_3.281 YBR066C
          Length = 224

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 41/70 (58%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKE 391
           ++K+ C +C    T S  L  H  +HTG++ Y+C +  CG+ F+   N  +H+K HL+K+
Sbjct: 155 QRKHVCKVCTMAFTTSGHLSRHNKIHTGEKKYVCPFEGCGQRFSRHDNCVQHHKTHLRKK 214

Query: 392 KEQREQSDGV 401
           +  + +S  +
Sbjct: 215 ENSKSKSTSI 224

>Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {ON}
           YJL056C (REAL)
          Length = 885

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 44/81 (54%), Gaps = 5/81 (6%)

Query: 312 IFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCG 371
            F+S   L+       T   +K  +C IC K  + SSSL  H+  HTG++P  CK   CG
Sbjct: 779 CFSSEETLV---QHTRTHSGEKPYKCDICNKKFSISSSLKIHIRTHTGEKPLQCKI--CG 833

Query: 372 KAFNVKSNMNRHYKLHLKKEK 392
           K FN  SN+++H K H KK K
Sbjct: 834 KRFNESSNLSKHIKTHKKKYK 854

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C +T  +   L+ H+ VH+  +PY CK   C + F+ +  + +H + H
Sbjct: 748 CHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTH 793

>KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weakly
           similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131C ACE2 Transcription factor that activates
           expression of early G1-specific genes localizes to
           daughter cell nuclei after cytokinesis and delays G1
           progression in daughters localization is regulated by
           phosphorylation potential Cdc28p substrate
          Length = 746

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 319 LIPADNQVWTKKVKKKN-QC--PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFN 375
           L P +   + K++  K  +C  P CGK   R  ++  H+  H  DRPY+C +P C KAF 
Sbjct: 566 LPPGEIDKYVKELPDKTFECLHPDCGKNFRRRYNIRSHIQTHLEDRPYICDFPDCNKAFV 625

Query: 376 VKSNMNRHYKLHLKK 390
              ++ RH K H +K
Sbjct: 626 RNHDLIRHKKTHAEK 640

>Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa]
           {ON} (16151..16525,16527..17390) [1239 nt, 413 aa]
          Length = 412

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 5/94 (5%)

Query: 322 ADNQVWTKKVKKKNQ-CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNM 380
           A+N V   K K +   CPIC +   R      HM  HTG++P+ C +P C K F+    +
Sbjct: 25  ANNTVAKPKEKPRPHVCPICNRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDEL 84

Query: 381 NRHYKLHLK---KEKEQREQSDGVETAETLSPLQ 411
            RH ++H     + K  R++   V TA   +P Q
Sbjct: 85  TRHRRIHTNPNPRGKRGRKKK-VVPTASPTNPTQ 117

>Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C
           (ZAP1) - Metalloregulatory protein involved in
           zinc-responsive transcriptional regulation [contig 224]
           FULL
          Length = 711

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 40/68 (58%), Gaps = 2/68 (2%)

Query: 328 TKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           T   +K  +C  CGK    SSSL  H+  HTG++P  CK   CGK FN  SN+++H + H
Sbjct: 627 THSGEKPYKCSHCGKGFATSSSLRIHIRTHTGEKPLECK--VCGKRFNESSNLSKHMRTH 684

Query: 388 LKKEKEQR 395
            +K K Q+
Sbjct: 685 ERKYKCQK 692

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           K  +C  C KT +    L  HM  H+G++PY C    CGK F   S++  H + H
Sbjct: 604 KPCKCVHCLKTFSTQDILQQHMRTHSGEKPYKCS--HCGKGFATSSSLRIHIRTH 656

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           CG+ +T+   LL H+ VHT  +P  CK   C K F+ +  + +H + H
Sbjct: 583 CGRVITQRQKLLRHLRVHTRYKP--CKCVHCLKTFSTQDILQQHMRTH 628

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 33/75 (44%), Gaps = 5/75 (6%)

Query: 317 NGLIP--ADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAF 374
           N LIP   DNQ   K + + + C     +    ++ +    +  G   Y+C W  CG+  
Sbjct: 531 NSLIPNETDNQ---KHICRWDACMQEFSSCEELNTHIEKEHIPRGKSSYVCGWENCGRVI 587

Query: 375 NVKSNMNRHYKLHLK 389
             +  + RH ++H +
Sbjct: 588 TQRQKLLRHLRVHTR 602

>Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON}
           YGL035C (REAL)
          Length = 502

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           CPIC +   R      HM +HTG++P+ C +P C K F+    + RH ++H
Sbjct: 40  CPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON}
           YGL035C (REAL)
          Length = 505

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           CPIC +   R      HM +HTG++P+ C +P C K F+    + RH ++H
Sbjct: 40  CPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C
           (REAL)
          Length = 878

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 312 IFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCG 371
            F+S   L+       T   +K  +C IC K    SSSL  H+  HTG++P  CK   CG
Sbjct: 774 CFSSEETLV---QHTRTHSGEKPYKCHICDKKFAISSSLKIHIRTHTGEKPLQCKI--CG 828

Query: 372 KAFNVKSNMNRHYKLHLKKEK 392
           K FN  SN+++H K H KK K
Sbjct: 829 KRFNESSNLSKHIKTHKKKYK 849

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C +T  +   L+ H+ VH+  +PY CK   C + F+ +  + +H + H
Sbjct: 743 CHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTH 788

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 329 KKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHL 388
           K   + + CPIC +   R      H+  HTG++P+ C +P C K F+    + RH ++H 
Sbjct: 23  KDAPRPHVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRIHT 82

Query: 389 ---KKEKEQREQSDGVE 402
               + K  R++   VE
Sbjct: 83  NPHPRAKRGRKKKIPVE 99

>KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.80
           YGL035C
          Length = 335

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 10/78 (12%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHL-------- 388
           CPIC +   R      HM  HTG++P+ C +P C K F+    + RH ++H         
Sbjct: 23  CPICQRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNTQPRGKR 82

Query: 389 --KKEKEQREQSDGVETA 404
             KK+ +  E ++GV T 
Sbjct: 83  GRKKKVQPIEDTNGVATT 100

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           C IC K  TR  +L  H+  HT +RPY+C    CGKAF    + NRH  LH  K +
Sbjct: 471 CDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLHTGKRR 524

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 28/63 (44%), Gaps = 9/63 (14%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLC--------KWPKCGKAFNVKSNMNRHYKLHL 388
           C +CGK   R      H  +HTG R Y+C         W  CGK F     + RH+K  L
Sbjct: 499 CSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSW-GCGKKFARSDALGRHFKTEL 557

Query: 389 KKE 391
            K+
Sbjct: 558 GKK 560

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 18/92 (19%)

Query: 312 IFTSNNG--LIPADNQVWTKKVK--------------KKNQCPICGKTVTRSSSLLPHMF 355
           I T+N+G  L+ A+ ++  ++++              K+++C IC K   + + L  H+ 
Sbjct: 349 IVTTNDGRLLLDANPEILPRRIELVGGVEKPIGANGIKQHECNICHKLFIQLTHLEVHLR 408

Query: 356 VHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
            H GD+PY C W  CGK F    N+  H +LH
Sbjct: 409 SHLGDKPYKCTW--CGKGFTQGGNLKTHVRLH 438

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           +C  CGK  T+  +L  H+ +HTG++P+ C++  C K F+ K N+  H   H K
Sbjct: 417 KCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEF--CSKRFSRKGNLTAHLVTHEK 468

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLKKEKEQR 395
           C  C K  +R  +L  H+  H   RP++CK   C K F    NM  H  + H     E  
Sbjct: 446 CEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFHQNTLTELT 505

Query: 396 EQSDGVETAETLSPLQRE 413
            +   ++ AE +S  +RE
Sbjct: 506 RRLANLDPAENISAEERE 523

>Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056C
           (REAL)
          Length = 879

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 312 IFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCG 371
            F+S   L+       T   +K  +C IC K    SSSL  H+  HTG++P  CK   CG
Sbjct: 775 CFSSEETLV---QHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CG 829

Query: 372 KAFNVKSNMNRHYKLHLKKEK 392
           K FN  SN+++H K H KK K
Sbjct: 830 KRFNESSNLSKHIKTHKKKYK 850

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C +T  +   L+ H+ VH+  +PY CK   C + F+ +  + +H + H
Sbjct: 744 CHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTH 789

>YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}
           MIG1Transcription factor involved in glucose repression;
           sequence specific DNA binding protein containing two
           Cys2His2 zinc finger motifs; regulated by the SNF1
           kinase and the GLC7 phosphatase
          Length = 504

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           + + CPIC +   R      HM +HTG++P+ C +P C K F+    + RH ++H
Sbjct: 36  RPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON}
           ZAP1Zinc-regulated transcription factor; binds to
           zinc-responsive promoters to induce transcription of
           certain genes in presence of zinc, represses other genes
           in low zinc; regulates its own transcription; contains
           seven zinc-finger domains
          Length = 880

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 312 IFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCG 371
            F+S   L+       T   +K  +C IC K    SSSL  H+  HTG++P  CK   CG
Sbjct: 776 CFSSEETLV---QHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CG 830

Query: 372 KAFNVKSNMNRHYKLHLKKEK 392
           K FN  SN+++H K H KK K
Sbjct: 831 KRFNESSNLSKHIKTHQKKYK 851

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C +T  +   L+ H+ VH+  +PY CK   C + F+ +  + +H + H
Sbjct: 745 CHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTH 790

>ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 329

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           CPIC +   R      HM  HTG++P++C +  CGK F+    + RH ++H
Sbjct: 19  CPICHRAFHRLEHQTRHMRTHTGEKPHVCDFKNCGKRFSRSDELTRHRRIH 69

>TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.281
           YBR066C
          Length = 314

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           KKK  C +C K +T S  L  H  +HTG++ Y C    C + F+   N  +HYK HLK
Sbjct: 253 KKKYICKVCSKGLTTSGHLARHYRIHTGEKNYSCLHEGCDQKFSRHDNCKQHYKTHLK 310

>KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {ON}
           Anc_3.281 YBR066C
          Length = 280

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 37/65 (56%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           +K QC  C    T S  L  H  +HTG++ Y+C    CG+ F+   N  +HY+ HLKK++
Sbjct: 210 RKFQCKTCSMAFTTSGHLSRHNKIHTGEKNYVCPHESCGQRFSRHDNCIQHYRTHLKKKQ 269

Query: 393 EQREQ 397
            Q ++
Sbjct: 270 RQAKK 274

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           QC  CGK  T+  +L  H+ +HTG+RPY C   KCGK F+ K N+  H   H
Sbjct: 520 QCEYCGKRFTQGGNLRTHVRLHTGERPYECD--KCGKRFSRKGNLAAHMLTH 569

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           K+++CP C K  T+S+ L  H+  H G +P+ C++  CGK F    N+  H +LH
Sbjct: 489 KQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 541

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLK 389
           +C  CGK  +R  +L  HM  H   +P+ CK   C K+F    NM  H  + HL+
Sbjct: 548 ECDKCGKRFSRKGNLAAHMLTHENHKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQ 602

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           QC  CGK  T+  +L  H+ +HTG+RPY C   KCGK F+ K N+  H   H
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYECD--KCGKRFSRKGNLAAHMLTH 565

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           K+++CP C K  T+S+ L  H+  H G +P+ C++  CGK F    N+  H +LH
Sbjct: 485 KQHKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 537

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLK 389
           +C  CGK  +R  +L  HM  H   +P+ CK   C K+F    NM  H  + HL+
Sbjct: 544 ECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQ 598

>ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} similar
           to uniprot|Q288C3 Torulaspora delbrueckii CRZ1
           Calcineurin-responsive zinc finger transcription factor
           and some similarites with YNL027W uniprot|P53968
           Saccharomyces cerevisiae YNL027W CRZ1 Transcription
           factor that activates transcription of genes involved in
           stress response nuclear localization is positively
           regulated by calcineurin-mediated dephosphorylation
          Length = 619

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 6/68 (8%)

Query: 329 KKVKKKN----QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY 384
           K++ +KN     C +CGK  TR  +L  H+  HT +RP+ C    CGKAF  + +  RH 
Sbjct: 498 KRLSQKNPAAFACELCGKRFTRPYNLKSHLRTHTNERPFECSI--CGKAFARQHDRKRHE 555

Query: 385 KLHLKKEK 392
            LH  K++
Sbjct: 556 DLHTGKKR 563

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 9/58 (15%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLC--------KWPKCGKAFNVKSNMNRHYK 385
           +C ICGK   R      H  +HTG + Y+C         W  CGK F     + RH+K
Sbjct: 537 ECSICGKAFARQHDRKRHEDLHTGKKRYVCGGTLKNGSSW-GCGKKFARSDALGRHFK 593

>AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL035C
           (MIG1)
          Length = 389

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH---LKKEKE 393
           CPIC +   R      H+  HTG++P+ C +  CGK F+ +  + RH ++H     K K 
Sbjct: 24  CPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIHESDRPKGKR 83

Query: 394 QREQSDGVETAETLSPL 410
            R ++   E A    P+
Sbjct: 84  GRRKAHSDEGAARAPPV 100

>KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON}
           uniprot|P50898 Kluyveromyces lactis MIG1 Regulatory
           protein MIG1
          Length = 474

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           CPIC +   R      H+  HTG+RP+ C +P C K F+    + RH ++H
Sbjct: 28  CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH 78

>KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]
           {ON} some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters
          Length = 357

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKE 391
           ++K  C IC +  T S  L  H  +HTG++ + C++P C + F+   N  +HY+ H K  
Sbjct: 281 RRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYRTHFKNN 340

Query: 392 KEQREQSDGVET 403
               EQ   + T
Sbjct: 341 PMPEEQQPSINT 352

>CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} similar
           to uniprot|P47043 Saccharomyces cerevisiae YJL056c ZAP1
           metalloregulatory protein
          Length = 713

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 51/119 (42%), Gaps = 18/119 (15%)

Query: 272 FQQSLNIPPHYRYSSNVQPVYLTPIQSCGYANSPLSYQNGIFTSNNGLIPADNQVWTKKV 331
           F Q   +  H +  S  +P      Q C      L+    + +                 
Sbjct: 578 FSQRQKLVRHLKVHSKYKPYQCPQCQKCFSTEDTLNQHKRVHSG---------------- 621

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           +K  +C IC K    S+SL  H+  HTG++P  CK   CG+ FN  SN+++H K H+KK
Sbjct: 622 EKPYECHICHKRFAISNSLKIHIRTHTGEKPLKCK--VCGRCFNESSNLSKHMKTHMKK 678

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C KT ++   L+ H+ VH+  +PY C  P+C K F+ +  +N+H ++H
Sbjct: 574 CNKTFSQRQKLVRHLKVHSKYKPYQC--PQCQKCFSTEDTLNQHKRVH 619

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 351 LPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQREQSDGV-ETAETLSP 409
           L  M +  G   Y C+W  C K F+ +  + RH K+H K +  Q  Q      T +TL+ 
Sbjct: 555 LEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSKYKPYQCPQCQKCFSTEDTLNQ 614

Query: 410 LQR 412
            +R
Sbjct: 615 HKR 617

>Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W
           (FZF1) - putative transcription factor, has five zinc
           fingers [contig 41] FULL
          Length = 285

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 302 ANSPLSYQNGIFTSNNGLIPADNQVWTKKVKKKNQCPI--CGKTVTRSSSLLPHMFVHTG 359
           ++SP +  + + TS+   IP+     +++  KK  CPI  C K   + SSL  H+  H  
Sbjct: 3   SSSPRNLISALVTSSYT-IPSTTWSMSRECDKKYICPITSCNKRYRKPSSLREHVNSHNN 61

Query: 360 DRPYLCKWPKCGKAFNVKSNMNRHYKLHLK-KEKEQREQSDGVETAETLS 408
           +RP+ C  P CGK F    +MN H   H K K  +  E S G  T + LS
Sbjct: 62  NRPFACPEPNCGKRFLRVCHMNVHRWTHSKIKPLKCEECSKGFTTKQQLS 111

>KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 682

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 325 QVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY 384
            + T   +K  +C  CGK    SSSL  H+  HTG++P  CK   CGK FN  SN+++H 
Sbjct: 595 HIRTHSGEKPYKCVHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFNESSNLSKHM 652

Query: 385 KLHLKKEK 392
           + H +K K
Sbjct: 653 RTHERKYK 660

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           CGK +T+   LL H+ VHT  +P  CK P C K F+ +  + +H + H
Sbjct: 554 CGKVITQRQKLLRHLRVHTRYKP--CKCPHCAKTFSTQDILQQHIRTH 599

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           K  +CP C KT +    L  H+  H+G++PY C    CGK F   S++  H + H
Sbjct: 575 KPCKCPHCAKTFSTQDILQQHIRTHSGEKPYKCV--HCGKGFATSSSLRIHIRTH 627

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 16/31 (51%)

Query: 359 GDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           G   Y+C W  CGK    +  + RH ++H +
Sbjct: 543 GKSSYVCGWENCGKVITQRQKLLRHLRVHTR 573

>KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 460

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 8/86 (9%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHL-------- 388
           CPIC +   R      H+  HTG++P+ C +P C K F+    + RH ++H         
Sbjct: 28  CPICSRAFHRLEHQTRHIRTHTGEKPHACDFPGCTKKFSRSDELTRHKRIHTNPHPKGKR 87

Query: 389 KKEKEQREQSDGVETAETLSPLQREQ 414
            ++K+   QS G +TA     L RE+
Sbjct: 88  GRKKKTETQSSGADTAVQQGNLPRER 113

>Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 36/62 (58%)

Query: 330 KVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           ++++K  C IC +  T S  L  H  +HTG++ + C +  C + F+   N  +HY+ HLK
Sbjct: 169 ELRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLK 228

Query: 390 KE 391
           KE
Sbjct: 229 KE 230

>NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303
          Length = 571

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           C +C KT TR  +L  H+  HT ++P++C    CGKAF  + +  RH  LH  K++
Sbjct: 454 CELCDKTFTRPYNLKSHLRTHTNEKPFVCNI--CGKAFARQHDRKRHEDLHTGKKR 507

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 9/57 (15%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCK--------WPKCGKAFNVKSNMNRHYK 385
           C ICGK   R      H  +HTG + Y+C         W  C K F     + RH+K
Sbjct: 482 CNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPW-GCHKKFARSDALGRHFK 537

>Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON}
           (114648..116492) [1845 nt, 615 aa]
          Length = 614

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 329 KKVKKKN----QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY 384
           +K  +KN     CP+C K  TR  +L  H   HT +RP+ C   +CGK F  + +  RH 
Sbjct: 483 RKFSQKNPSIYACPVCDKKFTRPYNLKSHKRTHTNERPFSCS--QCGKTFAREHDRKRHE 540

Query: 385 KLHLKKEK 392
            LH  K++
Sbjct: 541 DLHTGKKR 548

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 9/57 (15%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLC--------KWPKCGKAFNVKSNMNRHYK 385
           C  CGKT  R      H  +HTG + Y+C         W  CGK F     + RH+K
Sbjct: 523 CSQCGKTFAREHDRKRHEDLHTGKKRYVCGGKLKSGESW-GCGKRFARSDALGRHFK 578

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           +C  C K  T SSSL  H+  HTG++P  C    CGK FN  SN+++H K+H +K
Sbjct: 575 KCQFCDKRFTTSSSLRIHIRTHTGEKPLACN--VCGKRFNESSNLSKHMKIHERK 627

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C K   +   LL H+ VHTG +P+ C  P C K F+ +  +++H + H
Sbjct: 523 CTKHFAQRQKLLRHIKVHTGYKPFKC--PHCSKTFSTEDILSQHIRTH 568

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 8/54 (14%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           C +CGK    SS+L  HM +H  +R Y+CK   C ++F+      + Y +H+ K
Sbjct: 604 CNVCGKRFNESSNLSKHMKIH--ERKYMCK--HCKRSFDRL----QQYNIHIAK 649

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 3/51 (5%)

Query: 340 CGKTVTRSSSLLPHM---FVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C +T      L  H+    V TG   Y C+W  C K F  +  + RH K+H
Sbjct: 490 CHQTCKSRQELNEHIEAIHVPTGQSSYQCRWDGCTKHFAQRQKLLRHIKVH 540

>KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {ON}
           Anc_1.326 YJL056C
          Length = 746

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 49/122 (40%), Gaps = 18/122 (14%)

Query: 268 AGPIFQQSLNIPPHYRYSSNVQPVYLTPIQSCGYANSPLSYQNGIFTSNNGLIPADNQVW 327
            G  F Q   I  H +  +  +P      Q C  ++  L     I +             
Sbjct: 618 CGKTFTQRQKIARHLKVHTRYKPYKCPQCQKCFSSDETLKQHLRIHSG------------ 665

Query: 328 TKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
               +K   C ICGK    SSSL  H+  HTG++P  C    CGK F   SN+N+H K H
Sbjct: 666 ----EKPYHCDICGKRFAISSSLKIHVRTHTGEKPLQCA--VCGKRFIESSNLNKHMKTH 719

Query: 388 LK 389
            K
Sbjct: 720 EK 721

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 359 GDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           G   Y C W  CGK F  +  + RH K+H +
Sbjct: 607 GQSQYTCSWAGCGKTFTQRQKIARHLKVHTR 637

>CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakly
           similar to uniprot|P53968 Saccharomyces cerevisiae
           YNL027w CRZ1
          Length = 645

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           C +CGK  +R  +L  H+  HT ++PY C    CGKAF  + +  RH  LH  K++
Sbjct: 523 CEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLHTGKKR 576

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 9/68 (13%)

Query: 326 VWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCK--------WPKCGKAFNVK 377
           + T   +K  QC ICGK   R      H  +HTG + Y+C         W  CGK F   
Sbjct: 540 LRTHTDEKPYQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFW-GCGKKFARS 598

Query: 378 SNMNRHYK 385
             + RH+K
Sbjct: 599 DALGRHFK 606

>NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {ON}
           Anc_2.303 YNL027W
          Length = 708

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           C +C KT TR  +L  H+  HT ++P++CK   C KAF  + +  RH  LH  K++
Sbjct: 582 CELCNKTFTRPYNLKSHLRTHTNEKPFICKI--CNKAFARQHDRKRHEDLHTGKKR 635

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 26/63 (41%), Gaps = 9/63 (14%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLC--------KWPKCGKAFNVKSNMNRHYKLHL 388
           C IC K   R      H  +HTG + Y+C         W  CGK F     + RH+K   
Sbjct: 610 CKICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGDTW-GCGKKFARSDALGRHFKTES 668

Query: 389 KKE 391
            K+
Sbjct: 669 GKK 671

>Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON}
           (58087..59160) [1074 nt, 358 aa]
          Length = 357

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 311 GIFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKC 370
           GI +S   ++ AD     K+  +K  C +C K +T S  L  H  +HTG++ + C +  C
Sbjct: 282 GIESSRTHILKAD---IVKR--RKYICRVCSKGLTTSGHLARHYRIHTGEKNHFCPYEGC 336

Query: 371 GKAFNVKSNMNRHYKLHLKKE 391
            + F+   N  +HY+ HLKK 
Sbjct: 337 NQRFSRHDNCIQHYRTHLKKR 357

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           QC  CGK  T+  +L  H  +HTG++PY C+  KCGK F+ K N+  H   H
Sbjct: 569 QCEYCGKRFTQGGNLRTHTRLHTGEKPYSCE--KCGKRFSRKGNLAAHMLTH 618

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           K+++CP C K  T+S+ L  H+  H G +P+ C++  CGK F    N+  H +LH
Sbjct: 538 KQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHTRLH 590

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLKKEKEQR 395
           C  CGK  +R  +L  HM  H   +PY CK   C K+F    N+  H  + HL+   +  
Sbjct: 598 CEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFHLQTLNQLT 657

Query: 396 EQSDGVETAETLSPLQR 412
           ++   ++  E + P +R
Sbjct: 658 QRLAEMDPNENIDPDER 674

>ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 930

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLKK 390
           +K  +C +CGK  +R  +L  H+  H   +P++CK   C K F    NM  H  + HL  
Sbjct: 615 EKPYECELCGKRFSRKGNLAAHIVTHQKLKPFVCKLDGCNKTFTQLGNMKAHQNRFHLNT 674

Query: 391 EKEQREQSDGVETAETLSPLQRE 413
             E  ++   ++  E ++P +RE
Sbjct: 675 LNELTQRLAEMDPQEDIAPDERE 697

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           C  CGK  T+  +L  H  +HTG++PY C+   CGK F+ K N+  H   H K
Sbjct: 592 CECCGKRFTQGGNLRTHQRLHTGEKPYECEL--CGKRFSRKGNLAAHIVTHQK 642

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 45/83 (54%), Gaps = 9/83 (10%)

Query: 312 IFTSNNGLIPADNQV--WTKKVK-----KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYL 364
           I   N+ ++P  +Q+    +K K     K+++CP C +  T+S+ L  H+  H G +P+L
Sbjct: 532 ILDENSEILPPSSQLVGGVEKPKGSHGVKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFL 591

Query: 365 CKWPKCGKAFNVKSNMNRHYKLH 387
           C+   CGK F    N+  H +LH
Sbjct: 592 CEC--CGKRFTQGGNLRTHQRLH 612

>TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.303
           YNL027W
          Length = 506

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 6/68 (8%)

Query: 329 KKVKKKN----QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY 384
           +++ +KN     C +C K  TR  +L  H+  HT +RP++C    CGKAF  + +  RH 
Sbjct: 382 RRLSQKNPAMFACELCDKRFTRPYNLKSHLRTHTNERPFICS--SCGKAFARQHDRKRHE 439

Query: 385 KLHLKKEK 392
            LH  K++
Sbjct: 440 DLHTGKKR 447

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 9/57 (15%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLC--------KWPKCGKAFNVKSNMNRHYK 385
           C  CGK   R      H  +HTG + Y+C         W  CGK F     + RH+K
Sbjct: 422 CSSCGKAFARQHDRKRHEDLHTGKKRYVCGGHLKDGTAW-GCGKKFARSDALGRHFK 477

>NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80
          Length = 455

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKE-KEQR 395
           CPIC +   R      HM  HTG++P+ C +P C K F+    + RH ++H   + + +R
Sbjct: 70  CPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIHTNPQPRGKR 129

Query: 396 EQSDGVETAET 406
            +   V T +T
Sbjct: 130 GRKKKVVTDQT 140

>KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa]
           {ON} some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 203

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 31/47 (65%)

Query: 341 GKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           GK  +R S+L  H+ VH+  +P+ C +  C K++NVKSN+ RH K H
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKH 198

>NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON}
           Anc_3.518
          Length = 288

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHL 388
           +CPIC +   R      H+  HTG++P+ C +  CGK+F+    + RH ++HL
Sbjct: 18  RCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIHL 70

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 320 IPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSN 379
            PADN       ++  +C +C +   R      HM  HTG++P+ C +P CGK+F+    
Sbjct: 9   FPADND------ERPFKCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDE 62

Query: 380 MNRHYKLHLKKEKEQREQ 397
           + RH + H    + + ++
Sbjct: 63  LKRHLRTHTSTSQRKTKK 80

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLKK 390
           +K  +C +CGK  +R  +L  H+  H   +P++CK   C K F    NM  H  + HL  
Sbjct: 477 EKPYECELCGKRFSRKGNLAAHVVTHQKLKPFICKLDGCNKTFTQLGNMKAHQNRFHLNT 536

Query: 391 EKEQREQSDGVETAETLSPLQRE 413
             E  ++   ++  E ++P +RE
Sbjct: 537 LNELTQKLAEMDPNENIAPKERE 559

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           QC  CGK  T+  +L  H  +HTG++PY C+   CGK F+ K N+  H   H K
Sbjct: 453 QCQYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CGKRFSRKGNLAAHVVTHQK 504

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 9/83 (10%)

Query: 312 IFTSNNGLIPADNQV--WTKKVK-----KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYL 364
           +    +G++P  +Q+    +K K     K+++CP C +  T+S+ L  H+  H G +P+ 
Sbjct: 394 LIDETSGILPPSSQLVGGVEKPKGSHGVKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQ 453

Query: 365 CKWPKCGKAFNVKSNMNRHYKLH 387
           C++  CGK F    N+  H +LH
Sbjct: 454 CQY--CGKRFTQGGNLRTHQRLH 474

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +CP+C +   R      H+  HTG++PY C +P C K+F+    + RH K+H
Sbjct: 18  KCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSFPDCPKSFSRTDELKRHSKIH 69

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 313 FTSNNGLIPADNQVWTKKVKKKN----QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWP 368
           FT  + L    + V  +K  +KN     C +C K  TR  +L  H+  HT +RP+ C   
Sbjct: 382 FTEEDSLPMNVSGVTRRKSIQKNPAVYACELCDKKFTRPYNLKSHLRTHTDERPFACAI- 440

Query: 369 KCGKAFNVKSNMNRHYKLHLKKEK 392
            CGKAF  + +  RH  LH  K++
Sbjct: 441 -CGKAFARQHDRKRHEDLHTGKKR 463

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 9/57 (15%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCK--------WPKCGKAFNVKSNMNRHYK 385
           C ICGK   R      H  +HTG + Y CK        W  CGK F     + RH+K
Sbjct: 438 CAICGKAFARQHDRKRHEDLHTGKKRYTCKGKLKDGTQW-GCGKKFARSDALGRHFK 493

>Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON}
           YER028C (REAL)
          Length = 388

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 13/102 (12%)

Query: 320 IPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSN 379
            PADN       ++  +C IC +   R      H+  HTG++P+ C +  C K+F+    
Sbjct: 8   FPADND------QRPFRCEICSRGFHRLEHKKRHVRTHTGEKPHKCSFQSCPKSFSRGDE 61

Query: 380 MNRHYKLHLK--KEKEQREQSDG-----VETAETLSPLQREQ 414
           + RH + H    K++ +R +S G     V+ A T+S   +EQ
Sbjct: 62  LKRHLRTHTNTVKKRSRRLKSKGLQKSAVDAATTISTTVKEQ 103

>Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 239

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQ 394
           C ICG    R      H+  HTG++P+ C  P C K F+    + RH K H K  K +
Sbjct: 14  CEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKSRKRK 71

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 329 KKVKKKN----QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY 384
           ++  KKN     C IC K  TR  +L  H+  HT +RP++C    CGKAF  + +  RH 
Sbjct: 410 RRNSKKNPSIYDCVICEKKFTRPYNLRSHLRTHTNERPFVCTV--CGKAFAREHDRKRHE 467

Query: 385 KLHLKKEK 392
            LH  K++
Sbjct: 468 DLHTGKKR 475

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 9/63 (14%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLC--------KWPKCGKAFNVKSNMNRHYKLHL 388
           C +CGK   R      H  +HTG + Y+C         W  CGK F     + RH+K   
Sbjct: 450 CTVCGKAFAREHDRKRHEDLHTGKKRYICGGKLKSGEAW-GCGKKFARSDALGRHFKTES 508

Query: 389 KKE 391
            K+
Sbjct: 509 GKK 511

>SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 767

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQR 395
           +C  C K    SSSL  H+  HTG++P  CK   CGK FN  SN+++H K H +K K ++
Sbjct: 687 KCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI--CGKRFNESSNLSKHMKTHERKYKCEK 744

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C K+ T+   LL H+ VH+G +P+ C  P C K F+ +  + +H + H
Sbjct: 635 CSKSFTQRQKLLRHLKVHSGYKPFKC--PHCTKKFSTEDILQQHIRTH 680

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 325 QVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRH 383
            + T   +K  +C ICGK    SS+L  HM  H  +R Y C+  KC ++FN    +  H
Sbjct: 704 HIRTHTGEKPLKCKICGKRFNESSNLSKHMKTH--ERKYKCE--KCKRSFNQLEQLRLH 758

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 359 GDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           G   Y C W  C K+F  +  + RH K+H
Sbjct: 624 GQSSYQCSWDTCSKSFTQRQKLLRHLKVH 652

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           ++K  C IC +  T S  L  H  +HTG++ + C +  C + F+   N  +HY+ HLKK
Sbjct: 172 RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKK 230

>KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa]
           {ON} Anc_8.326 YLR131C
          Length = 619

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           CGKT  R  ++  H+  H  DRPY C +P C KAF    ++ RH K H +K
Sbjct: 475 CGKTFKRRYNIRSHIQTHLEDRPYPCDFPGCDKAFVRNHDLVRHKKSHFEK 525

>KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {ON}
           some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters mediates
           glucose repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 265

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKE 391
           +++  C  C K  T S  L  H  +HTG++ ++C  P CG+ F+   N  +HYK HL++ 
Sbjct: 199 RRRYVCKTCVKGFTTSGHLARHNRIHTGEKNHVCPHPGCGQRFSRHDNCVQHYKTHLRRN 258

Query: 392 KEQ 394
             Q
Sbjct: 259 TWQ 261

>TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {ON}
           Anc_3.518 YGL209W
          Length = 276

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHL 388
           C  CG+   R      H+ +HTG++PY CK+ +C K+F+    + RH K+H+
Sbjct: 39  CESCGRGFYRLEHKKRHLKIHTGEKPYKCKFEQCIKSFSRSDELRRHSKIHI 90

>Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {ON}
           YLR131C (ACE2) - zinc finger transcription factor
           [contig 171] FULL
          Length = 745

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query: 319 LIPADNQVWTKKVKKKN-QC--PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFN 375
           L P +   + K++  K  +C  P CGKT  R  ++  H+  H  DRPY C +  C KAF 
Sbjct: 568 LPPGEIDKFVKELPDKTFECLHPDCGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFV 627

Query: 376 VKSNMNRHYKLHLKK 390
              ++ RH K H +K
Sbjct: 628 RNHDLIRHKKTHAEK 642

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLKKEKEQ 394
           QC +CGK  +R  +L  H+  H   +P++CK   C K+F    NM  H  K HL+     
Sbjct: 550 QCELCGKRFSRKGNLAAHVLTHKKIKPFICKLDNCNKSFTQLGNMKGHQNKFHLETLTRL 609

Query: 395 REQSDGVETAETLSPLQRE 413
             +   ++  E +S  +RE
Sbjct: 610 TARLAQLDPKENISTEERE 628

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           QC  CGK  T+  +L  H  +HTG++PY C+   CGK F+ K N+  H   H K
Sbjct: 522 QCQYCGKKFTQGGNLRTHERLHTGEKPYQCEL--CGKRFSRKGNLAAHVLTHKK 573

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           K+++C  C +  T+ + L  H+  H G +PY C++  CGK F    N+  H +LH
Sbjct: 491 KQHECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQY--CGKKFTQGGNLRTHERLH 543

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           QC  CGK  T+  +L  H+ +HTG++PY C+  KCG+ F+ K N+  H   H
Sbjct: 532 QCEYCGKRFTQGGNLRTHVRLHTGEKPYECE--KCGRRFSRKGNLAAHRLTH 581

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           K+++CP C K  T+S+ L  H+  H G +P+ C++  CGK F    N+  H +LH
Sbjct: 501 KQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 553

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLKK 390
           +K  +C  CG+  +R  +L  H   H   +P+ CK   C K+F    NM  H  + HL+ 
Sbjct: 556 EKPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQT 615

Query: 391 EKEQREQSDGVETAETLSPLQRE 413
             E  ++   ++  E ++P ++E
Sbjct: 616 LNELTQRLAEMDPNENIAPAEKE 638

>TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {ON}
           Anc_3.281 YBR066C
          Length = 350

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 45/85 (52%)

Query: 312 IFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCG 371
           I   N   +  + ++ T + ++K+QC IC K  T +  L  H  +HTG++ + C    C 
Sbjct: 245 ILKKNIKEMTKEERLLTIERRRKHQCKICMKKFTTAGHLTRHHKIHTGEKNHKCPHRGCN 304

Query: 372 KAFNVKSNMNRHYKLHLKKEKEQRE 396
             F+   N  +HY+ HLK++ ++R 
Sbjct: 305 LWFSRNDNSLQHYQTHLKRKTKKRR 329

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           QC  CGK  T+  +L  H+ +HTG++PY C+  KCG+ F+ K N+  H   H
Sbjct: 515 QCEYCGKRFTQGGNLRTHVRLHTGEKPYECE--KCGRRFSRKGNLAAHRLTH 564

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           K+++CP C K  T+S+ L  H+  H G +P+ C++  CGK F    N+  H +LH
Sbjct: 484 KQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 536

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLKK 390
           +K  +C  CG+  +R  +L  H   H   +P+ CK   C K+F    NM  H  + HL+ 
Sbjct: 539 EKPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQT 598

Query: 391 EKEQREQSDGVETAETLSPLQRE 413
             E  ++   ++  E ++P ++E
Sbjct: 599 LNELTQRLAEMDPNENIAPAEKE 621

>ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {ON}
           some similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 171

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 7/75 (9%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH-------L 388
           +C IC +   R      H+  HTG++P+ C +P CGK+F+    + RH + H        
Sbjct: 15  RCEICNRGFHRLEHKKRHIRTHTGEKPHKCSFPGCGKSFSRSDELKRHLRTHTGTSQRKT 74

Query: 389 KKEKEQREQSDGVET 403
           KK   +R + D + T
Sbjct: 75  KKTPSKRVEKDRIPT 89

>Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           ++K  C IC +  T S  L  H  +HTG++ + C +  C + F+   N  +HY+ HLKK
Sbjct: 171 RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKK 229

>NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {ON}
           Anc_8.326
          Length = 635

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 3/75 (4%)

Query: 319 LIPADNQVWTKKVKKKN-QC--PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFN 375
           L P     + K++  K  +C  P CGK   R  +   H+  H  DRPY C +P C KAF 
Sbjct: 472 LPPGSIDRYVKELPDKTFECLYPNCGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFV 531

Query: 376 VKSNMNRHYKLHLKK 390
              ++ RH K+H +K
Sbjct: 532 RNHDLVRHKKVHSEK 546

>TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1.326
           YJL056C
          Length = 778

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           +C +CG + + +SSL  H   HTG++P  C    CGK FN  SN+++H K H K+ K
Sbjct: 702 KCDMCGNSFSSASSLKVHKRTHTGEKPLSCN--VCGKRFNSSSNLSKHVKTHKKQYK 756

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C  CGK  +    L+ H  VH+G++PY C    CG +F+  S++  H + H
Sbjct: 675 CKTCGKNFSNQEILIQHQRVHSGEKPYKCDM--CGNSFSSASSLKVHKRTH 723

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C +  T+   L+ H+ VHT  +P+ CK   CGK F+ +  + +H ++H
Sbjct: 650 CDRRFTQKQKLVRHLRVHTHYKPFTCK--TCGKNFSNQEILIQHQRVH 695

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 359 GDRPYLCKWPKCGKAFNVKSNMNRHY-KLHL 388
           G    LCKW KCGK F  +  +N H  K HL
Sbjct: 606 GKNDSLCKWDKCGKLFENEEMLNNHVEKTHL 636

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 3/51 (5%)

Query: 340 CGKTVTRSSSLLPHMF-VHTGDR--PYLCKWPKCGKAFNVKSNMNRHYKLH 387
           CGK       L  H+   H   R   Y CKW  C + F  K  + RH ++H
Sbjct: 617 CGKLFENEEMLNNHVEKTHLLSRQSEYYCKWENCDRRFTQKQKLVRHLRVH 667

>KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.303
           YNL027W
          Length = 519

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 317 NGLIPADNQVWTKKVKKKNQ---CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKA 373
           N  IP +  +     KK  Q   C +C K  TR  +L  H+  HT +RP+ C    CGKA
Sbjct: 376 NNEIPPNLDIRKTNSKKNPQLYTCEVCDKKFTRPYNLKSHLRTHTNERPFACTI--CGKA 433

Query: 374 FNVKSNMNRHYKLHLKKEK 392
           F  + +  RH  LH  K++
Sbjct: 434 FARQHDRKRHEDLHSGKKR 452

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 9/57 (15%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCK--------WPKCGKAFNVKSNMNRHYK 385
           C ICGK   R      H  +H+G + Y C         W  CGK F     + RH+K
Sbjct: 427 CTICGKAFARQHDRKRHEDLHSGKKRYACGGKLKSGIPW-GCGKKFARSDALGRHFK 482

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 329 KKVKKKN----QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY 384
           +K  +KN     C +C K  TR  +L  H+  HT +RP+ C    CGKAF  + +  RH 
Sbjct: 414 RKTSQKNPAIYACELCDKKFTRPYNLKSHLRTHTDERPFACNV--CGKAFARQHDRKRHE 471

Query: 385 KLHLKKEK 392
            LH  K++
Sbjct: 472 DLHTGKKR 479

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 9/57 (15%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLC--------KWPKCGKAFNVKSNMNRHYK 385
           C +CGK   R      H  +HTG + Y+C         W  CGK F     + RH+K
Sbjct: 454 CNVCGKAFARQHDRKRHEDLHTGKKRYICGGNLKDGTSW-GCGKKFARSDALGRHFK 509

>TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.326
           YLR131C
          Length = 680

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 51/109 (46%), Gaps = 8/109 (7%)

Query: 286 SNVQPVYLTPIQSCGYAN-SPLSYQNGIFTSNNGLIPADNQVWTKKVKKKN-QC--PICG 341
           S +    L  I S G  N SP+     + T   G I     ++ K+++ K  +C  P CG
Sbjct: 445 SKIPQFQLNLINSNGPDNLSPVKITRKLTTLPRGSI----DIYVKELEGKMFECLYPDCG 500

Query: 342 KTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           KT  R  ++  H+  H  DRPY C  P C K F    ++ RH K H +K
Sbjct: 501 KTFKRRYNVRSHIQTHLQDRPYKCDMPGCDKGFVRNHDLLRHKKCHEEK 549

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 329 KKVKKKN----QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY 384
           K++ +KN     C +C K  TR  +L  H+  HT +RP++C    C KAF  + +  RH 
Sbjct: 641 KRLSQKNPAIYACELCDKKFTRPYNLKSHLRTHTNERPFICSI--CNKAFARQHDRKRHE 698

Query: 385 KLHLKKEK 392
            LH  K++
Sbjct: 699 DLHTGKKR 706

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 9/57 (15%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLC--------KWPKCGKAFNVKSNMNRHYK 385
           C IC K   R      H  +HTG + Y+C         W  CGK F     + RH+K
Sbjct: 681 CSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSW-GCGKKFARSDALGRHFK 736

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 7/89 (7%)

Query: 320 IPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSN 379
            P DN+       +  +C  C +   R      H+  HTG++P+ C +P CGK+F+    
Sbjct: 8   FPVDNE------NRPFRCDTCNRGFHRLEHKKRHLRTHTGEKPHHCGFPGCGKSFSRSDE 61

Query: 380 MNRHYKLHLKKEKEQREQSDGVETAETLS 408
           + RH + H   + ++R +  G++  E L+
Sbjct: 62  LKRHMRTHT-GQSQRRLKKSGIQKQEYLT 89

>TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa]
           {ON} Anc_4.80 YGL035C
          Length = 390

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           CP+C +   R      H+  HTG++P+ C +P C K F+    + RH ++H
Sbjct: 74  CPVCNRAFHRLEHQTRHIRTHTGEKPHSCDFPGCTKKFSRSDELTRHKRIH 124

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           C +C K  TR  +L  H+  HT +RP++C    CGKAF  + +  RH  LH  K++
Sbjct: 501 CDMCDKKFTRPYNLKSHLRTHTNERPFVCSI--CGKAFARQHDRKRHEDLHSGKKR 554

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 9/62 (14%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLC--------KWPKCGKAFNVKSNMNRHYKLHL 388
           C ICGK   R      H  +H+G + Y+C        KW  CGK F     + RH+K   
Sbjct: 529 CSICGKAFARQHDRKRHEDLHSGKKRYICGGTLKDGTKW-GCGKKFARSDALGRHFKTEA 587

Query: 389 KK 390
            K
Sbjct: 588 GK 589

>YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}
           NRG1Transcriptional repressor that recruits the
           Cyc8p-Tup1p complex to promoters; mediates glucose
           repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 231

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           ++K  C IC +  T S  L  H  +HTG++ + C +  C + F+   N  +HY+ HLKK
Sbjct: 171 RRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKK 229

>SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {ON}
           similar to uniprot|Q750L1 Ashbya gossypii AGR031W
           AGR031Wp and some similarites with YDR043C
           uniprot|Q03125 Saccharomyces cerevisiae YDR043C NRG1
           Transcriptional repressor that recruits the Cyc8p-Tup1p
           complex to promoters mediates glucose repression and
           negatively regulates a variety of processes including
           filamentous growth and alkaline pH response
          Length = 157

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           +++  C IC +  T S  L  H  +HTG++ ++C +  CG+ F+   N  +HY+ HLK
Sbjct: 97  RRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 8/81 (9%)

Query: 321 PADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNM 380
           PADN       ++  +C +C K   R      H+  HTG++P+ C +P C K F+    +
Sbjct: 17  PADND------QRPYKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDEL 70

Query: 381 NRHYKLH--LKKEKEQREQSD 399
            RH ++H    K K ++ ++D
Sbjct: 71  KRHLRIHTNTSKRKTRKRRAD 91

>Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa]
           {ON} complement(264361..265350) [990 nt, 330 aa]
          Length = 329

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 35/58 (60%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           ++K  C +CGK +T S  L  H  +HTG++ + C +  C + F+ + N ++HY+ H +
Sbjct: 260 RRKYYCRVCGKGLTTSGHLSRHYRIHTGEKKHCCPFEGCNQRFSRRDNCSQHYQTHRR 317

>CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some
           similarities with uniprot|P08153 Saccharomyces
           cerevisiae YDR146c SWI5 or uniprot|P21192 Saccharomyces
           cerevisiae YLR131c ACE2
          Length = 689

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%)

Query: 338 PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           P CGKT  R  ++  H+  H  DRPY C +  C KAF    ++ RH K H +K
Sbjct: 561 PQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQEK 613

>YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}
           NRG2Transcriptional repressor that mediates glucose
           repression and negatively regulates filamentous growth;
           has similarity to Nrg1p
          Length = 220

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK---E 393
           C IC    T S  L  H  +HTG++ ++C    CG+ F+   N N+HY+ H  K+K   +
Sbjct: 155 CKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHANKKKRNWK 214

Query: 394 QREQS 398
           +RE S
Sbjct: 215 RREAS 219

>Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar to
           Ashbya gossypii ADL198W
          Length = 560

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           C +C K  TR  +L  H+  HT +RP+ C    CGKAF  + +  RH  LH  K++
Sbjct: 440 CDLCNKKFTRPYNLKSHLRTHTDERPFACNM--CGKAFARQHDRKRHEDLHSGKKR 493

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 9/57 (15%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLC--------KWPKCGKAFNVKSNMNRHYK 385
           C +CGK   R      H  +H+G + Y+C         W  CGK F     + RH+K
Sbjct: 468 CNMCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKDGTSW-GCGKKFARSDALGRHFK 523

>Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa]
           {ON} complement(192400..194424) [2025 nt, 675 aa]
          Length = 674

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 326 VWTKKV-KKKNQC--PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNR 382
           ++ K++  KK QC  P C KT  R  ++  H+  H  DRPY C +  C KAF    ++ R
Sbjct: 476 IYVKEMPDKKFQCLYPKCDKTFKRRYNIRSHIQTHLEDRPYKCDFEGCDKAFVRNHDLIR 535

Query: 383 HYKLHLKK 390
           H K H +K
Sbjct: 536 HKKSHAEK 543

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 5/51 (9%)

Query: 344 VTRSSSLLPH----MFV-HTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           +TR  + LP     ++V    D+ + C +PKC K F  + N+  H + HL+
Sbjct: 462 ITRKPTTLPRGSIDIYVKEMPDKKFQCLYPKCDKTFKRRYNIRSHIQTHLE 512

>Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK---E 393
           C IC    T S  L  H  +HTG++ ++C    CG+ F+   N N+HY+ H  K+K   +
Sbjct: 155 CKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHANKKKRNWK 214

Query: 394 QREQS 398
           +RE S
Sbjct: 215 RRETS 219

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQR 395
           +C +CGK   R      H+  HTG++P+ C +P C K F+    + RH + H+   + + 
Sbjct: 14  KCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVRTHMSTSRGKS 73

Query: 396 EQSDGVETA 404
            +  G   A
Sbjct: 74  RKRSGSSPA 82

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQRE 396
           C IC K   R      H+  HTG++P+ C +  C K F+    + RH K+H+ K K+ R 
Sbjct: 15  CDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKIHVNK-KKNRA 73

Query: 397 QSDGVETAETLSP 409
             + +     L+P
Sbjct: 74  SKNRIMKRNILTP 86

>Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}
           similar to Ashbya gossypii AFR471C
          Length = 504

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           CPIC +   R      H+  HTG++P+ C +  CGK F+ +  + RH ++H
Sbjct: 24  CPICSRAFHRLEHQTRHIRTHTGEKPHGCDFIGCGKKFSRRDELARHRRIH 74

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLK 389
           C +CGK  +R  +L  H   H   +PY+CK   C K+F    NM  H  + HLK
Sbjct: 467 CEMCGKRFSRKGNLAAHALTHQKLKPYICKLENCNKSFTQLGNMKAHQNRFHLK 520

>Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK---E 393
           C IC    T S  L  H  +HTG++ ++C    CG+ F+   N N+HY+ H  K+K   +
Sbjct: 155 CKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHANKKKRNWK 214

Query: 394 QREQS 398
           +RE S
Sbjct: 215 RRETS 219

>Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK---E 393
           C IC    T S  L  H  +HTG++ ++C    CG+ F+   N N+HY+ H  K+K   +
Sbjct: 155 CKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHANKKKRNWK 214

Query: 394 QREQS 398
           +RE S
Sbjct: 215 RRETS 219

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C +C +   R      H+ +HTG++PY C +  C K F+    +NRH K+H
Sbjct: 21  CEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYLNCSKKFSRSDELNRHSKVH 71

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C  CGK  T+  +L  H+ +HTG++PY C+  +CG+ F+ K N+  H   H
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYECE--RCGRKFSRKGNLAAHKLTH 601

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           K+ QCP C K  T+S+ L  H+  H G +P+ C++  CGK F    N+  H +LH
Sbjct: 521 KQFQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLH 573

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLKK 390
           +K  +C  CG+  +R  +L  H   H   +P+ CK   C K F    NM  H  + HL+ 
Sbjct: 576 EKPYECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFHLQT 635

Query: 391 EKEQREQSDGVETAETLSPLQRE 413
                ++   ++  E +S  +RE
Sbjct: 636 LNRLTQRLAEMDPNENISQKERE 658

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQR 395
           +C +CGK   R      H+  HTG++P+ C +P C K F+    + RH + H+   + + 
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTHMSTSRGKG 74

Query: 396 EQSDG 400
            +  G
Sbjct: 75  RKRSG 79

>CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some
           similarities with uniprot|P39943 Saccharomyces
           cerevisiae YER028c or uniprot|P53035 Saccharomyces
           cerevisiae YGL209w MIG2
          Length = 318

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 6/73 (8%)

Query: 316 NNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFN 375
           N    P DN       K+  +C IC +   R      H   HTG++P+ CK+P C K+F+
Sbjct: 7   NQDSYPPDN------FKRPFRCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFS 60

Query: 376 VKSNMNRHYKLHL 388
               + RH + H+
Sbjct: 61  RADELKRHSRTHM 73

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           +++  C IC K  T S  L  H  +HTG++ ++C    CG+ F+   N  +HYK HL++
Sbjct: 198 RRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTHLRR 256

>NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518
          Length = 401

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +C  C +   R      HM  HTG++P+ C +P CGK F+    + RH + H
Sbjct: 19  RCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

>SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} similar
           to uniprot|P21192 Saccharomyces cerevisiae YLR131C ACE2
           Transcription factor that activates expression of early
           G1-specific genes localizes to daughter cell nuclei
           after cytokinesis and delays G1 progression in daughters
           localization is regulated by phosphorylation potential
           Cdc28p substrate
          Length = 798

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 3/75 (4%)

Query: 319 LIPADNQVWTKKVKKKN-QC--PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFN 375
           L P +   + +++  K  QC  P C KT  R  ++  H+  H  DRPY+C +  C KAF 
Sbjct: 600 LPPGEIDRYVRELPDKTFQCMYPDCNKTFRRRYNIRSHIQTHLEDRPYVCDYEGCTKAFV 659

Query: 376 VKSNMNRHYKLHLKK 390
              ++ RH K H  K
Sbjct: 660 RNHDLIRHKKTHADK 674

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 320 IPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSN 379
            P+DN+      ++  +CP+C +   R+     H+  HTG++P+LC    C K+F+    
Sbjct: 7   FPSDNE------ERPFKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDE 60

Query: 380 MNRHYKLH 387
           + RH K+H
Sbjct: 61  LKRHMKVH 68

>KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {ON}
           Anc_3.518 YGL209W
          Length = 416

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 43/94 (45%), Gaps = 17/94 (18%)

Query: 317 NGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNV 376
           +G  P DN       ++  +C IC +   R      H+  HTG++P+ C +P C K F+ 
Sbjct: 6   DGNFPKDND------RRPFKCDICSRGFHRLEHKNRHIMTHTGEKPHQCSFPGCVKKFSR 59

Query: 377 KSNMNRHYKLH---------LKKEKE--QREQSD 399
              + RH K H         +K+ KE   R QSD
Sbjct: 60  GDELKRHAKTHTSSTRRKVKVKRSKETLMRAQSD 93

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +C +C K+ + S+SL  H+  HTG++P  CK   CG+ FN  SN+++H K H
Sbjct: 669 KCHLCDKSFSVSTSLKIHIRTHTGEKPLECK--VCGRRFNESSNLSKHMKTH 718

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C K  ++   ++ H+ VH+G +PY C+   C K F+    + +H ++H
Sbjct: 617 CNKEFSQRQKIVRHLKVHSGFKPYKCE--VCSKCFSSDETLKQHSRVH 662

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 3/51 (5%)

Query: 340 CGKTVTRSSSLLPHM---FVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C  T   S  L  H+    +  G   Y C W  C K F+ +  + RH K+H
Sbjct: 584 CNLTFNSSEELNAHLESFHLTKGKSKYTCFWHGCNKEFSQRQKIVRHLKVH 634

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 6/72 (8%)

Query: 316 NNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFN 375
           NN L P      ++  KK +QCP C +  ++S+ L  H+  H G +PY C +  CGK F 
Sbjct: 502 NNDLSP----TRSRTKKKTHQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNF--CGKKFT 555

Query: 376 VKSNMNRHYKLH 387
              N+  H +LH
Sbjct: 556 QGGNLKTHQRLH 567

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           K  QC  CGK  T+  +L  H  +HTG++PY CK   C K F+ K N+  H   H K
Sbjct: 543 KPYQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKI--CNKRFSRKGNLTAHVLTHKK 597

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 24/52 (46%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRH 383
           +K   C IC K  +R  +L  H+  H   +PY CK   C K F    NM  H
Sbjct: 570 EKPYSCKICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAH 621

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHL 388
           +C  C +   R      H+  HTG++P++C +P C K F+ +  + RH + HL
Sbjct: 22  RCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFPHCKKGFSRRDELKRHIRTHL 74

>NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80
          Length = 493

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           CP+C +   R      H+  HTG++P +C +P C K F+    + RH ++H
Sbjct: 45  CPVCQRAFHRLEHQTRHLRTHTGEKPNVCDFPGCIKRFSRSDELTRHKRIH 95

>Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON}
           YDR146C (REAL)
          Length = 707

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 302 ANSPLSYQNGIFTSNNGLIPADNQVWTKKVKKKNQC--PICGKTVTRSSSLLPHMFVHTG 359
           ANSP      + T   G I   ++   + + K  +C  P C KT  R  ++  H+  H  
Sbjct: 518 ANSPSKITRKLTTLPRGSI---DRYVKEMLDKTFECLYPGCAKTFKRRYNIRSHIQTHLE 574

Query: 360 DRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           DRPY C  P C KAF    ++ RH K H +K
Sbjct: 575 DRPYSCDCPGCDKAFVRNHDLIRHKKSHQEK 605

>CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {OFF}
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113w AZF1 asparagine-rich zinc finger protein
          Length = 291

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHL 388
           +C IC K  +R  +L  H   H   RP++CK   C K+F+   NM  H  K HL
Sbjct: 12  ECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSHQNKFHL 65

>TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.281
           YBR066C
          Length = 175

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKE 391
           ++++ C +C K  T S  L  H  +HTG++ + C    C + F+   N  +HY+ HL+K+
Sbjct: 116 RRRHVCKVCSKGFTTSGHLARHNRIHTGEKNHFCPLEGCNQRFSRHDNCIQHYRTHLRKK 175

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKE 391
           ++++ C IC K  T S  L  H  +HTG++ + C +  C + F+   N  +HY+ H+K+E
Sbjct: 107 ERRHVCRICYKGFTTSGHLARHNRIHTGEKNHECPYEGCDQKFSRHDNCIQHYRAHVKRE 166

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHL 388
           C +CGK  +R  +L  H   H   +PY+CK  +C K+F    NM  H  + HL
Sbjct: 566 CELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAHQNRFHL 618

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           C +C K  TR  +L  H+  HT +RP+ C    CGKAF  + +  RH  LH  +++
Sbjct: 415 CELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHEDLHTGQKR 468

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 9/57 (15%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLC--------KWPKCGKAFNVKSNMNRHYK 385
           C ICGK   R      H  +HTG + Y C        +W  CGK F     + RH+K
Sbjct: 443 CAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEW-GCGKKFARSDALGRHFK 498

>NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3.281
          Length = 330

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKE 391
           ++K  C +C K  T S  L  H  +HTG++ + C +  C + F+   N  +HY+ H K  
Sbjct: 267 RRKYLCKVCSKGFTTSGHLARHNRIHTGEKSHACHFAGCTQKFSRHDNCLQHYRTHFKVR 326

Query: 392 K 392
           K
Sbjct: 327 K 327

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 7/79 (8%)

Query: 320 IPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSN 379
            PADN+      ++  +C +C +   R      H+  HTG++P+ C +  CGK+F+    
Sbjct: 8   FPADNE------ERPFKCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGSCGKSFSRSDE 61

Query: 380 MNRHYKLHL-KKEKEQREQ 397
           + RH + H    ++  R+Q
Sbjct: 62  LKRHLRTHAGSSQRRSRKQ 80

>KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {ON}
           Anc_8.326 YLR131C
          Length = 736

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%)

Query: 338 PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           P C KT  R  ++  H+  H  DRPY C +P C KAF    ++ RH K H  K
Sbjct: 564 PNCDKTFKRRYNVRSHIQTHLQDRPYTCDYPGCEKAFVRNHDLVRHKKGHTGK 616

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 5/51 (9%)

Query: 344 VTRSSSLLPHMFV-----HTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           +TR  + LP   +        DR + C +P C K F  + N+  H + HL+
Sbjct: 535 ITRKPTTLPRGCIDQYVKELPDRMFACLYPNCDKTFKRRYNVRSHIQTHLQ 585

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 336 QCPICGKTVTRSSSLLPHM-FVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           +C  CGK   RS  L  H+  VH+ +RP+ C  P C K F+   N+ +H K H K+
Sbjct: 766 KCETCGKAFRRSEHLKRHIRSVHSSERPFAC--PTCDKKFSRSDNLAQHIKTHKKR 819

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 330 KVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +  KK++CP C +  ++++ L  H+  H G +P++C +  CGK F    N+  H +LH
Sbjct: 578 RAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 633

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           C  CGK  T+  +L  H  +HTG++PY C    C K F+ K N+  H   H K
Sbjct: 613 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 663

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAF----NVKSNMNRHYKLHL 388
           C IC K  +R  +L  H+  H   +P++CK   C K F    N+K++ NR +K  L
Sbjct: 641 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETL 696

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 330 KVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +  KK++CP C +  ++++ L  H+  H G +P++C +  CGK F    N+  H +LH
Sbjct: 589 RTVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 644

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           C  CGK  T+  +L  H  +HTG++PY C    C K F+ K N+  H   H K
Sbjct: 624 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 674

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAF----NVKSNMNRHYKLHL 388
           C IC K  +R  +L  H+  H   +P++CK   C K F    N+K++ NR +K  L
Sbjct: 652 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETL 707

>Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {ON}
           YGL035C (MIG1) - 1:1 [contig 227] FULL
          Length = 463

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           CPIC +   R      H+  HTG++P+ C +  C K F+    + RH ++H
Sbjct: 25  CPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {ON}
           some similarities with uniprot|P38082 Saccharomyces
           cerevisiae YBR066c NRG2 or uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 314

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 310 NGIFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPK 369
           N ++++ + +I   +     + ++K+ C IC    T S  L  H  +HTG++ ++C    
Sbjct: 227 NKVYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEG 286

Query: 370 CGKAFNVKSNMNRHYKLHLKKEKEQRE 396
           C ++F+   N  +HY+ H KK KEQ +
Sbjct: 287 CNQSFSRHDNCLQHYRTHSKK-KEQSQ 312

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 330 KVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +  KK++CP C +  ++++ L  H+  H G +P++C +  CGK F    N+  H +LH
Sbjct: 588 RAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 643

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           C  CGK  T+  +L  H  +HTG++PY C    C K F+ K N+  H   H K
Sbjct: 623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 673

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAF----NVKSNMNRHYKLHL 388
           C IC K  +R  +L  H+  H   +P++CK   C K F    N+K++ NR +K  L
Sbjct: 651 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETL 706

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
           (REAL)
          Length = 948

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 326 VWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYK 385
           V   +  KK++CP C +  ++++ L  H+  H G +P+ C +  CGK F    N+  H +
Sbjct: 615 VHNTRTIKKHECPYCHRLFSQATHLEVHVRSHIGYKPFACDY--CGKRFTQGGNLRTHER 672

Query: 386 LH 387
           LH
Sbjct: 673 LH 674

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           C  CGK  T+  +L  H  +HTG++PY C    C K F+ K N+  H   H K
Sbjct: 654 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 704

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAF----NVKSNMNRHYKLHL 388
           C IC K  +R  +L  H+  H   +P++CK   C K F    N+K++ NR +K  L
Sbjct: 682 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCDKTFTQLGNMKAHQNRFHKETL 737

>Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON}
           YDR146C (REAL)
          Length = 708

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 48/106 (45%), Gaps = 9/106 (8%)

Query: 290 PVYLTPIQSC--GYANSPLSYQNGIFTSNNGLIPADNQVWTKKVKKKN-QC--PICGKTV 344
           P   T ++ C    ANSP      + T   G I      + K++  K  +C  P C KT 
Sbjct: 505 PQVGTHVRECDTNIANSPSKITRKLTTLPRGSI----DRYVKEMPDKTFECLYPECTKTF 560

Query: 345 TRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
            R  ++  H+  H  DRPY C  P C KAF    ++ RH K H +K
Sbjct: 561 KRRYNIRSHIQTHLEDRPYSCDHPGCNKAFVRNHDLIRHKKSHQEK 606

>KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON} 
          Length = 467

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           QC  CGK  T+  +L  H  +HTG++PY C+   CG+ F+ K N+  H   H
Sbjct: 331 QCQFCGKKFTQGGNLRTHQRLHTGEKPYQCE--SCGRRFSRKGNLAAHILTH 380

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           KK++CP C +  ++S+ L  H+  H G +P+ C++  CGK F    N+  H +LH  ++ 
Sbjct: 300 KKHECPYCHRLFSQSTHLEVHIRSHIGYKPFQCQF--CGKKFTQGGNLRTHQRLHTGEKP 357

Query: 393 EQRE 396
            Q E
Sbjct: 358 YQCE 361

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHL 388
           +K  QC  CG+  +R  +L  H+  H   +P++CK   C K+F    NM  H  + HL
Sbjct: 355 EKPYQCESCGRRFSRKGNLAAHILTHKNLKPFVCKLDNCDKSFTQLGNMKAHQNRFHL 412

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           C +C K  TR  +L  H+  HT +RP+ C    CGKAF  + +  RH  LH  K++
Sbjct: 428 CNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRKRHEDLHSGKKR 481

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 9/57 (15%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLC--------KWPKCGKAFNVKSNMNRHYK 385
           C +CGK   R      H  +H+G + Y+C         W  CGK F     + RH+K
Sbjct: 456 CSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATW-GCGKKFARSDALGRHFK 511

>Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON}
           YDR146C (REAL)
          Length = 691

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 44/92 (47%), Gaps = 7/92 (7%)

Query: 302 ANSPLSYQNGIFTSNNGLIPADNQVWTKKVKKKN-QC--PICGKTVTRSSSLLPHMFVHT 358
           ANSP      + T   G I      + K++  K+ +C  P C KT  R  ++  H+  H 
Sbjct: 502 ANSPSKITRKLTTLPRGSI----DRYVKEMPDKSFECLYPGCAKTFKRRYNIRSHIQTHL 557

Query: 359 GDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
            DRPY C  P C KAF    ++ RH K H +K
Sbjct: 558 EDRPYSCDNPGCDKAFVRNHDLIRHKKSHQEK 589

>Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)
          Length = 382

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 320 IPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSN 379
            P DN+       +  +C  C +   R      H+  HTG++P+ C +P CGK+F+    
Sbjct: 8   FPVDNE------NRPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDE 61

Query: 380 MNRHYKLHLKKEKEQREQSDGVETAETLS 408
           + RH + H   + ++R +   V+  E L+
Sbjct: 62  LKRHMRTHT-GQSQRRLKKSSVQKQEFLT 89

>CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa]
           {ON} similar to uniprot|P53035 Saccharomyces cerevisiae
           YGL209w MIG2 C2H2 zinc-finger protein
          Length = 396

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 320 IPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSN 379
           +P+DN+      ++  +C  C +   R      HM  HTG++P+ C +P CGK+F+    
Sbjct: 8   LPSDNK------ERPFKCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDE 61

Query: 380 MNRHYKLH 387
           + RH + H
Sbjct: 62  LKRHNRTH 69

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQR 395
           +C  C +   R      H+  HTG++P+ C +P CGK+F+    + RH + H   + ++R
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHT-GQSQRR 76

Query: 396 EQSDGVETAETLS 408
            +   V+  E L+
Sbjct: 77  LKKASVQKQEFLT 89

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           ++K  C  C K  T S  L  H  +HTG++ +LC +  C + F+ + N  +HY+ H K
Sbjct: 182 RRKYLCTTCTKGFTTSGHLARHKRIHTGEKNHLCPFEGCKQRFSRQDNCLQHYRTHFK 239

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           QC +C +  +R + L  HMF H+ D+P+ C +  CGK    K  + RH   H +
Sbjct: 82  QCTVCARQFSRKTHLERHMFSHSEDKPFKCSY--CGKGVTTKQQLRRHEITHTR 133

>Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON}
           YER028C (REAL)
          Length = 394

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 14/83 (16%)

Query: 307 SYQNGIFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCK 366
           S QNG F+S+N   P              +C IC +   R      H+  HTG++PY C 
Sbjct: 3   STQNG-FSSDNDRRPF-------------RCEICSRGFHRLEHKKRHVRTHTGEKPYKCS 48

Query: 367 WPKCGKAFNVKSNMNRHYKLHLK 389
              C K+F+    + RH++ H +
Sbjct: 49  SKNCTKSFSRSDELKRHFRTHTR 71

>KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.326
           YLR131C
          Length = 645

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 28/53 (52%)

Query: 338 PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           P C K   R  ++  H+  H  DRPY C +P C KAF    ++ RH K H +K
Sbjct: 517 PECKKLFKRRYNIRSHIQTHLEDRPYTCDFPGCTKAFVRNHDLVRHKKSHSEK 569

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 5/57 (8%)

Query: 338 PICGKTVTRSSSLLPHMFV-----HTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           PI    +TR  + LP   +        D+ + C +P+C K F  + N+  H + HL+
Sbjct: 482 PISPLKITRKRTTLPRGSIDRYVKELPDKSFECLYPECKKLFKRRYNIRSHIQTHLE 538

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           QC  CGK  T+  +L  H  +HTG++PY C+   C K F+ K N+  H   H
Sbjct: 629 QCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEI--CDKRFSRKGNLAAHKLTH 678

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 46/84 (54%), Gaps = 10/84 (11%)

Query: 312 IFTSNNGLIPADNQ----VWTKKV----KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPY 363
           + T+++ ++P+ N+    V   KV     K+++CP C +  ++S+ L  H+  H G +P+
Sbjct: 569 LITNDSHILPSKNELVGGVEKPKVVHEGSKQHECPYCHRLFSQSTHLEVHIRSHLGYKPF 628

Query: 364 LCKWPKCGKAFNVKSNMNRHYKLH 387
            C +  CGK F    N+  H +LH
Sbjct: 629 QCNF--CGKRFTQGGNLRTHQRLH 650

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLKKEKEQ 394
           +C IC K  +R  +L  H   H   +P++CK   C K F    NM  H  K HL+   E 
Sbjct: 657 RCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFHLQTLLEL 716

Query: 395 REQSDGVETAETLSPLQRE 413
             +   +   ET+    RE
Sbjct: 717 TSKIAEMNPNETIPEEDRE 735

>TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4.80
           YGL035C
          Length = 518

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C  CG+   R      HM  HTG++P+ C +  C K F+    + RH ++H
Sbjct: 71  CGTCGRAFHRLEHQTRHMRTHTGEKPHACDFQGCTKRFSRSDELTRHKRIH 121

>Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON}
           (43237..43899) [663 nt, 221 aa]
          Length = 220

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHL 388
           +++ +C  CG+  T S  L  H  +HTG++ ++C +  C   F+   N  +HYK HL
Sbjct: 158 RRRFECKTCGRKFTTSGHLTRHNRIHTGEKNHVCPFEGCNLRFSRNDNSLQHYKTHL 214

>YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}
           SWI5Transcription factor that recruits the Mediator and
           Swi/Snf complexes; activates transcription of genes
           expressed at the M/G1 phase boundary and in G1 phase;
           required for expression of the HO gene controlling
           mating type switching; localization to the nucleus
           occurs during G1 and appears to be regulated by
           phosphorylation by Cdc28p kinase
          Length = 709

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%)

Query: 338 PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           P C KT  R  ++  H+  H  DRPY C  P C KAF    ++ RH K H +K
Sbjct: 555 PGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQEK 607

>KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|P47043 Saccharomyces
           cerevisiae YJL056C ZAP1 Zinc-regulated transcription
           factor binds to zinc-responsive promoter elements to
           induce transcription of certain genes in the presence of
           zinc regulates its own transcription contains seven
           zinc- finger domains
          Length = 781

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           +C +C K+ + SSSL  H+  HTG++P  C  P C K FN  SN+ +H + H ++
Sbjct: 721 KCHLCPKSYSTSSSLRIHIRTHTGEKPLSC--PICNKRFNESSNLAKHIRTHKRE 773

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +C  CGK       L  H+ VH+G+RP+ C    C K+++  S++  H + H
Sbjct: 693 RCAECGKCFNTQDILTQHLRVHSGERPFKCHL--CPKSYSTSSSLRIHIRTH 742

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           C K   +   L+ H+ VH+  +P+ C   +CGK FN +  + +H ++H
Sbjct: 669 CNKVFVQKQKLIRHLKVHSKYKPFRC--AECGKCFNTQDILTQHLRVH 714

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 340 CGKTVTRSSSLLPHM---FVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           C K    + SL  H+    V +G   Y C+W  C K F  K  + RH K+H K
Sbjct: 636 CNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVHSK 688

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +C  CGK  T++ +L  H  +HTG+RP+ C   KC K F  + N+  H   H
Sbjct: 509 ECEFCGKRFTQAGNLRTHRRLHTGERPFKCD--KCDKTFARRGNLTAHEFTH 558

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHLKKEKE 393
           +C  C KT  R  +L  H F H   +PY+C+   C K F+   NM  H  K H +  KE
Sbjct: 537 KCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSHQNKYHPQTIKE 595

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           QC  C K  ++S+ L  H+  H G +P+ C++  CGK F    N+  H +LH
Sbjct: 481 QCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLH 530

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQR 395
           +C  C +   R      H+  HTG++P+ C +P CGK+F+    + RH + H  + + + 
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQRRL 77

Query: 396 EQS 398
           ++S
Sbjct: 78  KKS 80

>NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326
          Length = 794

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%)

Query: 338 PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           P C K   R  ++  H+  H  DRPY C++  C KAF    ++ RH KLH +K
Sbjct: 666 PNCDKIFKRRYNVRTHIQTHLEDRPYRCEFRGCEKAFVRNHDLVRHKKLHAEK 718

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +C  CGK  T+  +L  H  +HTG++PY C+   C K F+ K N+  H   H
Sbjct: 501 ECQFCGKRFTQGGNLRTHQRLHTGEKPYACQH--CSKRFSRKGNLAAHQLTH 550

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387
           +KK++CP C     +++ L  H+  H G +P+ C++  CGK F    N+  H +LH
Sbjct: 469 QKKHECPYCHHKFAQTTHLEVHVRSHLGYKPFECQF--CGKRFTQGGNLRTHQRLH 522

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRH 383
           C  C K  +R  +L  H   H   +P+LCK   CGK F    NM  H
Sbjct: 530 CQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNH 576

>ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {ON}
           similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131C ACE2 Transcription factor that activates
           expression of early G1-specific genes localizes to
           daughter cell nuclei after cytokinesis and delays G1
           progression in daughters localization is regulated by
           phosphorylation potential Cdc28p substrate
          Length = 813

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           CGK   R  ++  H+  H  DRPY+C +  C KAF    ++ RH K H +K
Sbjct: 634 CGKIFKRRYNIRSHIQTHLEDRPYMCDFEGCDKAFVRNHDLVRHKKSHAEK 684

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 53/122 (43%), Gaps = 18/122 (14%)

Query: 290 PVYLTPIQSCGYANSP-------LSYQN--GIFTSNNGLIPADNQVWTKKVKKKNQCPIC 340
           P+ + P+ S GY++ P        S+Q        + G  PAD +         +QC +C
Sbjct: 211 PLSVYPVDSRGYSDPPHITSQHVASHQRPPAAVQPHQGQNPADPE-------NPHQCHLC 263

Query: 341 GKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQREQSDG 400
            K+  R S L  H+  H+  +P+ C W  C      K N+ +H KL    +  Q  QS G
Sbjct: 264 DKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKLKHTPQVLQELQSAG 321

Query: 401 VE 402
           V 
Sbjct: 322 VH 323

>NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {ON}
           Anc_3.281
          Length = 293

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           ++K  C +C K  T S  L  H  +HTG++ + C +P C   F+   N  +HY+ H K
Sbjct: 225 RRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHFK 282

>CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1321

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 14/82 (17%)

Query: 318 GLIPADNQVWTKKVKKKNQ-----------CPICGKTVTRSSSLLPHMFVHTGDRPYLCK 366
           G +P DN      + KK++           CPIC +   R   L  H   HT ++P+LC 
Sbjct: 5   GSVPVDNGANFAPIPKKSRTIKTDKPRPHLCPICTRGFVRLEHLKRHQRAHTNEKPFLCV 64

Query: 367 WPKCGKAFNVKSNMNRH-YKLH 387
           +  CG+ F  +  + RH YKLH
Sbjct: 65  F--CGRCFARRDLVLRHQYKLH 84

>KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]
           {ON} weakly similar to uniprot|P21192 Saccharomyces
           cerevisiae YLR131C ACE2 Transcription factor that
           activates expression of early G1-specific genes
           localizes to daughter cell nuclei after cytokinesis and
           delays G1 progression in daughters localization is
           regulated by phosphorylation potential Cdc28p substrate
          Length = 854

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 333 KKNQCPI--CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           K+ QC    C K   R  +   H+  H  DRPY C +P C KAF    ++ RH K HL+K
Sbjct: 691 KQFQCKFKDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKKSHLEK 750

>NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281
          Length = 266

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           ++K+ C IC    T S  L  H  +HTG++ + C +  C + F+   N  +HY+ HLKK
Sbjct: 207 RRKHVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLKK 265

>NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326
          Length = 620

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 340 CGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK--EKEQREQ 397
           CGK   R  ++  H+  H  D+PY C +P C KAF    ++ RH K H  +    ++R Q
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHANRTSSPQKRVQ 546

Query: 398 SD 399
            D
Sbjct: 547 KD 548

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 46/89 (51%), Gaps = 8/89 (8%)

Query: 316 NNGLIPADNQVWTKKVKKKN--QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKA 373
           ++G++P   +  T K  K     CP+C +   R   L  H   HT ++P+LC +  CG+ 
Sbjct: 59  DDGIVPIPKKSRTIKTDKPRPFLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRC 116

Query: 374 FNVKSNMNRH-YKLH---LKKEKEQREQS 398
           F  +  + RH  KLH   + ++K+ RE +
Sbjct: 117 FARRDLVLRHQQKLHASLMDQDKDLRESA 145

>KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.518
           YGL209W
          Length = 391

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 6/91 (6%)

Query: 320 IPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSN 379
            PADN       ++  +C +C +   R      H+  HTG++P+ C +P C K F+    
Sbjct: 8   FPADND------QRPFRCELCQRGFHRLEHKKRHVRTHTGEKPHACTFPGCEKHFSRSDE 61

Query: 380 MNRHYKLHLKKEKEQREQSDGVETAETLSPL 410
           + RH + H    + +  +     T +T S L
Sbjct: 62  LKRHSRTHATGLQRKSRKPRAKSTKKTASKL 92

>CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa]
           {ON} similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131c ACE2 or uniprot|P08153 Saccharomyces cerevisiae
           YDR146c SWI5
          Length = 703

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 327 WTKKVKKKN-QC--PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRH 383
           + K++  KN +C  P CGK   R  ++  H+  H  D+PY C +  C KAF    ++ RH
Sbjct: 514 YVKELPDKNFECLFPNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARH 573

Query: 384 YKLHLK 389
            K H K
Sbjct: 574 KKTHDK 579

>CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} similar
           to uniprot|P46974 Saccharomyces cerevisiae YJR127c ZMS1
           or uniprot|Q04545 Saccharomyces cerevisiae YML081w
          Length = 1020

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 319 LIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKS 378
           LIP  ++       +   CPIC +   R   L  H   HT ++P+LC    CGK F  K 
Sbjct: 11  LIPKKSRAVKTDKPRPFLCPICSRGFVRQEHLKRHQNSHTHEKPFLCL--ICGKCFARKD 68

Query: 379 NMNRHY-KLHLKKEKEQREQSDG 400
            + RH  KLH   + EQ +++ G
Sbjct: 69  LVLRHLQKLHRDYKTEQLDKTIG 91

>Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON}
           (42259..43791) [1533 nt, 511 aa]
          Length = 510

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 2/71 (2%)

Query: 319 LIPADNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKS 378
           L+P    +     K++++C  C K  +++ +L  H  +HTG+RPY C    C K F+ K 
Sbjct: 361 LVPKQELMEEVVDKRQHKCAYCDKRFSQTGNLNTHQRLHTGERPYECHI--CNKRFSRKG 418

Query: 379 NMNRHYKLHLK 389
           N+  H   H K
Sbjct: 419 NLTAHVITHKK 429

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 9/81 (11%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAF----NVKSNMNR-HYKLHLKK 390
           +C IC K  +R  +L  H+  H   +PY+CK   C K F    N+K + N+ HY+  L+ 
Sbjct: 406 ECHICNKRFSRKGNLTAHVITHKKLKPYICKVDGCNKKFTQLGNMKVHQNKFHYETILRL 465

Query: 391 E----KEQREQSDGVETAETL 407
                KE+ ++    E +ETL
Sbjct: 466 SDSFNKEESKEYLSKEDSETL 486

>KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {ON}
           similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 472

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 336 QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           +C  CGK   + S L  HMF HT D+P+ C    CGK    +  + RH   H K
Sbjct: 138 KCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSI--CGKGVTTRQQLKRHEITHTK 189

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGK----AFNVKSNMNRHYK 385
           CPICGK     S L  HM +H  D   + K  KC      +F  K+ + +HY+
Sbjct: 281 CPICGKPCVAESGLRNHMMIH--DESLVTKNWKCSSCPDTSFAKKTQLVQHYE 331

>AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR146C (SWI5) and
           YLR131C (ACE2)
          Length = 844

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 3/67 (4%)

Query: 327 WTKKVKKKN-QC--PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRH 383
           + KK++ K  QC  P CGK   R  ++  H+  H  DRP+ C    C KAF    ++ RH
Sbjct: 665 YIKKLQDKTFQCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRH 724

Query: 384 YKLHLKK 390
            K H +K
Sbjct: 725 KKTHAEK 731

>KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar to
           uniprot|P39933 Saccharomyces cerevisiae YPR186C PZF1
           Transcription factor IIIA (TFIIIA) with putative
           Zn-fingers
          Length = 433

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 337 CPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           C  CG+  TR + L  HMF HT ++P+ C    CGK    +  + RH   H +
Sbjct: 83  CTECGRQFTRKTHLERHMFTHTAEKPFHC--SHCGKGVTTRQQLRRHEITHTR 133

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 3/69 (4%)

Query: 323 DNQVWTKKVKKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNR 382
           +  ++T   +K   C  CGK VT    L  H   HT  R ++C    CG++F     +  
Sbjct: 97  ERHMFTHTAEKPFHCSHCGKGVTTRQQLRRHEITHT--RSFVCPHEGCGESFYKHPQLRS 154

Query: 383 HY-KLHLKK 390
           H   +HL+K
Sbjct: 155 HVLAVHLQK 163

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 5/73 (6%)

Query: 318 GLIPADNQVWTKKVKKKN--QCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFN 375
           GL+P   +  T K  K     CPIC +   R   L  H   HT ++P+LC +  CG+ F 
Sbjct: 38  GLLPIPKKSRTIKTDKPRPYLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVF--CGRCFA 95

Query: 376 VKSNMNRH-YKLH 387
            +  + RH +KLH
Sbjct: 96  RRDLVLRHQHKLH 108

>TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {ON}
           Anc_8.326 YLR131C
          Length = 743

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 338 PICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKK 390
           P C K   R  ++  H+  H  DRPY+C +  C KAF    ++ RH K H +K
Sbjct: 576 PNCNKVFKRRYNIRSHIQTHLEDRPYVCDFEGCDKAFVRNHDLVRHKKSHAEK 628

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 5/51 (9%)

Query: 344 VTRSSSLLPHMFV-----HTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLK 389
           +TR  + LP   +        DR + C +P C K F  + N+  H + HL+
Sbjct: 547 ITRKPTTLPRGSIDRYVKELPDRIFECMYPNCNKVFKRRYNIRSHIQTHLE 597

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 333 KKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEK 392
           K+++CP C +   +S+ L  H+  H G +PY C +  CGK F    N+  H +LH  ++ 
Sbjct: 513 KQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLRTHQRLHTGEKP 570

Query: 393 EQREQSD 399
            + E  D
Sbjct: 571 YECELCD 577

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 332 KKKNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHY-KLHL 388
           +K  +C +C K  +R  +L  H+  H   +P++CK   C ++F    NM  H  + HL
Sbjct: 568 EKPYECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAHQNRFHL 625

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,515,556
Number of extensions: 2279648
Number of successful extensions: 7348
Number of sequences better than 10.0: 587
Number of HSP's gapped: 7178
Number of HSP's successfully gapped: 761
Length of query: 414
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 302
Effective length of database: 40,638,807
Effective search space: 12272919714
Effective search space used: 12272919714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)