Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A018302.530ON44244222530.0
Suva_8.582.530ON45246710711e-143
NCAS0F009302.530ON42244510361e-138
KNAG0C058502.530ON44345110331e-137
YHR004C (NEM1)2.530ON44645710311e-137
Skud_8.492.530ON44745610251e-136
NDAI0H014202.530ON44846110231e-135
TDEL0A030502.530ON3553779951e-133
Smik_8.532.530ON4464559931e-131
CAGL0K02959g2.530ON4643489791e-128
SAKL0A09416g2.530ON3854419391e-124
TPHA0G035002.530ON3923449041e-118
Kpol_348.82.530ON4224718921e-116
KLTH0D06776g2.530ON4094168801e-114
ZYRO0B01958g2.530ON3363258611e-112
Kwal_26.80012.530ON4134668561e-111
TBLA0I014602.530ON3933548081e-104
AGL070W2.530ON3433357308e-93
Ecym_72572.530ON3523407272e-92
KLLA0E18613g2.530ON3743516274e-77
SAKL0G12870g5.202ON3991732385e-21
YLR019W (PSR2)5.202ON3971732351e-20
Skud_12.875.202ON3921732304e-20
TPHA0E030705.202ON4941722325e-20
Smik_12.825.202ON3921732305e-20
Suva_10.995.202ON3851782296e-20
Kpol_2002.1005.202ON4771632272e-19
CAGL0D05610g5.202ON4471622262e-19
TBLA0C060905.202ON4841722263e-19
NDAI0D018605.202ON5141722263e-19
NDAI0I021705.202ON3912302234e-19
KAFR0J009905.202ON4831732192e-18
TBLA0H019905.202ON6882422212e-18
Smik_12.535.202ON4141852173e-18
NCAS0D027405.202ON3981622155e-18
Kpol_478.165.202ON3502082135e-18
TDEL0E042705.202ON4531732148e-18
KNAG0M017405.202ON4811732149e-18
ZYRO0B10428g5.202ON4821642149e-18
YLL010C (PSR1)5.202ON4271852121e-17
CAGL0D03234g5.202ON4101732112e-17
Suva_10.655.202ON4151622112e-17
Skud_12.575.202ON4151732102e-17
Kwal_33.151405.202ON4101642093e-17
KLLA0F15620g5.202ON4141732093e-17
Ecym_71045.202ON4921752095e-17
NCAS0A068005.202ON4731622086e-17
KLTH0B03388g5.202ON4091642068e-17
AAL158W5.202ON4781621989e-16
TPHA0N006705.202ON4521621971e-15
YPL063W (TIM50)8.527ON4761571641e-11
SAKL0H10296g8.527ON4781571571e-10
TBLA0A005408.527ON4851571543e-10
TDEL0B031908.527ON4771121534e-10
Suva_16.2498.527ON4801611525e-10
Smik_16.1728.527ON4771121516e-10
Kpol_457.58.527ON4891571481e-09
Kwal_27.119908.527ON4741121481e-09
NCAS0C022108.527ON4911611472e-09
NDAI0E029108.527ON4411611462e-09
KLTH0E12254g8.527ON4761121462e-09
Skud_16.2188.527ON4801121463e-09
CAGL0H05159g8.527ON4851611463e-09
KLLA0E23101g8.527ON4801161445e-09
ZYRO0F09130g8.527ON4891121392e-08
TPHA0I020008.527ON4781611383e-08
Ecym_11778.527ON4901571312e-07
KAFR0E010208.527ON4481611251e-06
KNAG0A020608.527ON4501611241e-06
ADR045W8.527ON4761111188e-06
KLTH0C03894g8.839ON74599820.17
NCAS0C004208.839ON725106820.18
TPHA0I002408.839ON732122790.46
ZYRO0E00396gsingletonON36666704.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A01830
         (442 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   872   0.0  
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   417   e-143
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   403   e-138
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   402   e-137
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   401   e-137
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   399   e-136
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    398   e-135
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   387   e-133
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   387   e-131
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   381   e-128
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   366   e-124
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   352   e-118
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   348   e-116
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   343   e-114
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   336   e-112
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   334   e-111
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   315   e-104
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   285   8e-93
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   284   2e-92
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   246   4e-77
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    96   5e-21
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    95   1e-20
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    93   4e-20
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    94   5e-20
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    93   5e-20
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    93   6e-20
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    92   2e-19
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    92   2e-19
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    92   3e-19
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     92   3e-19
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     91   4e-19
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    89   2e-18
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    90   2e-18
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    88   3e-18
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    87   5e-18
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    87   5e-18
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    87   8e-18
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    87   9e-18
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    87   9e-18
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    86   1e-17
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    86   2e-17
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    86   2e-17
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    86   2e-17
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    85   3e-17
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    85   3e-17
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    85   5e-17
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    85   6e-17
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    84   8e-17
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    81   9e-16
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    80   1e-15
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    68   1e-11
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    65   1e-10
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    64   3e-10
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    64   4e-10
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    63   5e-10
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    63   6e-10
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    62   1e-09
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    62   1e-09
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     61   2e-09
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    61   2e-09
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    61   2e-09
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    61   3e-09
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    61   3e-09
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    60   5e-09
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    58   2e-08
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    58   3e-08
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    55   2e-07
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    53   1e-06
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    52   1e-06
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    50   8e-06
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...    36   0.17 
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...    36   0.18 
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...    35   0.46 
ZYRO0E00396g Chr5 complement(21090..22190) [1101 bp, 366 aa] {ON...    32   4.4  

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/442 (96%), Positives = 428/442 (96%)

Query: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG 60
           MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG
Sbjct: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG 60

Query: 61  LSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLIY 120
           LSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLIY
Sbjct: 61  LSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLIY 120

Query: 121 VWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLSTSDEFFLQ 180
           VWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLSTSDEFFLQ
Sbjct: 121 VWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLSTSDEFFLQ 180

Query: 181 RDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKMGRFLFPKKLIPRSILCN 240
           RDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKMGRFLFPKKLIPRSILCN
Sbjct: 181 RDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKMGRFLFPKKLIPRSILCN 240

Query: 241 ERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSK 300
           ERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSK
Sbjct: 241 ERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSK 300

Query: 301 VSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNA 360
           VSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNA
Sbjct: 301 VSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNA 360

Query: 361 NHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISXXXXXXXXXXXXXXEAL 420
           NHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS              EAL
Sbjct: 361 NHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISDPTDTDLLNLLPILEAL 420

Query: 421 RYTTDVRNVLALKNGEKMFENV 442
           RYTTDVRNVLALKNGEKMFENV
Sbjct: 421 RYTTDVRNVLALKNGEKMFENV 442

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  417 bits (1071), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 233/467 (49%), Positives = 304/467 (65%), Gaps = 46/467 (9%)

Query: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG 60
           MNAL Y +NH       L   NK K  I  E +   +D  S SN+   T     AS  + 
Sbjct: 1   MNALKYFSNH-------LITTNKPKKTINVE-VTKSQDSLSASNETFDT----GASNTEK 48

Query: 61  LSSVKD--AHNQNVEGAIHIKQQ------IPRKRITILSVFEKFNLFSLLANIILFVPRY 112
             +VK+   HN + EG    KQ       +  KR  + S+  K  + S+L  I+LF+P Y
Sbjct: 49  DPTVKENHQHNSSTEGPNEPKQDEECTYSVSTKRKALHSIL-KEKIVSILWAILLFLPYY 107

Query: 113 LFLNPLIYVWFILTLPLTLVERGIKLRDRKKK------------AELRGNFGESSELSP- 159
           L + PL+ +WF+ T PL ++ER +K  D++ K            +   G+F E  +    
Sbjct: 108 LIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNR 167

Query: 160 -LRSISEVGEEDLSTSDEFFLQRDTIKGSLLRASS------DKPPVFQRYKSTIKQDHEA 212
            L +I E+ E+DL+ SDE  LQRD +KGSLL+A+        K   + + ++++  +H  
Sbjct: 168 NLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHSAKSKSRRYSKSEASL-TNHST 226

Query: 213 MNTNIFGTKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL 272
            NT +FGTK+MGRFLFPKKLIP+SIL  ++KK LV+DLDETLIHS SRGTTH NSSQGHL
Sbjct: 227 ANT-VFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNSSQGHL 285

Query: 273 VEVKFSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGN 332
           VEVKF I+GISTLY++HKRP+CDLFL+K SKWY+++IFTASMKEYADPVIDWLEGSF  +
Sbjct: 286 VEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEGSFAAS 345

Query: 333 FAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNV 392
           F+KR YR +C+LRDGVGYIKDLS+L +   +++N     +  L +VIIIDNSPVSYA+NV
Sbjct: 346 FSKRYYRSDCVLRDGVGYIKDLSILKS---SEENGKGSSLSSLDDVIIIDNSPVSYAMNV 402

Query: 393 DNAIQVEGWISXXXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMF 439
           DNAIQVEGWIS              EA+RY+TDVRN+LALK+GEK F
Sbjct: 403 DNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAF 449

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  403 bits (1036), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 228/445 (51%), Positives = 295/445 (66%), Gaps = 32/445 (7%)

Query: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG 60
           MNALSYI++H+  P   L+   K +  IVP       +   I +  K T   +    E  
Sbjct: 1   MNALSYISSHLASPIHYLK---KKEPTIVPVEQEPTNNNEKIKSHSKATTNND----EDY 53

Query: 61  LSSVKDAHNQN-VEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLI 119
            + + D+ + N +E +I +       R ++L  F  F         +LF P++L + PL+
Sbjct: 54  STPMADSSSSNTIEKSIAVYGSDRALRFSVL--FWTF---------VLFFPKFLIVKPLL 102

Query: 120 YVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRS-----ISEVGEEDLSTS 174
           ++WFI+T PL L+ERG+K R   K  +L  N  +++E  P  S     I E  E+DL+  
Sbjct: 103 FLWFIVTFPLYLLERGMKHRTLLKN-KLDENSQKNAERVPTTSPELTVIDETTEDDLAGG 161

Query: 175 DEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKMGRFLFPKKLIP 234
           DE +LQRDTIKGSLL+A+S K    Q   S   +   + NT+ F +K+MG+FLFPKKLIP
Sbjct: 162 DEIYLQRDTIKGSLLKATSAK----QLSSSKTVKSISSNNTS-FSSKRMGKFLFPKKLIP 216

Query: 235 RSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFC 294
           RSI+   R+K LV+DLDETLIHS+SRGTTH NSSQGH+VEVKFS++G+STLYYVHKRP+C
Sbjct: 217 RSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYC 276

Query: 295 DLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDL 354
           D FLSKVSKWY+++IFTASMKEYADPVIDWLE S    F++RLYR +C+LRDGVGYIKDL
Sbjct: 277 DFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDL 336

Query: 355 SVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISXXXXXXXXXXX 414
           SV+  A+  ++     P   L E+IIIDNSP+SYA+NV+NAIQVEGWIS           
Sbjct: 337 SVISEASGMKNISALPP--SLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDNALLNLL 394

Query: 415 XXXEALRYTTDVRNVLALKNGEKMF 439
              EALR+TTDVRNVLALKNGEK F
Sbjct: 395 PLLEALRFTTDVRNVLALKNGEKAF 419

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  402 bits (1033), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 235/451 (52%), Positives = 300/451 (66%), Gaps = 23/451 (5%)

Query: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSIS-NDQKGTITRENASPEK 59
           MN +SYIT H+  P   LR   K   N V        D   ++ ND      +  A+ EK
Sbjct: 1   MNTISYITQHLIYP---LRPRAKSLHNEVKSGEGKVDDGVGVTENDVADGKLKTTANVEK 57

Query: 60  GLSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFN-------LFSLLANIILFVPRY 112
             +S       + +G+   K   P   I +++  +  N       ++++L  +I F+P Y
Sbjct: 58  QENSTLKEELLDRQGSDAEKASKP---IIVINDGDILNENILHQKVWNVLVFVIFFLPTY 114

Query: 113 LFLNPLIYVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLS 172
           L   PL+ +WF++TLPL LVERGIKLR+R K    + +    S+ S L SI+E  EEDL+
Sbjct: 115 LIYKPLLLLWFLVTLPLALVERGIKLRNRPKMKTEKVSELVLSDPSKLGSINEEVEEDLA 174

Query: 173 TSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEA----MNTNIFGTKKMGRFLF 228
             DEF+LQRD +KGSLL+A+++K     + K    Q+        N+ +FGTKKMGRFLF
Sbjct: 175 AGDEFYLQRDIVKGSLLKATTNKHHTPLKSKKNSAQNQHGNETHPNSTVFGTKKMGRFLF 234

Query: 229 PKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYV 288
           PKKLIP+SIL  E+KKTLV+DLDETLIHSVSRGTTH NSSQGH+VEVKFSI+G+STLYYV
Sbjct: 235 PKKLIPKSILNREKKKTLVMDLDETLIHSVSRGTTHPNSSQGHIVEVKFSISGVSTLYYV 294

Query: 289 HKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGV 348
            KRP+CDLFL+KVSKWY+IVIFTASMKEYADPVIDWLE SF G F++RLYR++C+LRDGV
Sbjct: 295 FKRPYCDLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFSRRLYRNDCILRDGV 354

Query: 349 GYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISXXXXX 408
           GYIKDL ++   ++   +      + L +VII+DNSPVSYALNVDNAIQVEGWI+     
Sbjct: 355 GYIKDLKMVTRGSNLGTSP-----DRLEDVIIVDNSPVSYALNVDNAIQVEGWINDPTDT 409

Query: 409 XXXXXXXXXEALRYTTDVRNVLALKNGEKMF 439
                    EAL  TTDVRN+L+LKNGEK F
Sbjct: 410 DLLNLIPLLEALENTTDVRNILSLKNGEKAF 440

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  401 bits (1031), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 224/457 (49%), Positives = 299/457 (65%), Gaps = 32/457 (7%)

Query: 1   MNALSYITNHVQLPFSKLRDNNKVKAN---IVPENIVGKKDWSSISNDQKGTITRENASP 57
           MNAL Y +NH+     + + N +V  N   + P   V  K  S   ND    ++  +   
Sbjct: 1   MNALKYFSNHLITTKKQKKINVEVTKNQDLLGPSKEVSNKYTSHSEND---CVSEVDQQY 57

Query: 58  EKGLSSVKDAHNQNVEGAIHIKQQIPRKRITILSVF-EKFNLFSLLANIILFVPRYLFLN 116
           +   S +K++ +QN E     K  +P+K   + S+  EK  + S+L  ++LF+P YL + 
Sbjct: 58  DHSSSHLKES-DQNQER----KNSVPKKPKALRSILIEK--IASILWALLLFLPYYLIIK 110

Query: 117 PLIYVWFILTLPLTLVERGIKLRDRKKKA------EL---RGNFGESSELSP-----LRS 162
           PL+ +WF+ T PL+++ER +K  D++ +       EL     N  +SSE +      L +
Sbjct: 111 PLMSLWFVFTFPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPKNCNLNT 170

Query: 163 ISEVGEEDLSTSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKK 222
           I E  E+DL+ SDE  LQRD +KGSLLRA S K       KS +   + + +  +FGTK+
Sbjct: 171 IPEAVEDDLNASDEIILQRDNVKGSLLRAQSVKSRPRSYSKSELSLSNHSSSNTVFGTKR 230

Query: 223 MGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGI 282
           MGRFLFPKKLIP+S+L  ++KK LV+DLDETLIHS SR TTH NSSQGHLVEVKF ++GI
Sbjct: 231 MGRFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGI 290

Query: 283 STLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNC 342
            TLY++HKRP+CDLFL+KVSKWY+++IFTASMKEYADPVIDWLE SF  +F+KR YR +C
Sbjct: 291 RTLYFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDC 350

Query: 343 LLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWI 402
           +LRDGVGYIKDLS++ ++       +      L +VIIIDNSPVSYA+NVDNAIQVEGWI
Sbjct: 351 VLRDGVGYIKDLSIVKDSEENGKGSS----SSLDDVIIIDNSPVSYAMNVDNAIQVEGWI 406

Query: 403 SXXXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMF 439
           S              EA+RY+TDVRN+LALK+GEK F
Sbjct: 407 SDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAF 443

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  399 bits (1025), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 221/456 (48%), Positives = 292/456 (64%), Gaps = 29/456 (6%)

Query: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG 60
           MNAL Y +NH       L    K K  I  E +   +D  + SN+   T  R   +   G
Sbjct: 1   MNALKYFSNH-------LITTKKPKKTINVE-LTKSQDLVNASNETSKTGARHTENDIIG 52

Query: 61  LSSVKDAHNQNVEGAIHIK---QQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNP 117
            +   +    N+EG+   +   Q +  K   + S+  +  + S+L  I+LF+P YL + P
Sbjct: 53  GNHQHNHSTDNLEGSKQNEDNNQSVYIKPKALRSILRR-KIASILWTILLFLPYYLIIKP 111

Query: 118 LIYVWFILTLPLTLVERGIKLRDRKKK---------AELRGNFGESSELSP-----LRSI 163
           L+ +WF+ T PL+++ER +K  D++ K         +   GN  +S+E +      L +I
Sbjct: 112 LMSLWFVFTFPLSVIERRVKHTDKRHKEPGNSGNVSSTSSGNGNDSNEKAGSKNGNLNTI 171

Query: 164 SEVGEEDLSTSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKM 223
            E  ++DL+ SDE  LQRD +KGSLL+A S K       KS +   + +    +FGTK+M
Sbjct: 172 PETVDDDLNASDEIILQRDNVKGSLLKAQSVKSRSRSYSKSDVSLTNHSNTNTVFGTKRM 231

Query: 224 GRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGIS 283
           GRFLFPKKLIP+SIL  ++KK LV+DLDETLIHS SR TTH NSSQGHLVEVKF I+GI 
Sbjct: 232 GRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIP 291

Query: 284 TLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCL 343
           TLY++HKRP+CD FL+KVS+WY+++IFTASMKEYADPVIDWLE SF  NF+KR YR +C+
Sbjct: 292 TLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCV 351

Query: 344 LRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           LRDGVGYIKDLS++     +++N        L +VIIIDNSPVSYA+NVDNAIQVEGWIS
Sbjct: 352 LRDGVGYIKDLSII---KSSEENGKGSSPSSLDDVIIIDNSPVSYAMNVDNAIQVEGWIS 408

Query: 404 XXXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMF 439
                         EA+RY+TDVRN+LALK+GEK F
Sbjct: 409 DPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAF 444

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  398 bits (1023), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 222/461 (48%), Positives = 289/461 (62%), Gaps = 39/461 (8%)

Query: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQK---------GTIT 51
           MNALSY+++ + LP    +  +K  A  V E  V     + I+ +Q          GT  
Sbjct: 1   MNALSYVSDSLVLPLQLFKKKDKKDARNVIEKKVAAGAATEINLEQPYVDRIGKQVGTKK 60

Query: 52  RENA--SPEKGLSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFV 109
            E +   P  GL      +N  VE   H    +   R T      K N+ S+L + +LF 
Sbjct: 61  AEESLKKPTPGLEFTD--NNFIVEEEGHSSLNVTDDRKT------KNNVTSILWSFLLFF 112

Query: 110 PRYLFLNPLIYVWFILTLPLTLVERGIKLRDR-----------KKKAELRGNFGESSELS 158
           P+ L + P++++W+ILT PL+L+ERG K R R           K +  +  N     E S
Sbjct: 113 PKILIIKPILFLWYILTFPLSLIERGTKYRMRPFSQSKDSSPEKDETLVHNNSFLPEEPS 172

Query: 159 PLRSISEVGEEDLSTSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIF 218
            L +I+E+ E+DL + D  +LQRD +KGSLL+ASS + P   R   T+       N   F
Sbjct: 173 KLDAINELTEDDLVSGDGIYLQRDNVKGSLLKASSVRQPSLSRSMKTM-----VSNNTSF 227

Query: 219 GTKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFS 278
            +K+MG+FLFPKKLIP+SI   ER+K LV+DLDETLIHS+SRGTTH N SQGH+VEVKFS
Sbjct: 228 SSKRMGKFLFPKKLIPKSITQTERRKKLVLDLDETLIHSISRGTTHTNVSQGHIVEVKFS 287

Query: 279 INGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLY 338
            +G+S LYYVHKRP+CD FLSKV KWY+++IFTASMKEYADPVIDWLE SFQG F +R Y
Sbjct: 288 SSGVSMLYYVHKRPYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWLEASFQGTFTERYY 347

Query: 339 RHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQV 398
           R +C+ RDGVGYIKDL+++ + ++    +T      L EVII+DNSP+SYA+N DNAIQV
Sbjct: 348 RTDCIRRDGVGYIKDLTIIKDDSNVSVPQT----STLSEVIILDNSPISYAMNADNAIQV 403

Query: 399 EGWISXXXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMF 439
           EGWIS              EALRYTTDVR++LALKNGE+ F
Sbjct: 404 EGWISDPTDTALLNLLPLLEALRYTTDVRSILALKNGERAF 444

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  387 bits (995), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 199/377 (52%), Positives = 258/377 (68%), Gaps = 41/377 (10%)

Query: 65  KDAHNQNVEG--AIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLIYVW 122
           K+   ++VE   A+  +++I R+R        KF  ++    +ILF P++L + P   +W
Sbjct: 16  KNGKTEDVEDKVAVQKREKIVRRR-------SKFTSYAW--AVILFFPQWLIIKPTQLIW 66

Query: 123 FILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLSTSDEFFLQRD 182
           +I++LPL L+E G+K R ++K  +             L+SISE+ E+DL+  DE FLQRD
Sbjct: 67  WIISLPLLLIEYGLKSRLQRKSTK--------RSTGTLQSISELEEDDLAGGDEIFLQRD 118

Query: 183 TIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKMGRFLFPKKLIPRSILCNER 242
            +KGSL  A           K    +     +T + GTK+MGRFLFPKKLIPRS+L  E+
Sbjct: 119 AVKGSLAPA-----------KYRRSRSGSRSSTVMLGTKRMGRFLFPKKLIPRSVLHAEK 167

Query: 243 KKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSKVS 302
           +K LVVDLDETLIHS SR T+H NS+QGH+VE++F+I+G+STLYYVHKRP CDLFLSKVS
Sbjct: 168 RKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVS 227

Query: 303 KWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANH 362
           KWY++V+FTASM+EYADPVIDWLEGSF G F+KRLYR+NC+LRDGVGYIKDLS++     
Sbjct: 228 KWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCG--- 284

Query: 363 AQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISXXXXXXXXXXXXXXEALRY 422
                   P   L EVI++DNSP+SYA+NVDNAIQVEGWIS              EALRY
Sbjct: 285 --------PTVTLGEVILVDNSPISYAMNVDNAIQVEGWISDPSDTDLLTLLPFLEALRY 336

Query: 423 TTDVRNVLALKNGEKMF 439
           TTDVR++LALKN E+ F
Sbjct: 337 TTDVRDILALKNSEQAF 353

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  387 bits (993), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/455 (49%), Positives = 294/455 (64%), Gaps = 28/455 (6%)

Query: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRE-NASPEK 59
           MNAL Y +NH+ +   K R N+    N         +D ++ +   +   T E N   + 
Sbjct: 1   MNALKYFSNHL-ITTKKPRKNHVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDH 59

Query: 60  GLSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLI 119
               +KD  NQN E  + I  + P+   +IL    K  + S+L  ++LF+P YL + PL+
Sbjct: 60  SSDHLKD-FNQNEERKLFISAK-PKSLRSIL----KEKIGSILWALLLFLPYYLVIKPLM 113

Query: 120 YVWFILTLPLTLVERGIKLRDRKKKAELRGNFGE--------------SSELSPLRSISE 165
            +W++ T PL+++ER +K  D++ K       G               +S+   L +ISE
Sbjct: 114 SLWYVFTFPLSVIERRVKHTDKRNKESSDNENGSPTSSSSAGDSSEKINSKNCNLNTISE 173

Query: 166 VGEEDLSTSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIK-QDHEAMNTNIFGTKKMG 224
             E+DL+ SDE  LQRD +KGSLLRA S K       KS +   +H + NT +FGTK+MG
Sbjct: 174 TVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNT-VFGTKRMG 232

Query: 225 RFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGIST 284
           RFLFPKKLIP+S+L  ++KK LV+DLDETLIHS SR TTH NSSQGHLVEVKF I+GI T
Sbjct: 233 RFLFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIRT 292

Query: 285 LYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLL 344
           LY++HKRP+CDLFL+KVSKWY ++IFTASMKEYADPVIDWLE SF  +F++R YR +C+L
Sbjct: 293 LYFIHKRPYCDLFLTKVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRYYRSDCVL 352

Query: 345 RDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISX 404
           RDGVGYIKDLS++ N+   +   +      L +VIIIDNSPVSYA+NVDNAIQVEGWIS 
Sbjct: 353 RDGVGYIKDLSIIKNSEENEKGSS----SSLDDVIIIDNSPVSYAMNVDNAIQVEGWISD 408

Query: 405 XXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMF 439
                        EA+RY+TDVRN+LALK+GEK F
Sbjct: 409 PTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAF 443

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  381 bits (979), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 194/348 (55%), Positives = 244/348 (70%), Gaps = 11/348 (3%)

Query: 98  LFSLLANIILFVPRYLFLNPLIYVWFILTLPLTLVERGIKLRDRKKKAE-LRGNFGESSE 156
            F ++ +II F P Y+ + P ++VWFILT PL+L+E  ++ R +  + E L  +   + +
Sbjct: 121 FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKD 180

Query: 157 LSP---LRSISEVGEEDLSTSDEFFLQRDTIKGSLLRASSDKPP-VFQRYKSTIKQDHEA 212
            SP   L  I E  E+DL + +   LQ+D +KGSLL  + D      Q+ +        +
Sbjct: 181 NSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPS 240

Query: 213 MNTNIFGTKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL 272
             +NI GTK MGRF FPKKLIPRSIL +E+KKTLV+DLDETLIHSVSRGTTH NSSQ H+
Sbjct: 241 HTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHI 300

Query: 273 VEVKFSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGN 332
           +EV+F+I+G+STLYYVHKRP+CDLFLSKV KWYN++IFTASMKEYADPVIDWLE SF G+
Sbjct: 301 IEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGS 360

Query: 333 FAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNV 392
           F +R+YR++C+ RDGVGYIKDL    N          +P   L +V+IIDNSPVSYA++V
Sbjct: 361 FTQRMYRNHCIARDGVGYIKDLG---NIKDPYSKNATIP---LTDVVIIDNSPVSYAMHV 414

Query: 393 DNAIQVEGWISXXXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMFE 440
           DNAIQVEGWIS              EALRYTTDVRNVLALKN EK F+
Sbjct: 415 DNAIQVEGWISDPTDTELLNLLPFLEALRYTTDVRNVLALKNSEKAFQ 462

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  366 bits (939), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 207/441 (46%), Positives = 281/441 (63%), Gaps = 60/441 (13%)

Query: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITR-ENASPEK 59
           MNA+SYITNHV  P  K  + N +K           KD +       GT+++ E  +PE 
Sbjct: 1   MNAISYITNHVTPP--KFDEANSIK-----------KDQADAQ--AHGTVSKSEQNAPE- 44

Query: 60  GLSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLI 119
                 D  ++N             K+ T LS         LL +IILF+P +  + P++
Sbjct: 45  ------DDEDKN-----------QTKKATKLS---------LLWSIILFLPNFFIIKPVL 78

Query: 120 YVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLSTSDEFFL 179
           + W+I+T PL L+E      + ++  E   + G+  +   +  I E  EEDL+  DE  L
Sbjct: 79  FFWYIITFPLNLIEHSPADDEDERNGEEGNSTGDEEKTPSINIIVEEDEEDLA-GDEIIL 137

Query: 180 QRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNI-FGTKKMGRFLFPKKLIPRSIL 238
           Q D +KGSL   S  +    +  K++ +    + +T    G+++MGRFLFPKKLIP+S+L
Sbjct: 138 QTDAVKGSLSTISESQQ--VKTIKASTRSSIRSGSTGTALGSRRMGRFLFPKKLIPQSVL 195

Query: 239 CNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFL 298
            NE+KK LV+DLDETLIHS+SRGT+  NSSQGH+VEVKF+++GIS+LY+VHKRP+CDLFL
Sbjct: 196 NNEKKKILVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFAVSGISSLYFVHKRPYCDLFL 255

Query: 299 SKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLV 358
           SKV+KWY +V+FTASMKEYADPVIDWLE SF G+F++RLYR +C+LRDGVGYIKDLS++ 
Sbjct: 256 SKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLSLIS 315

Query: 359 NANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISXXXXXXXXXXXXXXE 418
                         + L+E+II+DNSP+SYA+NVDNAIQVEGWIS              E
Sbjct: 316 K-------------KSLNEIIIVDNSPISYAMNVDNAIQVEGWISDPTDTDLLNLLPLLE 362

Query: 419 ALRYTTDVRNVLALKNGEKMF 439
           ALR+TTD+RNVL+LK+GE+ F
Sbjct: 363 ALRFTTDIRNVLSLKSGEQAF 383

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  352 bits (904), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 189/344 (54%), Positives = 244/344 (70%), Gaps = 25/344 (7%)

Query: 117 PLIYVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELS---------------PLR 161
           PL++ W++LT PLTL E+      R + ++   +  ++S ++                L+
Sbjct: 52  PLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQLQ 111

Query: 162 SISEVGEEDLSTSDEFFLQRDTIKGSLLRASS-DKPPVFQ---RYKSTIKQDHEAMNTNI 217
           ++  V E+D+    E  LQRDT+KGSLL AS+  K P      +  S +K    +M++++
Sbjct: 112 NLDSVLEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVK----SMSSSV 166

Query: 218 -FGTKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVK 276
            FGTKKMGRFLFPKKLIPRSIL + RKK LV+DLDETLIHS+SR  ++ N++Q HLVEVK
Sbjct: 167 AFGTKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSNSNSNNAQAHLVEVK 226

Query: 277 FSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKR 336
           F I+GISTLYYVHKRP+CDLFLS VSKWY+++IFTASMKEYADPVIDWLE SF GNF+KR
Sbjct: 227 FQISGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKR 286

Query: 337 LYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAI 396
            YR++C+LRDGVGYIKDLS++ + N    N+       LHE+I+IDNSPVSYA+NVDNAI
Sbjct: 287 YYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHEIILIDNSPVSYAMNVDNAI 346

Query: 397 QVEGWISXXXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMFE 440
           QVEGWIS              E+LRYTTDVRN+L+LKNGE+ F+
Sbjct: 347 QVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGERAFD 390

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  348 bits (892), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/471 (43%), Positives = 282/471 (59%), Gaps = 85/471 (18%)

Query: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG 60
           MNALSYI++++  P         ++   +P      +D  + +ND   T     +S  + 
Sbjct: 1   MNALSYISSNLITP---------IEEEELPSG-SQSEDVQTYTNDVSDTCV---SSQTQI 47

Query: 61  LSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLIY 120
           +S V+D  N++                         N  S L  ++LF P+YL + P+ +
Sbjct: 48  ISKVEDVLNED-------------------------NQRSTLVLVLLFFPKYLLVKPIFF 82

Query: 121 VWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLSTSDEFFLQ 180
           +WF++T P+TL E        +K  +L  +      +S  ++++ + EEDLS   E  LQ
Sbjct: 83  LWFLITFPITLFE--------QKNKKLPKSSANLDTMSKSKNLNILVEEDLSGGGEIILQ 134

Query: 181 RDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFG--TKKMGRFLFPKKLIPRSIL 238
           RDT+ GSLL++ +++       + + +  H   +++  G  +KK+GRFLFPKKLIPRSIL
Sbjct: 135 RDTLNGSLLKSRANQ-------QHSHQSRHAKSSSSSVGLISKKIGRFLFPKKLIPRSIL 187

Query: 239 CNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFL 298
            + RKK LV+DLDETLIHS+SR T + N++Q HLVEVKF I+GISTLYYVHKRP+CDLFL
Sbjct: 188 HSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFL 247

Query: 299 SKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVL- 357
           SKV +WY+++IFTASMKEYADPVIDWLE SF+G+F+KR YR++C+LRDGVGYIKDLS++ 
Sbjct: 248 SKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVN 307

Query: 358 -VNANHAQDNKTF----------------------------LPVEGLHEVIIIDNSPVSY 388
            +  +HA    +                             L    L EVI+IDNSPVSY
Sbjct: 308 AIPGSHAASTTSHNNHNNNNNSNTNSNDNNDNNDTNAHTHQLQNNLLSEVILIDNSPVSY 367

Query: 389 ALNVDNAIQVEGWISXXXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMF 439
           A+NVDNAIQV+GWIS              E+LR TTDVRN+L+LKNGE+ F
Sbjct: 368 AMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAF 418

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  343 bits (880), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 260/416 (62%), Gaps = 53/416 (12%)

Query: 54  NASPEKGLSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYL 113
            A+P +    V+D+   N    +  K+   RKR            ++LL +++ F+P  +
Sbjct: 20  TATPHR----VEDSEKANARIDVAPKEAQKRKRAR----------WTLLWSMLAFLPNLI 65

Query: 114 FLNPLIYVWFILTLPLTLVER-------GIKLRDRKKKAELRGNFGESSELSPLRSISEV 166
            + P+++VWF++T PL+L+ER       G+   + +  ++   + G  S  +  R  +  
Sbjct: 66  VVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSSRISTIT 125

Query: 167 GEEDLSTSDEFFLQRDTIKGSLLRASS--DKPPVFQR------YKSTIKQDHEAMNT--- 215
            EED    +E  LQ DT+KGSL   S   ++P    R       +   K   +++ T   
Sbjct: 126 EEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRQPLQPQQQQPKTSRQSLKTSSV 185

Query: 216 ---------NIFGTKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVN 266
                       G+++MGRFLFPKKLIP+S+L   +++TLV+DLDETLIHS+SRGT+  N
Sbjct: 186 RSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHSMSRGTSSSN 245

Query: 267 SSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLE 326
           SSQGH+VEVKF+ +GISTLY+VHKRP+CDLFL+K++KWY +V+FTASMKEYADPVIDWLE
Sbjct: 246 SSQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLE 305

Query: 327 GSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPV 386
            SF G F++RLYR +C+LRDGVGYIKDLSV+V            P   L ++ IIDNSPV
Sbjct: 306 SSFPGKFSRRLYRQDCILRDGVGYIKDLSVVV------------PNASLSDIFIIDNSPV 353

Query: 387 SYALNVDNAIQVEGWISXXXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMFENV 442
           SYA++VDNAIQVEGWIS              EALR+TTD+RNVLALK+GE  F NV
Sbjct: 354 SYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLALKSGEHAFTNV 409

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  336 bits (861), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 179/325 (55%), Positives = 214/325 (65%), Gaps = 50/325 (15%)

Query: 113 LFLNPLIYVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLS 172
           +FL P   +WF++T PL L+E G+K + + +    +G      E+          ++DL+
Sbjct: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKVESTSRKGEIIRKKEV----------DDDLA 108

Query: 173 TSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKMGRFLFPKKL 232
             DE FLQRDT+KG L            R K+             FGTKKMGRFLFPKKL
Sbjct: 109 -EDEMFLQRDTVKGGL------------RGKA-------------FGTKKMGRFLFPKKL 142

Query: 233 IPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRP 292
           +P+SIL  ERKK LVVDLDETLIHS +R  +H NS+QGH+VEV+F  + ISTLYYVHKRP
Sbjct: 143 VPQSILFAERKKRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRP 202

Query: 293 FCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIK 352
            CDLFLSKVSKWY+++IFTASMKEYADPVIDWLE SF G F KRLYRHNC++R+GVGYIK
Sbjct: 203 HCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIK 262

Query: 353 DLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISXXXXXXXXX 412
           DLSV+               E L EV++IDNSP SYA N DNAIQVEGWIS         
Sbjct: 263 DLSVV--------------TEVLDEVVLIDNSPTSYARNEDNAIQVEGWISDPSDTDLLN 308

Query: 413 XXXXXEALRYTTDVRNVLALKNGEK 437
                EALRY TDVR++L LKNGEK
Sbjct: 309 LLPLLEALRYVTDVRSILGLKNGEK 333

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  334 bits (856), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/466 (42%), Positives = 268/466 (57%), Gaps = 83/466 (17%)

Query: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG 60
           MNA+SY+TN+   P  +   ++       PENI G  D +   N +   +  +     +G
Sbjct: 1   MNAISYLTNNALTPKPEGPSSS-------PENIEGSADVNVSGNGKNPQLKVKKTRKSRG 53

Query: 61  LSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLIY 120
           +                                     ++ L +I++F+P  L + P+++
Sbjct: 54  IR------------------------------------WAFLWSILVFLPNLLVVKPILF 77

Query: 121 VWFILTLPLTLVERGIKLRDR---KKKAELRGNFGESSELSPLRS-------ISEVGEED 170
           VWF++T PL+L+ER          +   +  GN     ++S           I+ + EED
Sbjct: 78  VWFVITFPLSLIERSSTPESAGGTESSLQRTGNLYSDEQVSTTSDSVGSKPRINTIQEED 137

Query: 171 LS-TSDEFFLQRDTIKGSLLRASSDKPPVF-------QRYKSTIKQDHEAMNT------- 215
                DE FLQ DT+KGSL  A++  PP         Q++    +Q  +A +        
Sbjct: 138 DDLGGDEIFLQPDTVKGSLT-ATNCVPPEHSQDLSRRQQHSKGSRQSPKAASVRSGASSS 196

Query: 216 --NIFGTKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLV 273
                G+++MGRFLFPKKLIP+S+L   + +TLV+DLDETLIHS+SRGT+  NSSQGH+V
Sbjct: 197 AGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLDLDETLIHSMSRGTSSSNSSQGHMV 256

Query: 274 EVKFSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNF 333
           EVKF+I+GISTLY+VHKRP+CDLFL+ ++ WY +V+FTASMKEYADPVIDWLE SF G F
Sbjct: 257 EVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVFTASMKEYADPVIDWLESSFPGKF 316

Query: 334 AKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVD 393
           ++RLYR +C+LRDGVGYIKDLS +             P   L ++ IIDNSPVSYA++VD
Sbjct: 317 SRRLYRQDCILRDGVGYIKDLSAVA------------PNTLLSDIFIIDNSPVSYAMHVD 364

Query: 394 NAIQVEGWISXXXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMF 439
           NAIQVEGWIS              EALR+TTDVRN+LALK+GE  F
Sbjct: 365 NAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEHAF 410

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  315 bits (808), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 169/354 (47%), Positives = 219/354 (61%), Gaps = 45/354 (12%)

Query: 113 LFLNPLIYVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLS 172
           + + PLI++W+I T PL L+E+    + +     +      SS             +DL+
Sbjct: 57  ILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTPPLIDPKIASSSA---------TDLDDLN 107

Query: 173 TSDEFFLQRDTIKGSLLR--------ASSDKPPVFQRYKSTIKQDH------EAMNTNIF 218
           ++DE  LQ D+IKGSLL           S  PP        IKQ         ++ +N  
Sbjct: 108 SNDEIILQTDSIKGSLLEKKNTSAAATPSATPPATSPSPLVIKQKKIQNKSVYSLTSNFI 167

Query: 219 GTKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKF- 277
           G+K MGRFLFPKKLIP SIL   ++K L++DLDETLIHS+SR  +    S  HL+EVKF 
Sbjct: 168 GSKNMGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNISSSTISNYHLIEVKFP 227

Query: 278 -------SING----ISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLE 326
                  S  G    +S+LYYV+KRP+CD FL+ VS WY+++IFTASMKEYADPVIDWLE
Sbjct: 228 TPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLE 287

Query: 327 GSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPV 386
            SF GNF KRLYR++C+LRDG+GYIKDLSVL   N +           L+E+I+IDNSP+
Sbjct: 288 DSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQST----------LNELILIDNSPI 337

Query: 387 SYALNVDNAIQVEGWISXXXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMFE 440
           S+A+NVDNAIQV+GWIS              E+LR+TTDVRN+LALKNGE+ F 
Sbjct: 338 SFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNILALKNGERAFH 391

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  285 bits (730), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 159/335 (47%), Positives = 218/335 (65%), Gaps = 45/335 (13%)

Query: 105 IILFVPRYLFLNPLIYVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSIS 164
           ++ F+P++L + P++ VWF+LT PL+L+E+           E  G  G  +     +   
Sbjct: 53  VLFFLPKWLVVKPVVLVWFVLTFPLSLIEQ-------TSSKEADGAPGPEAAEE-EQLAE 104

Query: 165 EVGEEDLSTSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKMG 224
            V ++DL+  +   LQ D++K S                        + + + + + ++G
Sbjct: 105 AVEDDDLA-GESMVLQEDSVKSS----------------------RPSTSRSSYTSTRLG 141

Query: 225 RFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGIST 284
           +FLFPKKLIP+SIL  +RKK LV+DLDETLIHS+SR T+ V++SQGH+VEV F+ +G+ST
Sbjct: 142 KFLFPKKLIPQSILQTDRKKLLVLDLDETLIHSMSRSTSSVSNSQGHMVEVTFAASGVST 201

Query: 285 LYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLL 344
           LYYVHKRP+CDLFLS+VSKWY++VIFTASMKEYADPVIDWLE      F++R YR +CLL
Sbjct: 202 LYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLL 261

Query: 345 RDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWISX 404
           RDGVGY+KDLS++               + L ++II+DNSP+SYA+NVDNAIQVEGWIS 
Sbjct: 262 RDGVGYVKDLSII--------------SKNLQDIIIVDNSPISYAMNVDNAIQVEGWISD 307

Query: 405 XXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMF 439
                        E LR+TTD RN+L+LKNGE+ F
Sbjct: 308 PTDTGLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  284 bits (727), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 156/340 (45%), Positives = 211/340 (62%), Gaps = 42/340 (12%)

Query: 100 SLLANIILFVPRYLFLNPLIYVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSP 159
           S +  ++ F+P +L + P+  +WF+LT PL L+E              +    E  E+ P
Sbjct: 54  SWVWRVVFFLPTWLIIKPIWLIWFVLTFPLNLIEH----------TSSKDGSVEEEEVIP 103

Query: 160 LRSISEVGEEDLSTSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFG 219
             S    G E         ++ D + G  +    D          +IK    + + + + 
Sbjct: 104 TNSQGSGGGE--------VIEDDDLVGESMVLHED----------SIKSSRPSTSRSSYT 145

Query: 220 TKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSI 279
           + ++G+FLFPKKLIP+SIL  +RKK LV+DLDETLIHS+SR T+  N+SQGH+VEV FS+
Sbjct: 146 STRLGKFLFPKKLIPQSILQTDRKKVLVLDLDETLIHSMSRSTSSSNTSQGHMVEVTFSV 205

Query: 280 NGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYR 339
           +G+S+LYYVHKRP+CDLFLS+V KWY++VIFTASM+EYADPVIDWLE      F KR YR
Sbjct: 206 SGVSSLYYVHKRPYCDLFLSRVCKWYDLVIFTASMREYADPVIDWLESGISARFTKRKYR 265

Query: 340 HNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVE 399
            +C+LRDG+GY+KDL+++               + L + II+DNSPVSYA+NVDNAIQVE
Sbjct: 266 SDCILRDGIGYVKDLTMI--------------SKNLQDTIIVDNSPVSYAMNVDNAIQVE 311

Query: 400 GWISXXXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMF 439
           GWIS              E LR+TTD RN+L+LKNGE  F
Sbjct: 312 GWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  246 bits (627), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 139/351 (39%), Positives = 195/351 (55%), Gaps = 63/351 (17%)

Query: 105 IILFVPRYLFLNPLIYVWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSIS 164
           I++F+P YL + P+I +W+++T PL L+E              +GN G     S   S +
Sbjct: 73  ILIFLPNYLLIKPIITIWYVITFPLNLME-----------TNTQGNKGLIQVGSETDSRT 121

Query: 165 E-----VGEEDLSTSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFG 219
           E     V EEDLS +DE  + +D +K   +                              
Sbjct: 122 EKLSKYVVEEDLSPTDEIIINQDKMKPRPI------------------------------ 151

Query: 220 TKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQG--------- 270
           T+ +G+F FPKKL+P+S+L +  +K LV+DLDETLIHS+S   +  N +           
Sbjct: 152 TEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMI 211

Query: 271 HLVEVKFSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQ 330
           HLVEV+F    ISTLY V KRP+CD+FL + S+WY+I IFTASMKEYADPVIDWL+ +  
Sbjct: 212 HLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCS 271

Query: 331 GNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYAL 390
             F  R YR +C LR GVGY+KD+  +  A   + ++       L ++IIIDNSP+SYA+
Sbjct: 272 VQFHYRWYREDCTLRPGVGYVKDIGTV--ATQIETSR------DLSQMIIIDNSPISYAM 323

Query: 391 NVDNAIQVEGWISXXXXXXXXXXXXXXEALRYTTDVRNVLALKNGEKMFEN 441
           ++DNAIQV GWI+              +A+R+ TD R +LALK+G     N
Sbjct: 324 HLDNAIQVHGWINDPSDSELLHLLPLLKAMRHVTDSRCILALKSGRASISN 374

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 96.3 bits (238), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 64/173 (36%), Positives = 95/173 (54%), Gaps = 25/173 (14%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHK 290
           L+P      E KK LV+DLDETL+HS  +   ++ ++   + VE+   ++ +    YV K
Sbjct: 218 LLPPKDPVFEGKKCLVLDLDETLVHSSFK---YLRTADFVIPVEIDDQVHNV----YVIK 270

Query: 291 RPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGY 350
           RP  D FL +V K Y +V+FTAS+  Y DP++D L+   +G    RL+R +C   DG  Y
Sbjct: 271 RPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDP--RGAVHHRLFRDSCYNYDG-NY 327

Query: 351 IKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           IK+LS +                 L ++II+DNSP SY L+  +AI +  W S
Sbjct: 328 IKNLSQIGRP--------------LSDLIILDNSPASYILHPQHAIPISSWFS 366

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 98/173 (56%), Gaps = 25/173 (14%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHK 290
           L+P  +   ++KK L++DLDETL+HS  +   +++S+   L VE+   ++ +    YV K
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHSSFK---YMHSADFVLPVEIDDQVHNV----YVIK 268

Query: 291 RPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGY 350
           RP  D FL++VS+ Y +V+FTAS+  YA+P++D L+ +  G    RL+R  C   +G  Y
Sbjct: 269 RPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NY 325

Query: 351 IKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           IK+LS +                 L E II+DNSP SY  +  +A+ +  W S
Sbjct: 326 IKNLSQIGRP--------------LSETIILDNSPASYIFHPQHAVPISSWFS 364

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 93.2 bits (230), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 96/173 (55%), Gaps = 25/173 (14%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHK 290
           L+P  +   ++KK L++DLDETL+HS  +   ++ ++   L VE+   ++ +    YV K
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFK---YMQTADFVLPVEIDDQVHNV----YVIK 263

Query: 291 RPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGY 350
           RP  D FL +VS+ Y +V+FTAS+  YA+P++D L+ +  G    RL+R  C   +G  Y
Sbjct: 264 RPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NY 320

Query: 351 IKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           IK+LS +                 L E II+DNSP SY  +  +A+ +  W S
Sbjct: 321 IKNLSQIGRP--------------LSETIILDNSPASYIFHPQHAVPISSWFS 359

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 95/172 (55%), Gaps = 22/172 (12%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKR 291
           L P+ I    RKK L++DLDETL+HS  +   +V+S+      +  +I+  +   YV KR
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFK---YVDSAD---FVIPVTIDNQTHHVYVIKR 365

Query: 292 PFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYI 351
           P  D FL +VS+ Y +V+FTAS+  Y DP+++ L+ +       RL+R +C   +G  Y+
Sbjct: 366 PGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPA-NTIIHHRLFRESCYTYEG-NYV 423

Query: 352 KDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           K+LS L                 L+E+II+DNSP SY  +  +AI +  W S
Sbjct: 424 KNLSQL--------------GRPLNEIIILDNSPASYIFHPQHAIPISSWFS 461

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 93.2 bits (230), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 97/173 (56%), Gaps = 25/173 (14%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHK 290
           L+P  +   ++KK L++DLDETL+HS  +   +++++   L VE+   ++ +    YV K
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFK---YMHTADFVLPVEIDDQVHNV----YVIK 263

Query: 291 RPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGY 350
           RP  D FLS+V + Y +V+FTAS+  YA+P++D L+ +  G    RL+R  C   +G  Y
Sbjct: 264 RPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NY 320

Query: 351 IKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           IK+LS +                 L E II+DNSP SY  +  +A+ +  W S
Sbjct: 321 IKNLSQIGRP--------------LSETIILDNSPASYIFHPQHAVPISSWFS 359

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 92.8 bits (229), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 98/178 (55%), Gaps = 30/178 (16%)

Query: 227 LFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTL 285
           L P KL+P      ++KK L++DLDETL+HS  +   +++++   L VE+   ++ +   
Sbjct: 204 LLPPKLLPF-----QQKKCLILDLDETLVHSSFK---YLHTADFVLPVEIDDQVHNV--- 252

Query: 286 YYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLR 345
            YV KRP  D FL +VS+ Y +V+FTAS+  YA+P++D L+ +       RL+R  C   
Sbjct: 253 -YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPN--RTIHHRLFREACYNY 309

Query: 346 DGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           +G  YIK+LS +                 L E II+DNSP SY  +  +A+ +  W S
Sbjct: 310 EG-NYIKNLSQIGRP--------------LSETIILDNSPASYIFHPQHAVPISSWFS 352

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/163 (35%), Positives = 91/163 (55%), Gaps = 23/163 (14%)

Query: 241 ERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSK 300
           + KK LV+DLDETL+HS  +   +++++   L     +I+  +   YV KRP  D FL +
Sbjct: 305 KNKKCLVLDLDETLVHSSFK---YIDTADFVL---PVTIDDQTHQVYVIKRPGVDEFLKR 358

Query: 301 VSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNA 360
           V K + +V+FTAS+  Y DP++D L+ S   +   RL+R +C + DG  Y+K+LS +   
Sbjct: 359 VGKIFEVVVFTASVSRYGDPLLDILDSS--KSIHHRLFRESCYIYDG-NYVKNLSQIGRP 415

Query: 361 NHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
                         L ++II+DNSP SY  +  +AI +  W S
Sbjct: 416 --------------LSDIIILDNSPASYIFHPQHAIPISSWFS 444

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 90/162 (55%), Gaps = 25/162 (15%)

Query: 243 KKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHKRPFCDLFLSKV 301
           KK LV+DLDETL+HS  +   +++++   L V++   I+ +    YV KRP  D FL +V
Sbjct: 277 KKCLVLDLDETLVHSSFK---YLHTADFVLPVDIDDQIHNV----YVIKRPGVDEFLQRV 329

Query: 302 SKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNAN 361
            + Y +V+FTAS+  Y DP++D L+ S   N   RL+R  C   +G  YIK+LS +    
Sbjct: 330 GELYEVVVFTASVSRYGDPLLDVLDKS--NNIHHRLFRDACYTYEG-NYIKNLSQIGRP- 385

Query: 362 HAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
                        L E+II+DNSP SY  +  +AI +  W S
Sbjct: 386 -------------LSEIIILDNSPPSYIFHPQHAIPISSWFS 414

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 91/172 (52%), Gaps = 21/172 (12%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKR 291
           L+P     ++ KK L++DLDETL+HS  +      ++   ++ ++     I  +Y + KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFI----NNPDFILPIEIEDGQIHNVYVI-KR 355

Query: 292 PFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYI 351
           P  D FL +V KWY IVIFTAS+  YA+P++D L+         RL+R  C   +   +I
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNL-INHRLFRDACYNYEN-NFI 413

Query: 352 KDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           K+LS +                 LH++II+DNSP SY  +  +AI +  W S
Sbjct: 414 KNLSQI--------------GRPLHDIIILDNSPASYIFHPQHAIPISSWFS 451

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 89/172 (51%), Gaps = 22/172 (12%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKR 291
           L P+  +  + KK LV+DLDETL+HS  +     N+     V +   I+ +    YV KR
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFKYLP--NADFNLPVNIDDQIHNV----YVIKR 385

Query: 292 PFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYI 351
           P  D FL KV K + +VIFTAS+  Y DP++D L+   +     RL+R  C   +G  YI
Sbjct: 386 PGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKS-IHHRLFREACYNYEG-NYI 443

Query: 352 KDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           K+LS +                 L E+II+DNSP SY  +  +AI +  W S
Sbjct: 444 KNLSQMGRP--------------LSEIIILDNSPASYIFHPQHAIPISSWFS 481

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 90.5 bits (223), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 114/230 (49%), Gaps = 28/230 (12%)

Query: 204 STIKQDHEAMNTNIFGTKKMGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTT 263
           S + QD   ++ ++    +     F   L P++  C   KK LV+DLDETL+HS  +   
Sbjct: 183 SDMDQDDTYIDLSLLQPDQYHASGFRTLLPPQTNECF-GKKCLVLDLDETLVHSSFK--- 238

Query: 264 HVNSSQGHL-VEVKFSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVI 322
           +++++   L V++   I+ +    YV KRP  D FL +V++ Y +V+FTAS+  Y DP++
Sbjct: 239 YLHTADFVLPVDIDDQIHNV----YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLL 294

Query: 323 DWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIID 382
           D L+ S   +   RL+R  C   +G  Y+K+L+ +                 L E++I+D
Sbjct: 295 DILDSS--NSIHHRLFREACYNYEG-NYVKNLAQIGRP--------------LSEIVILD 337

Query: 383 NSPVSYALNVDNAIQVEGWISXXXXXXXXXXXXXXEAL--RYTTDVRNVL 430
           NSP SY  +  +AI +  W S              E L  +Y  DV  +L
Sbjct: 338 NSPASYMFHPQHAIPISSWFSDTHDNELLDIIPLLEDLSQKYVPDVGKIL 387

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 92/173 (53%), Gaps = 25/173 (14%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHK 290
           L+P       RKK LV+DLDETL+HS  +   ++ S+   L V++   I+ +    YV K
Sbjct: 302 LLPPPEKSLSRKKCLVLDLDETLVHSSFK---YLKSADFVLPVDIDDQIHNV----YVIK 354

Query: 291 RPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGY 350
           RP  D FL +V + + +V+FTAS+  Y DP++D L+     +   RL+R  C   +G  Y
Sbjct: 355 RPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKG--KSIHHRLFREACYNYEG-NY 411

Query: 351 IKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           IK+LS L                 L ++II+DNSP SY  +  +AI +  W S
Sbjct: 412 IKNLSQLGRP--------------LSDIIILDNSPASYIFHPQHAIPISSWFS 450

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 117/242 (48%), Gaps = 41/242 (16%)

Query: 163 ISEVGEEDLSTSDEFFLQRDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKK 222
           I+E+ E+    +D+  +  DTI+             F  Y    +Q  + ++  +   ++
Sbjct: 454 ITEINED----ADQIMIDSDTIEDE-----------FNPYLDETQQQQQFVDLTVLQPQQ 498

Query: 223 MGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSING 281
                F   L P++ +    KK L++DLDETL+HS  +   ++ S+   + V++   I+ 
Sbjct: 499 YHAMGFNTLLPPQNQIF-SGKKCLILDLDETLVHSSFK---YLTSADFVIPVDIDEQIHN 554

Query: 282 ISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHN 341
           +    YV KRP  D FL  VSK + +V+FTAS+  Y DP++D L+         RL+R  
Sbjct: 555 V----YVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLDK--HRCIHHRLFREA 608

Query: 342 CLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
           C   +G  YIK+LS +                 L E+II+DNSP SY  +  +AI +  W
Sbjct: 609 CYDYEG-NYIKNLSQI--------------GRPLSELIILDNSPASYIFHPQHAIPISSW 653

Query: 402 IS 403
            S
Sbjct: 654 FS 655

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 62/185 (33%), Positives = 97/185 (52%), Gaps = 27/185 (14%)

Query: 222 KMGRFLFP--KKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFS 278
           + G++  P  K L+P      + KK L++DLDETL+HS  +   ++ S+   L VE+   
Sbjct: 221 QQGQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFK---YLRSADFVLPVEIDDQ 277

Query: 279 INGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLY 338
           ++ +    YV KRP  + FL +V K + +V+FTAS+  Y DP++D L+         RL+
Sbjct: 278 VHNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDA--DKVIHHRLF 331

Query: 339 RHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQV 398
           R  C   +G  YIK+LS +                 L ++II+DNSP SY  +  +AI +
Sbjct: 332 REACYNYEG-NYIKNLSQIGRP--------------LSDIIILDNSPASYIFHPQHAIPI 376

Query: 399 EGWIS 403
             W S
Sbjct: 377 SSWFS 381

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 87.4 bits (215), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 90/162 (55%), Gaps = 25/162 (15%)

Query: 243 KKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHKRPFCDLFLSKV 301
           KK LV+DLDETL+HS  +   +V ++   L VE++  I+ +    YV KRP  D FL +V
Sbjct: 228 KKCLVLDLDETLVHSSFK---YVRTADFVLPVEIEDQIHNV----YVIKRPGVDEFLKRV 280

Query: 302 SKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNAN 361
            + Y +V+FTAS+  Y DP+++ L+ S   +   RL+R  C   +G  YIK+L+ +    
Sbjct: 281 GELYEVVVFTASVSRYGDPLLNILDQS--NSVHHRLFREACYNYEG-NYIKNLAQIGRP- 336

Query: 362 HAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
                        L ++II+DNSP SY  +  +AI +  W S
Sbjct: 337 -------------LSDIIILDNSPASYMFHPQHAIPISSWFS 365

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 86.7 bits (213), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 107/208 (51%), Gaps = 26/208 (12%)

Query: 199 FQRYKSTIKQDHEAMNTNIFGTKKMGRFLFP--KKLIPRSILCNERKKTLVVDLDETLIH 256
            Q ++ST     +  +T  + + +  +F  P    L+P      + +K LV+DLDETL+H
Sbjct: 133 LQDHQSTADSVQDNFSTISYSSLQKNQFHAPGCNTLLPPIQQSLQNRKCLVLDLDETLVH 192

Query: 257 SVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMK 315
           S  +   +V+++   L V++      +    YV KRP  D FL   SK + +VIFTAS++
Sbjct: 193 SSFK---YVSTADFVLPVDIDDQFQNV----YVIKRPGVDAFLQYTSKLFEVVIFTASVE 245

Query: 316 EYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGL 375
           +Y +P++D L+ +       RL+R  C   +G  YIK+L+ L                 L
Sbjct: 246 KYGNPLLDILDST-NDLVHHRLFRDACYNYNG-NYIKNLAQL--------------GRPL 289

Query: 376 HEVIIIDNSPVSYALNVDNAIQVEGWIS 403
            ++II+DNSP SY  + ++AI +  W S
Sbjct: 290 SDIIILDNSPTSYLFHPNHAIPISSWFS 317

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 87.0 bits (214), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 92/173 (53%), Gaps = 26/173 (15%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHK 290
           L PR+   N  KK LV+DLDETL+HS  +   ++ ++   L V++   I+ +    YV K
Sbjct: 273 LPPRAPAFN-GKKCLVLDLDETLVHSSFK---YLRTADFVLPVDIDDQIHNV----YVIK 324

Query: 291 RPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGY 350
           RP  D FL +V   Y +V+FTAS+  Y DP++D L+         RL+R +C   +G  Y
Sbjct: 325 RPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDK--HKTIHHRLFRESCYNYEG-NY 381

Query: 351 IKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           IK+LS +                 L ++II+DNSP SY  +  +AI +  W S
Sbjct: 382 IKNLSQIGRP--------------LSDIIILDNSPASYIFHPQHAIPISSWFS 420

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 87.0 bits (214), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 90/173 (52%), Gaps = 25/173 (14%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHK 290
           L+P        +K LV+DLDETL+HS  +   ++ S+   L V++   I+ +    YV K
Sbjct: 300 LLPPPSKAVSHRKCLVLDLDETLVHSSFK---YLKSADFVLPVDIDDQIHNV----YVIK 352

Query: 291 RPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGY 350
           RP  D FL +V K Y +V+FTAS+  Y DP++D L+     +   RL+R  C   +G  Y
Sbjct: 353 RPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKD--KSIHHRLFREACYNYEG-NY 409

Query: 351 IKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           IK+LS +                 L  +II+DNSP SY  +  +AI +  W S
Sbjct: 410 IKNLSQIGRP--------------LSNIIILDNSPASYIFHPQHAIPISSWFS 448

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 87.0 bits (214), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 84/164 (51%), Gaps = 29/164 (17%)

Query: 243 KKTLVVDLDETLIHS---VSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLS 299
           KK LV+DLDETL+HS     +G   V       V++   I+ +    YV KRP  D FL 
Sbjct: 312 KKCLVLDLDETLVHSSFKYLKGADFV-----LPVDIDDQIHNV----YVMKRPGVDEFLK 362

Query: 300 KVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVN 359
           KV   + +VIFTAS+  Y DP++D L+     +   RL+R  C   +G  YIK+LS +  
Sbjct: 363 KVGSLFEVVIFTASVARYGDPLLDILDK--HKSVHHRLFREACYNYEG-NYIKNLSQIGR 419

Query: 360 ANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
                          L E+II+DNSP SY  +  +AI +  W S
Sbjct: 420 P--------------LSEIIILDNSPASYIFHPQHAIPISSWFS 449

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 96/185 (51%), Gaps = 27/185 (14%)

Query: 222 KMGRFLFP--KKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFS 278
           + G++  P    L+P      + KK L++DLDETL+HS  +   ++ S+   L VE+   
Sbjct: 234 QQGQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFK---YLRSADFVLSVEIDDQ 290

Query: 279 INGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLY 338
           ++ +    YV KRP  + FL +V K + +V+FTAS+  Y DP++D L+         RL+
Sbjct: 291 VHNV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDT--DKVIHHRLF 344

Query: 339 RHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQV 398
           R  C   +G  YIK+LS +                 L ++II+DNSP SY  +  +AI +
Sbjct: 345 REACYNYEG-NYIKNLSQIGRP--------------LSDIIILDNSPASYIFHPQHAIPI 389

Query: 399 EGWIS 403
             W S
Sbjct: 390 SSWFS 394

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 91/173 (52%), Gaps = 25/173 (14%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHK 290
           L+P      + KK LV+DLDETL+HS  +   ++ ++   L V +   ++ +    YV K
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFK---YLRTADFVLPVNIDDQVHNV----YVIK 281

Query: 291 RPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGY 350
           RP  D FL +V + Y +V+FTAS+  Y DP++D L+     +   RL+R  C   +G  Y
Sbjct: 282 RPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQ--HKSIHHRLFREACYNYEG-NY 338

Query: 351 IKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           IK+LS +                 L E+II+DNSP SY  +  +AI V  W S
Sbjct: 339 IKNLSQIGRP--------------LSEIIILDNSPASYIFHPQHAIPVSSWFS 377

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 87/162 (53%), Gaps = 25/162 (15%)

Query: 243 KKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHKRPFCDLFLSKV 301
           KK L++DLDETL+HS  +   ++ S+   L VE+   ++ +    YV KRP  + FL +V
Sbjct: 245 KKCLILDLDETLVHSSFK---YLRSADFVLPVEIDDQVHNV----YVIKRPGVEEFLERV 297

Query: 302 SKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNAN 361
            K + +V+FTAS+  Y DP++D L+         RL+R  C   +G  YIK+LS +    
Sbjct: 298 GKLFEVVVFTASVSRYGDPLLDILDT--DKVIHHRLFREACYNYEG-NYIKNLSQIGRP- 353

Query: 362 HAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
                        L E+II+DNSP SY  +  +AI +  W S
Sbjct: 354 -------------LSEIIILDNSPASYIFHPQHAIPISSWFS 382

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 92/173 (53%), Gaps = 25/173 (14%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHK 290
           L+P      + KK L++DLDETL+HS  +   ++ S+   L VE+   ++ +    YV K
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFK---YLRSADFVLPVEIDDQVHNV----YVIK 286

Query: 291 RPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGY 350
           RP  + FL +V K + +V+FTAS+  Y DP++D L+ +       RL+R  C   +G  Y
Sbjct: 287 RPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTN--KVIHHRLFREACYNYEG-NY 343

Query: 351 IKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           IK+LS +                 L ++II+DNSP SY  +  +AI +  W S
Sbjct: 344 IKNLSQIGRP--------------LSDIIILDNSPASYIFHPQHAIPISSWFS 382

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 84/164 (51%), Gaps = 29/164 (17%)

Query: 243 KKTLVVDLDETLIHS---VSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLS 299
           KK LV+DLDETL+HS     R    V       VE+   I+ +    YV KRP  D FL 
Sbjct: 240 KKCLVLDLDETLVHSSFKFLRTADFVIP-----VEIDNQIHNV----YVIKRPGVDEFLK 290

Query: 300 KVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVN 359
            V + Y +V+FTAS+  Y DP++D L+ +       RL+R +C   DG  YIK+LS +  
Sbjct: 291 LVGQLYEVVVFTASVSRYGDPLLDVLDQT--QCIHHRLFRDSCYNYDG-NYIKNLSQIGR 347

Query: 360 ANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
                          L ++II+DNSP SY  +  +AI +  W S
Sbjct: 348 P--------------LSDLIILDNSPASYIFHPQHAIPISSWFS 377

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/173 (33%), Positives = 96/173 (55%), Gaps = 26/173 (15%)

Query: 232 LIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHK 290
           L+P++ +  + KK LV+DLDETL+HS  +   ++ ++   + VE+   ++ +    YV K
Sbjct: 234 LLPKADMF-KGKKCLVLDLDETLVHSSFK---YLRTADFVIPVEIDNQVHNV----YVIK 285

Query: 291 RPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGY 350
           RP  D FL ++++ Y +V+FTAS+  Y DP++D L+         RL+R +C   +G  Y
Sbjct: 286 RPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDK--DKTIHHRLFRDSCYNYEG-NY 342

Query: 351 IKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
           IK+LS +                 L ++II+DNSP SY  +  +AI +  W S
Sbjct: 343 IKNLSQIGRP--------------LSDMIILDNSPASYIFHPQHAIPISSWFS 381

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 94/175 (53%), Gaps = 25/175 (14%)

Query: 230 KKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYV 288
           + L+P       R+K LV+DLDETL+HS  +   +++++   + VE+   ++ +    YV
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFK---YLHTADFVIPVEIDNQVHNV----YV 361

Query: 289 HKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGV 348
            KRP  D FL +V + Y +V+FTAS+  Y DP++D L+         RL+R +C   +G 
Sbjct: 362 IKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDK--HNVVHHRLFRDSCYNYEG- 418

Query: 349 GYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
            YIK+LS +                 L ++II+DNSP SY  +  +AI +  W S
Sbjct: 419 NYIKNLSQIGRP--------------LSDLIILDNSPASYIFHPHHAIPISSWFS 459

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 87/162 (53%), Gaps = 24/162 (14%)

Query: 243 KKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHKRPFCDLFLSKV 301
           KK LV+DLDETL+HS  +   ++ ++   L V +   I+ +    YV KRP  + FL +V
Sbjct: 302 KKCLVLDLDETLVHSSFK---YLQTADFVLPVNIDEQIHNV----YVIKRPGVEEFLKRV 354

Query: 302 SKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNAN 361
            + + +V+FTAS+  Y DP++D L+   Q     RL+R  C   +G  YIK+LS +    
Sbjct: 355 GELFEVVVFTASVARYGDPLLDILDPGRQL-IHHRLFREACYNYEG-NYIKNLSQMGRP- 411

Query: 362 HAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
                        L E+II+DNSP SY  +  +AI +  W S
Sbjct: 412 -------------LSEIIILDNSPASYIFHPQHAIPISSWFS 440

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 84.0 bits (206), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 84/164 (51%), Gaps = 29/164 (17%)

Query: 243 KKTLVVDLDETLIHS---VSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLS 299
           KK LV+DLDETL+HS     R    V       VE+   ++ +    YV KRP  D FL 
Sbjct: 239 KKCLVLDLDETLVHSSFKFLRTADFVIP-----VEIDNQVHNV----YVIKRPGVDDFLR 289

Query: 300 KVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVN 359
            V + Y +V+FTAS+  Y DP++D L+ +       RL+R +C   DG  YIK+LS +  
Sbjct: 290 LVGQLYEVVVFTASVSRYGDPLLDVLDQNH--CIHHRLFRDSCYNYDG-NYIKNLSQIGR 346

Query: 360 ANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
                          L ++II+DNSP SY  +  +AI +  W S
Sbjct: 347 P--------------LSDLIILDNSPASYIFHPQHAIPISSWFS 376

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 91/162 (56%), Gaps = 25/162 (15%)

Query: 243 KKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHKRPFCDLFLSKV 301
           +K LV+DLDETL+HS  +   +++++   + VE+   ++ +    YV KRP  D FL +V
Sbjct: 308 RKCLVLDLDETLVHSSFK---YLHTADFVIPVEIDNQVHNV----YVIKRPGVDEFLKRV 360

Query: 302 SKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNAN 361
            + + +V+FTAS+  Y DP++D L+  ++     RL+R +C   +G  YIK+LS +    
Sbjct: 361 GELFEVVVFTASVSRYGDPLLDILD-QYKA-VHHRLFRDSCYNYEG-NYIKNLSQIGRP- 416

Query: 362 HAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
                        L ++II+DNSP SY  +  +A+ +  W S
Sbjct: 417 -------------LSDLIILDNSPASYIFHPQHAVPISSWFS 445

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 86/162 (53%), Gaps = 25/162 (15%)

Query: 243 KKTLVVDLDETLIHSVSRGTTHVNSSQGHL-VEVKFSINGISTLYYVHKRPFCDLFLSKV 301
           +K LV+DLDETL+HS  +   ++N +   L V++   +  +    YV KRP  D FL  V
Sbjct: 282 RKCLVLDLDETLVHSSFK---YLNIADFVLPVDIDNQVQNV----YVSKRPGVDEFLKIV 334

Query: 302 SKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNAN 361
              Y +++FTAS+  Y +P++D L+         RL+R +C + +G  Y+K+LS +    
Sbjct: 335 GDLYEVIVFTASVSRYGNPLMDILDP--HKYIHHRLFRDSCYVYEG-NYVKNLSQIGRP- 390

Query: 362 HAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGWIS 403
                        L ++II+DNSP SY  +  +AI +  W S
Sbjct: 391 -------------LGDIIILDNSPASYIFHPQHAIPISSWFS 419

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 77/157 (49%), Gaps = 37/157 (23%)

Query: 245 TLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSKVSKW 304
           TLV+ L++ L+HS          SQ H         G  T     KRP  D FL  +S++
Sbjct: 193 TLVITLEDFLVHS--------EWSQKH---------GWRTA----KRPGADYFLGYLSQY 231

Query: 305 YNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQ 364
           Y IV+F+++   Y+D + + L+       +  L++ +C+ +DGV +IKDLS L       
Sbjct: 232 YEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYKDGV-HIKDLSKLNR----- 284

Query: 365 DNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
                     L +VIIID  P SY L  +NAI +E W
Sbjct: 285 ---------DLSKVIIIDTDPNSYKLQPENAIPMEPW 312

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 75/157 (47%), Gaps = 37/157 (23%)

Query: 245 TLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSKVSKW 304
           TLV+ L++ LIHS          SQ +         G  T     KRP  D FL  +S++
Sbjct: 192 TLVLTLEDFLIHS--------EWSQQY---------GWRTA----KRPGADYFLGYLSQY 230

Query: 305 YNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQ 364
           Y IV+F+++   YA+ V + ++          LY+ +CL +DGV +IKDLS L       
Sbjct: 231 YEIVLFSSNYMMYAEKVAEKMD-PIHAFVTYNLYKEHCLYKDGV-HIKDLSKLNR----- 283

Query: 365 DNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
                     L + +IID  P SY L  +NAI V+ W
Sbjct: 284 ---------DLGKTMIIDTDPNSYKLQPENAIPVKPW 311

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 79/157 (50%), Gaps = 37/157 (23%)

Query: 245 TLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSKVSKW 304
           TLV+ L++ L+HS          SQ H         G  T     KRP  D FL  +S++
Sbjct: 197 TLVLTLEDLLVHS--------EWSQKH---------GWRTA----KRPGVDYFLGYLSQY 235

Query: 305 YNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQ 364
           Y IV+F+++   Y+D + + L+       +  L++ +CL +DGV +IKDLS L      +
Sbjct: 236 YEIVLFSSNYMMYSDRIAEKLD-PIHAFVSYNLFKEHCLYKDGV-HIKDLSKL-----NR 288

Query: 365 DNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
           D K         +V+IID  P SY L  +NAI ++ W
Sbjct: 289 DEK---------KVLIIDVDPNSYKLQPENAIPMKPW 316

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 63/112 (56%), Gaps = 16/112 (14%)

Query: 290 KRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVG 349
           KRP CD FL  +S++Y IV+F+++   YA+ + + L+       +  L++ +C+ +DGV 
Sbjct: 208 KRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 265

Query: 350 YIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
           +IKD+S L        N+       L +V+ ID  P +Y L  +NAI ++ W
Sbjct: 266 HIKDISKL--------NRD------LGKVVTIDTDPNTYKLQPENAIPMDPW 303

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 79/161 (49%), Gaps = 37/161 (22%)

Query: 241 ERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSK 300
           +R  TLV+ L++ L+HS          SQ +         G  T     KRP  D FL  
Sbjct: 194 QRPLTLVITLEDFLVHS--------EWSQKY---------GWRTA----KRPGADYFLGY 232

Query: 301 VSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNA 360
           +S+++ IV+F+++   Y++ + + L+       +  L++ +C+ +DGV +IKDLS L   
Sbjct: 233 LSQYFEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV-HIKDLSKLNR- 289

Query: 361 NHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
                         L +VIIID  P SY L  +NAI +E W
Sbjct: 290 -------------DLSKVIIIDTDPNSYKLQPENAIPMEPW 317

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 61/112 (54%), Gaps = 16/112 (14%)

Query: 290 KRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVG 349
           KRP  D FL  +S+++ IV+F+++   Y+D + + L+       +  L++ +C+ +DGV 
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 274

Query: 350 YIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
           +IKDLS L                 L +VIIID  P SY L  +NAI ++ W
Sbjct: 275 HIKDLSKLNR--------------DLSKVIIIDTEPNSYKLQPENAIPMDPW 312

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 74/157 (47%), Gaps = 37/157 (23%)

Query: 245 TLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSKVSKW 304
           TLVV L++ L+HS                      NG  T     KRP  D FL  +S++
Sbjct: 202 TLVVSLEDLLVHSEWTQK-----------------NGWRTA----KRPGVDYFLGYLSQY 240

Query: 305 YNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQ 364
           Y +V+F+++   Y++ + + L+       +  LY+ +C+ ++G  +IKDLS L       
Sbjct: 241 YEVVLFSSNYMMYSEKIAEKLD-PIHAFISYNLYKEHCVYKEG-DHIKDLSKLNR----- 293

Query: 365 DNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
                     L +VII+D  P SY L  +NAI ++ W
Sbjct: 294 ---------DLGKVIIVDTDPASYKLQPENAIPMQPW 321

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 61/112 (54%), Gaps = 16/112 (14%)

Query: 290 KRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVG 349
           KRP  D FL  +S++Y IV+F+++   Y+D V + L+          L++ +CL +DGV 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 269

Query: 350 YIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
           +IKDLS L        N+       L + +IID  P +Y L  +NAI ++ W
Sbjct: 270 HIKDLSKL--------NRD------LGKTVIIDCDPNAYKLQPENAIPMKPW 307

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 79/161 (49%), Gaps = 37/161 (22%)

Query: 241 ERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSK 300
           +R  TLV+ L++ L+HS          SQ +         G  T     KRP  D FL  
Sbjct: 200 QRPLTLVITLEDFLVHS--------EWSQKY---------GWRTA----KRPGVDYFLGY 238

Query: 301 VSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNA 360
           +S++Y IV+F+++   Y + + + L+       +  L++ +C+ +DGV +IKDLS L   
Sbjct: 239 LSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYNLFKEHCVYKDGV-HIKDLSKLNR- 295

Query: 361 NHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
                         +++V+IID  P +Y L  +NAI V+ W
Sbjct: 296 -------------DVNKVLIIDTEPNNYKLQPENAIPVKPW 323

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 79/161 (49%), Gaps = 37/161 (22%)

Query: 241 ERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSK 300
           +R  TLV+ L++ L+HS          SQ +         G  T     KRP  D FL  
Sbjct: 208 QRPLTLVLTLEDLLVHS--------EWSQKY---------GWRTA----KRPGVDYFLGY 246

Query: 301 VSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNA 360
           +S++Y IV+F+++   Y + + + L+       +  L++ +C+ +DGV +IKDLS L   
Sbjct: 247 LSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYSLFKEHCVYKDGV-HIKDLSKLNR- 303

Query: 361 NHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
                         +++V+IID  P +Y L  +NAI +E W
Sbjct: 304 -------------DVNKVLIIDTDPNNYKLQPENAIPMEPW 331

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 60/112 (53%), Gaps = 16/112 (14%)

Query: 290 KRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVG 349
           KRP  D FL  +S++Y IV+F+++   Y+D V + L+          L++ +CL +DGV 
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 270

Query: 350 YIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
           +IKDLS L        N+       L + II+D  P +Y L  +NAI +  W
Sbjct: 271 HIKDLSKL--------NRD------LGKTIIVDCDPNAYKLQPENAIPMRPW 308

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (53%), Gaps = 16/112 (14%)

Query: 290 KRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVG 349
           KRP  + FL  +S++Y IV+F+++   Y++   + L+       +  L++ +C+ +DGV 
Sbjct: 220 KRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLD-PIHAFVSYNLFKEHCVYKDGV- 277

Query: 350 YIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
           +IKDLS L                 L +VIIID  P SY L  +NAI ++ W
Sbjct: 278 HIKDLSKLKR--------------DLSKVIIIDTDPNSYKLQPENAIPMDPW 315

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 77/161 (47%), Gaps = 37/161 (22%)

Query: 241 ERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSK 300
           +R  TLV+ L++ L+HS           Q H         G  T     KRP  D FL  
Sbjct: 195 QRPLTLVITLEDFLVHS--------EWDQKH---------GWRTA----KRPGADYFLGY 233

Query: 301 VSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNA 360
           +S++Y IV+F+++   YA+ + + ++       +  L++ +C+ +DGV +IKDLS L   
Sbjct: 234 LSQYYEIVLFSSNYMMYAEKIAEKMD-PIHAFISYNLFKEHCVYKDGV-HIKDLSKLNR- 290

Query: 361 NHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
                         L +V+IID    SY L  +NAI ++ W
Sbjct: 291 -------------DLKKVMIIDTDENSYKLQPENAIPMDPW 318

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 62/116 (53%), Gaps = 16/116 (13%)

Query: 286 YYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLR 345
           +   KRP  D FL  +S++Y IV+F+++   YA+ + + L+          L++ +CL +
Sbjct: 216 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFITYNLFKEHCLYK 274

Query: 346 DGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
           DGV +IKDLS L        N+       L +V+IID    S+ L  +NAI +E W
Sbjct: 275 DGV-HIKDLSKL--------NRD------LGKVLIIDTDENSFKLQPENAIYLEPW 315

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 61/112 (54%), Gaps = 16/112 (14%)

Query: 290 KRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVG 349
           KRP CD FL  +S++Y IV+F+++   Y+D + + L+       +  L++ +C+ +DG+ 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLD-PIHAFISYNLFKEHCVYKDGI- 278

Query: 350 YIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
           +IKD+S +        N+       + +V++ID  P  Y    +NAI  + W
Sbjct: 279 HIKDISKM--------NRD------VGKVVMIDTDPNCYKSQPENAIPAKPW 316

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 76/161 (47%), Gaps = 37/161 (22%)

Query: 241 ERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSK 300
           +R  TLV+ L++ L+HS           Q H         G  T     KRP  D FL  
Sbjct: 189 QRPLTLVLTLEDFLVHS--------EWDQKH---------GWRTA----KRPGTDYFLGY 227

Query: 301 VSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNA 360
           +S++Y IV+F+++   Y++ + + L+       +  LY+ +C+ ++G  +IKDLS L   
Sbjct: 228 LSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLYKEHCVYKEGT-HIKDLSKLNR- 284

Query: 361 NHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
                         L +V+IID  P +Y    +NAI V+ W
Sbjct: 285 -------------DLDKVLIIDCDPNNYKFQPENAIPVKPW 312

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 75/157 (47%), Gaps = 37/157 (23%)

Query: 245 TLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSKVSKW 304
           TLV+ L++ LIHS          SQ          NG  T     KRP  D FL  +S++
Sbjct: 203 TLVLPLEDFLIHS--------EWSQK---------NGWRTA----KRPGADYFLGYLSQY 241

Query: 305 YNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQ 364
           Y IV+F+++   +++ + + L+          L++ +C+ +DG+ +IKDLS L       
Sbjct: 242 YEIVLFSSNYMMHSEKIAEKLD-PIHAFITYNLFKEHCVYKDGI-HIKDLSHL------- 292

Query: 365 DNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
            N+       L + IIID    ++ L  +NAI  E W
Sbjct: 293 -NRD------LGKTIIIDTDANAFKLQPENAIHAEPW 322

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 75/161 (46%), Gaps = 37/161 (22%)

Query: 241 ERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSK 300
           +R  TLV+ L++ L+HS                      NG  T     KRP  D FL  
Sbjct: 163 QRPLTLVLSLEDLLVHSEWTQK-----------------NGWRTA----KRPGVDYFLGY 201

Query: 301 VSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNA 360
           +S++Y IV+F+++   Y++ + + L+       +  L++ +C+ + G  +IKDLS L   
Sbjct: 202 LSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFISYNLFKEHCVYKKG-KHIKDLSKL--- 256

Query: 361 NHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
                         +++VIIID    +Y L  +NAI ++ W
Sbjct: 257 -----------NRDVNKVIIIDTDKNNYKLQPENAIPMKPW 286

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 77/161 (47%), Gaps = 37/161 (22%)

Query: 241 ERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSK 300
           +R  TLV+ L++ L+HS          SQ              T +   KRP  D FL  
Sbjct: 183 QRPLTLVLTLEDLLVHS--------EWSQ-------------KTGWRTAKRPGVDYFLGY 221

Query: 301 VSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNA 360
           +S++Y IV+F+++   Y++ + + L+       +  L++ +C+ +D V +IKDLS L   
Sbjct: 222 LSQYYEIVLFSSNYMMYSERIAEKLD-PLHAFISYNLFKEHCVYKDHV-HIKDLSKL--- 276

Query: 361 NHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
                N+       + +V+I+D    SY L  +NA+ +  W
Sbjct: 277 -----NRD------VRKVVIMDTDANSYKLQPENALPMAPW 306

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 54/111 (48%), Gaps = 16/111 (14%)

Query: 291 RPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGY 350
           RP  D  L  +S +Y  V+F ++   Y+  V++ L+   +      L++ +C+ +DG+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLD-PIRAFITYNLFKDHCVYKDGI-H 274

Query: 351 IKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPVSYALNVDNAIQVEGW 401
           IKDLS L                 L + +IID  P S  L ++NAI  E W
Sbjct: 275 IKDLSHLNR--------------DLGKTLIIDTDPNSVKLQMENAILAEPW 311

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 22/99 (22%)

Query: 242 RKKTLVVDLDETLIHSVSRGTTH------VNSSQGHLVEVK-FSINGISTL--------- 285
           +K  LVVDLD+T+IH     T H       N +   L  VK FS++    L         
Sbjct: 164 KKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRP 223

Query: 286 ------YYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYA 318
                 YYV  RP    F  K++  + + I+T + + YA
Sbjct: 224 PPRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYA 262

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 47/106 (44%), Gaps = 22/106 (20%)

Query: 235 RSILCNERKKTLVVDLDETLIHSVSRGTTHV------NSSQGHLVEVK-FSINGISTL-- 285
           R+ L  E+K  LVVDLD+T+IH     T         N +   L +VK FS+     L  
Sbjct: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPT 219

Query: 286 -------------YYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYA 318
                        YYV  RP    FL K++  + + I+T + + YA
Sbjct: 220 LYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYA 265

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 52/122 (42%), Gaps = 24/122 (19%)

Query: 235 RSILCNERKKTLVVDLDETLIHSVSRGTTH------VNSSQGHLVEVK-FSINGISTL-- 285
           +S L   +K  LVVDLD+T+IH     T         N +   L  VK F +   + L  
Sbjct: 159 KSRLIRSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPP 218

Query: 286 -------------YYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWL--EGSFQ 330
                        YYV  RP    F  KV+  Y + I+T + + YA+ +   +  +GS  
Sbjct: 219 MYMGPKPPVHKCSYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLF 278

Query: 331 GN 332
           GN
Sbjct: 279 GN 280

>ZYRO0E00396g Chr5 complement(21090..22190) [1101 bp, 366 aa] {ON}
           conserved hypothetical protein
          Length = 366

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 334 AKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLH-EVIIIDNSPVSYALNV 392
           A   YR++     GVG  KD   L     A D+K  L V+    E I +DN P S  +NV
Sbjct: 190 ADTHYRNDVEAVQGVGPHKDSDFLTFVYQASDHKDTLQVQNFKGEWISVDNIPGSLVVNV 249

Query: 393 DNAIQV 398
              ++ 
Sbjct: 250 GQTLEA 255

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,467,290
Number of extensions: 2039194
Number of successful extensions: 6166
Number of sequences better than 10.0: 87
Number of HSP's gapped: 6216
Number of HSP's successfully gapped: 89
Length of query: 442
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 329
Effective length of database: 40,524,141
Effective search space: 13332442389
Effective search space used: 13332442389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)