Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KAFR0A012203.186ON64764726550.0
NCAS0I019103.186ON61361111701e-152
ZYRO0A04994g3.186ON60860711251e-146
NDAI0A065103.186ON7126619851e-123
Smik_4.2213.186ON6192207367e-88
YDL013W (SLX5)3.186ON6192177262e-86
Suva_4.2363.186ON6302207253e-86
AER213C3.186ON5572116993e-83
Skud_4.2403.186ON6192197019e-83
Kwal_27.98243.186ON5852216911e-81
SAKL0C07964g3.186ON6232216941e-81
KLLA0C04411g3.186ON6075696816e-80
KLTH0E15884g3.186ON5862196342e-73
Kpol_1036.523.186ON5912226054e-69
TBLA0F007203.186ON6492225857e-66
TDEL0D043503.186ON5562185728e-65
CAGL0K01881g3.186ON5062225434e-61
KNAG0J012703.186ON5472215175e-57
TPHA0A043703.186ON6642395173e-56
Kpol_480.73.502ON60554716.2
SAKL0H08580g8.599ON1367114707.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KAFR0A01220
         (647 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {O...  1027   0.0  
NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {O...   455   e-152
ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {...   437   e-146
NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa] ...   384   e-123
Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W ...   288   7e-88
YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subuni...   284   2e-86
Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W ...   283   3e-86
AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}...   273   3e-83
Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W ...   274   9e-83
Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W (...   270   1e-81
SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} simila...   271   1e-81
KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} simila...   266   6e-80
KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]...   248   2e-73
Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa] ...   237   4e-69
TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.1...   229   7e-66
TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {O...   224   8e-65
CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakl...   213   4e-61
KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3....   203   5e-57
TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.1...   203   3e-56
Kpol_480.7 s480 (15455..17272) [1818 bp, 605 aa] {ON} (15455..17...    32   6.2  
SAKL0H08580g Chr8 complement(737581..741684) [4104 bp, 1367 aa] ...    32   7.7  

>KAFR0A01220 Chr1 complement(238371..240314) [1944 bp, 647 aa] {ON}
           Anc_3.186 YDL013W
          Length = 647

 Score = 1027 bits (2655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/647 (80%), Positives = 518/647 (80%)

Query: 1   MARSEEASTYYRNMGSSGDQDSVILIXXXXXXXXXXXXXXXXXXLVPDRRIGRPRDILNR 60
           MARSEEASTYYRNMGSSGDQDSVILI                  LVPDRRIGRPRDILNR
Sbjct: 1   MARSEEASTYYRNMGSSGDQDSVILIETDEEEDERIRDENRYRRLVPDRRIGRPRDILNR 60

Query: 61  FVSTRDPGDDNETTTHVSQEGXXXXXXXXVEIVGAIEAPRDPNGPIDPGAEYIDLDTEDQ 120
           FVSTRDPGDDNETTTHVSQEG        VEIVGAIEAPRDPNGPIDPGAEYIDLDTEDQ
Sbjct: 61  FVSTRDPGDDNETTTHVSQEGDNNDDDDDVEIVGAIEAPRDPNGPIDPGAEYIDLDTEDQ 120

Query: 121 YASGHHGFNTPRIVVIXXXXXXXXXXXXXLEIIEERTTRPTVTLNLPGGESLQINASDSD 180
           YASGHHGFNTPRIVVI             LEIIEERTTRPTVTLNLPGGESLQINASDSD
Sbjct: 121 YASGHHGFNTPRIVVINGDSNNGNNEDDGLEIIEERTTRPTVTLNLPGGESLQINASDSD 180

Query: 181 RPAHRSFEWQDALPEPXXXXXXXXXXXXXXXFLNNSDDENNDTAAGRQNNRYLPSNIXXX 240
           RPAHRSFEWQDALPEP               FLNNSDDENNDTAAGRQNNRYLPSNI   
Sbjct: 181 RPAHRSFEWQDALPEPRRRLLRRSAGRIRSLFLNNSDDENNDTAAGRQNNRYLPSNIRRL 240

Query: 241 XXXXXXXXXXXXXXXXXXNEQRPEMISGNPRFDEIRNRINAYSPDIRSAFDHAQTIHEFK 300
                             NEQRPEMISGNPRFDEIRNRINAYSPDIRSAFDHAQTIHEFK
Sbjct: 241 RQEEQAQMRQLAQRRRRMNEQRPEMISGNPRFDEIRNRINAYSPDIRSAFDHAQTIHEFK 300

Query: 301 SILENIAPVTLQDCGAELISLYTEYRSYLLQNWATRRVQNSXXXXXXXXXXXXXXXXXXX 360
           SILENIAPVTLQDCGAELISLYTEYRSYLLQNWATRRVQNS                   
Sbjct: 301 SILENIAPVTLQDCGAELISLYTEYRSYLLQNWATRRVQNSAAPATAGRARTDGRDRRRR 360

Query: 361 XXXXXXXXXXFDMESNEGGLTANNLARIFLANNGFQNVFXXXXXXXXXXXXXXXXXXXXX 420
                     FDMESNEGGLTANNLARIFLANNGFQNVF                     
Sbjct: 361 TRNQRLARLRFDMESNEGGLTANNLARIFLANNGFQNVFDGGDIRDDEDGDYYGYMNEYD 420

Query: 421 XXXXEHGENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDG 480
               EHGENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDG
Sbjct: 421 DYMGEHGENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDG 480

Query: 481 YSANFDSTPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGI 540
           YSANFDSTPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGI
Sbjct: 481 YSANFDSTPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGI 540

Query: 541 GEEDRGLSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAK 600
           GEEDRGLSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAK
Sbjct: 541 GEEDRGLSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAK 600

Query: 601 ENSRKPKKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
           ENSRKPKKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF
Sbjct: 601 ENSRKPKKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647

>NCAS0I01910 Chr9 complement(350296..352137) [1842 bp, 613 aa] {ON}
           Anc_3.186 YDL013W
          Length = 613

 Score =  455 bits (1170), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 261/611 (42%), Positives = 343/611 (56%), Gaps = 41/611 (6%)

Query: 45  LVPDRRIGRPRDILNRFVSTRDPGDDNETTTHVSQ----EGXXXXXXXXVEIVGAIEAP- 99
           L PD R  RPRD +NRFV  +       +T  +S     +         + IV  I  P 
Sbjct: 36  LYPDARTDRPRDSMNRFVDAQGSNRAIRSTPDLSHLNDDQDQDQDDDDDITIVREIVNPN 95

Query: 100 --RDPNGPIDPGAEYIDLDTEDQYASGHHGFNTPRIVVIXXXXXXXXXXXXXLEIIEERT 157
             RD + PI+P AE+IDLD E  YA+       PR + I             L I +ERT
Sbjct: 96  VARD-DAPINPDAEFIDLDQEVPYANA--TIPRPRTIQIITPSPPQQQQDDDLVITQERT 152

Query: 158 TRPTVTLNLPGGESLQINASDSDRPAHRSFEWQDALPEPXXXXXXXXXXXXXXXFLNNSD 217
            RPTVTLNLPGG++LQ++A+ +D+ A  SFEWQ+ +P                 F ++  
Sbjct: 153 MRPTVTLNLPGGQTLQVDATPTDQLARSSFEWQENIPLARRQLLRRSTNRANSLFFHDDH 212

Query: 218 DENNDTAAGRQNNRYLPSNIXXXXXXXXXXXXXXXXXXXXXNEQRPEMISGNPRFDEIRN 277
           + +ND  +       LP N+                      +        NP    +R 
Sbjct: 213 ESDNDNGSVP-----LPPNVIRLRQRQQQQNREEPPPPPPPQD------DANPIMTRLRT 261

Query: 278 RINAYSPDIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELISLYTEYRSYLLQNWATRR 337
           RIN YSPDI+SAF+HA ++HEF SIL+N+AP+TLQ+CG EL+SL+T+YRS L+ NWATRR
Sbjct: 262 RINTYSPDIQSAFNHAHSLHEFTSILQNVAPLTLQECGDELLSLFTQYRSQLMVNWATRR 321

Query: 338 VQNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDMESNEGGLTANNLARIFLANN-GFQ 396
           V++S                               +  N  G   N LAR+FL N  G  
Sbjct: 322 VRSSQQNTSSSNHRQRNLRNLRRNGA-------LRVTPNANGFNVN-LARLFLMNQLGIN 373

Query: 397 NVFXXXXXXXXXXXXXXXXXXXXXXXXXEHGENEDEEAQRTQNIINMIQEREEREHDSRT 456
           N                           +H   +DE+  +TQNIINMIQ REE+EHD+RT
Sbjct: 374 N---------GNDEDQYFTGAYNSEDDADHN-GDDEDDTQTQNIINMIQRREEQEHDTRT 423

Query: 457 KGFMANTKSQREANHKKARNLPDGYSANFDSTPKTVVKAMKNGKEEEIIVDDDVAVRNNL 516
           K FMA TK Q++A  K+A  LP+ YSANF++ P   +   KNGKEE IIV+D+ A +N  
Sbjct: 424 KSFMARTKPQQDAFKKRANELPENYSANFNTEPTMKLDIKKNGKEETIIVEDNDAAKN-Y 482

Query: 517 MEVPICTLCGAELGIGIPDDFKGIGEEDRGLSFQFLVSKYKSYCPYQSLAKPSEIDRHLS 576
           +EVP CTLCG ELG+GIP DF+GI + DRG SF+ LVSKYK +CPYQSLAKPS++D+ LS
Sbjct: 483 IEVPACTLCGVELGVGIPKDFQGINDTDRGGSFESLVSKYKFHCPYQSLAKPSQLDKDLS 542

Query: 577 KRTFVAKCGHLYCGRCVARISNAKENSRKPKKELAKLIGSSHPENYGPKKCPADNCKGLL 636
           +R F+A CGH +CGRC ARI NAK  S+ PKK L +L GSSHP+NYGP+ CPAD+C+ LL
Sbjct: 543 QRVFMASCGHTFCGRCYARIDNAKSKSKLPKKTLKQLKGSSHPDNYGPRVCPADSCRSLL 602

Query: 637 RSRGKLSEVYF 647
           R + K+ EV+F
Sbjct: 603 RVKTKMREVFF 613

>ZYRO0A04994g Chr1 complement(400896..402722) [1827 bp, 608 aa] {ON}
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 608

 Score =  437 bits (1125), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 253/607 (41%), Positives = 348/607 (57%), Gaps = 48/607 (7%)

Query: 45  LVPDRRIGRPRDILNRFVSTRDPGDDNETTTHVSQEGXXXXXXXXVEIVGAIEAPR-DPN 103
           L PD RI RPRD LNRFV++      N  TT     G        V IVG I   R +  
Sbjct: 46  LHPDGRIHRPRDGLNRFVNSEGT---NVATTRSQDNGGSDDE---VAIVGEINNTRGNEE 99

Query: 104 GPIDPGAEYIDLDTEDQYASGHHGFNTPRIVVIXXXXXXXXXXXXX--LEIIEERTTRPT 161
           GPI   AEY+DLD +          N P+++ +               L I++ERTT P 
Sbjct: 100 GPIGSDAEYVDLDAD----------NGPQVIEVNDNNRNNNENSDDDGLVIVQERTTAPR 149

Query: 162 VTLNLPGGESLQINASDSDRPAHRSFEWQDALPEPXXXXXXXXXXXXXXXFLNNSDDENN 221
           VTLNLPGGESLQI+AS +DRP  RSFEWQ                       + SDD+++
Sbjct: 150 VTLNLPGGESLQIDASPTDRPYRRSFEWQQQ-DRTRRQAMERSARRASRLLFHTSDDDDD 208

Query: 222 DTAAGRQNNRYLPSNIXXXXXXXXXXXXXXXXXXXXXNEQRPEMISGNPRFDEIRNRINA 281
           D+  G   N  LP ++                     ++ R + + GNP    +R RI++
Sbjct: 209 DSGNGTVENGRLPPSVLQLRRQEEERSRLRNITRRR-DQMRSDAMQGNPVLMRLRERIDS 267

Query: 282 YSPDIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELISLYTEYRSYLLQNWATRRVQNS 341
           + PD+RSAF HAQ+++EF+SIL+++AP+TLQ+C  EL+ L+TEYRS ++QNWAT RVQ++
Sbjct: 268 FPPDVRSAFVHAQSLYEFRSILQSVAPLTLQECDNELVPLFTEYRSRMVQNWATNRVQSN 327

Query: 342 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXFDMESNEGGLTANNLARIFLAN-NGFQNVFX 400
                                        F +    GG    +LA   L N NG  +   
Sbjct: 328 QQESRRLNEENHERQRRLWHNRRH-----FRIHMGVGGGFGESLANYILMNANGMGS--- 379

Query: 401 XXXXXXXXXXXXXXXXXXXXXXXXEHGENEDEEAQRTQNIINMIQEREEREHDSRTKGFM 460
                                     G+ ++EE+  TQ+I++MIQEREEREHDSRTK +M
Sbjct: 380 ---------------NDAAWLYNGYVGDMDEEES--TQSIVSMIQEREEREHDSRTKKYM 422

Query: 461 ANTKSQREANHKKARNLPDGYSANFDSTPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVP 520
             T+ Q+++  ++A  LPDGYSA+FD+ PK  +  +++GKEE ++V DD +V +   EVP
Sbjct: 423 EKTQDQQQSYVQRAMELPDGYSASFDTEPKIKLDIVRDGKEETVVVKDD-SVSDQWQEVP 481

Query: 521 ICTLCGAELGIGIPDDFKGIGEEDRGLSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTF 580
           +CTLCG ELG+GIPD+F+GI + DRG+SF+ LV KY+ +CPYQ+LA+PS++DR LS+RTF
Sbjct: 482 VCTLCGVELGVGIPDEFEGITKMDRGVSFECLVYKYQFHCPYQTLARPSQLDRDLSRRTF 541

Query: 581 VAKCGHLYCGRCVARISNAKENSRKPKKELAKLIGSSHPENYGPKKCPADNCKGLLRSRG 640
           VA CGH YCGRC ARI NA+  SR  K++LA+L GS+HP+NYGPK CPA  CK  +R+RG
Sbjct: 542 VAPCGHTYCGRCFARIDNARGKSRMAKRKLAQLKGSAHPDNYGPKICPAKGCKSPIRTRG 601

Query: 641 KLSEVYF 647
           K+ E +F
Sbjct: 602 KMREAFF 608

>NDAI0A06510 Chr1 complement(1479651..1481789) [2139 bp, 712 aa]
           {ON} Anc_3.186 YDL013W
          Length = 712

 Score =  384 bits (985), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 249/661 (37%), Positives = 337/661 (50%), Gaps = 60/661 (9%)

Query: 22  SVILIXXXXXXXXXXXXXXXXXXLVPDRRIGRPRDILNRFVSTRDPGDDNETTTHVSQEG 81
           S ILI                  LVPDRRIGRPRD L+RF+ST     +  +     +E 
Sbjct: 77  SAILIESDPEEDARIREESRQISLVPDRRIGRPRDALHRFISTNPNNTNTTSRRDAQEEN 136

Query: 82  XXXXXXXX-VEIVGAIEAPRDPN------GPIDPGAEYIDLDTEDQYASGHHGFNTPRIV 134
                      I+  I  P   N      GPIDP AEY+DLD E +Y +     + PR +
Sbjct: 137 EENDENDDDFAIMDEIIDPTHNNNNINEIGPIDPTAEYVDLDAEPEYITN----SRPRTI 192

Query: 135 VIXXXXX----------XXXXXXXXLEIIEERTTRPTVTLNLPGGESLQINASDSDRPAH 184
           +I                       + I+EERT+ PTVTLNLPGGE L+INA  ++RP  
Sbjct: 193 IINNNSSNNNIENSNGDANDDDDDEVMILEERTSTPTVTLNLPGGERLRINADPNERPTR 252

Query: 185 RSFEW--QDALPEPXXXXXXXXXXXXXXXFLNNSDDEN---NDTAAGRQNNRYLPSNI-- 237
            SFE   ++ +P                    +  DEN   NDT     +   LP++I  
Sbjct: 253 SSFESLNENIVPLSRRQLLRRATRRATNSLFFHGSDENESDNDT-----DEVSLPASILG 307

Query: 238 -XXXXXXXXXXXXXXXXXXXXXNEQRPEM-------ISGNPRFDEIRNRINAYSPDIRSA 289
                                     P+         S N     +R RI+ Y PD+R A
Sbjct: 308 MRQRARMMAMQERQRQRQGQGQGHSAPDTSGNSVDNTSTNRNLINLRERIHTYPPDVRGA 367

Query: 290 FDHAQTIHEFKSILENIAPVTLQDCGAELISLYTEYRSYLLQNWATRRVQNSXXXXXXXX 349
           FDHAQ++ EF SI++++AP T  +C  +LISL+T+YR  ++ +W  RR++ S        
Sbjct: 368 FDHAQSLQEFTSIVQSVAPTTFAECSDDLISLFTQYRGQVMADWTLRRIRQSQRDNERLL 427

Query: 350 XXXXXXXXXXXXXXXXXXXXXFDMESNEGGLTANNLARIFLANN---GFQNVFXXXXXXX 406
                                  + +N      +NLA  FL N    G+ +V        
Sbjct: 428 RERHARVRST-------------IRANNRHF-GSNLASFFLMNQLGLGYGDVGAADDEDD 473

Query: 407 XXXXXXXXXXXXXXXXXXEHGENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQ 466
                                E ED++A  TQNIINMIQ RE+ E DSRTKGFM+ TK Q
Sbjct: 474 GDYGIGEEDNDTGRAAGAYGYEYEDDDAH-TQNIINMIQRREDAERDSRTKGFMSKTKPQ 532

Query: 467 REANHKKARNLPDGYSANFDSTPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCG 526
           ++   K+A  LP+GYS++F + PK  +   KNGK+E +I++D V +    M+VP C LCG
Sbjct: 533 QDGFKKRALALPEGYSSSFSTEPKVKMTVKKNGKDETVIMED-VDLAKYWMDVPACILCG 591

Query: 527 AELGIGIPDDFKGIGEEDRGLSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGH 586
            ELG+GIP DF G  ++D G+SF+FLVSKY  +CPYQSL+KPS++DR LS++ +VA CGH
Sbjct: 592 VELGVGIPKDFVGTSDKDHGVSFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVASCGH 651

Query: 587 LYCGRCVARISNAKENSRKPKKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVY 646
            +CGRC  RI NAK  S+ PKK+LA+L GSSHP+NYGPK CP  +CK LLRSRG++ E+Y
Sbjct: 652 TFCGRCYVRIDNAKSKSKLPKKKLAELKGSSHPDNYGPKTCPGPSCKTLLRSRGRMREIY 711

Query: 647 F 647
           F
Sbjct: 712 F 712

>Smik_4.221 Chr4 (411040..412899) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  288 bits (736), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 140/220 (63%), Positives = 175/220 (79%), Gaps = 3/220 (1%)

Query: 429 NEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDST 488
           N+ +E + TQNII+MIQEREERE D   K  M  TK+Q+E    +A +LP+GYSA+FD+T
Sbjct: 402 NDADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQEEFEARAASLPEGYSASFDTT 461

Query: 489 PKTVVKAMKNGKEEEIIV-DDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRGL 547
           PK  +  MKNGKEE IIV DDD+A    L ++P+C LCGAELG+GIPDDF G+ + DRG+
Sbjct: 462 PKMKLDIMKNGKEETIIVTDDDLA--KTLDDIPVCCLCGAELGVGIPDDFTGMSQRDRGI 519

Query: 548 SFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKPK 607
           SF+ LVSKYK +CPYQ+LA+PS +DR LSKRTF+A CGH YCGRC ARI NAK+ S+ PK
Sbjct: 520 SFEGLVSKYKFHCPYQTLARPSVLDRDLSKRTFIASCGHAYCGRCFARIDNAKKKSKTPK 579

Query: 608 KELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
           K+LA+L GS+HP+NYGPK CPA++CK L+RSRGKL EVYF
Sbjct: 580 KKLAQLKGSAHPDNYGPKLCPAESCKKLIRSRGKLKEVYF 619

 Score =  196 bits (497), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/339 (35%), Positives = 166/339 (48%), Gaps = 19/339 (5%)

Query: 15  GSSGDQDSVILIXXXXXXXXXXXXXXXXXXLVPDRRIGRPRDILNRFV--STRDPGDDNE 72
            +S   ++VILI                  L PDRR+GR RD LNRFV   +R+      
Sbjct: 16  SASSPDEAVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSRNRNAQRI 75

Query: 73  TTTHVSQEGXXXXXXXXVEIVGAIEAPRDPNGPIDPGAEYIDLDTEDQYASGHHGFNTPR 132
            TT  S+          V I+  +       GPIDP A Y+DLD E     G      PR
Sbjct: 76  HTTTTSEYSNTQGNNDDVTIIREVGRFFGDEGPIDPSAHYVDLDEE----PGSETLEAPR 131

Query: 133 IVVIXXX------XXXXXXXXXXLEIIEERTTRPTVTLNLPGGESLQINASDSDRPAHRS 186
            + +                   L I+EERTTRP +TLNLPGGE L++NA+ +D P  RS
Sbjct: 132 TIRVDNANGYLNDSHDDNENDDGLTIVEERTTRPRITLNLPGGERLEVNATTTDIPIRRS 191

Query: 187 FEWQDALPEPXXXXXXXXXXXXXXXFLNNSDDENNDTAAGRQNNRYLPSNIXXXXXXXXX 246
           FE+Q+ L                  F++ SD+ + D     ++   LP  I         
Sbjct: 192 FEFQEDLAASRRQLLRRSATRARSLFVDRSDENDEDWT---EHTHSLPETIQRARRESHM 248

Query: 247 XXXXXXXXXXXXNEQ----RPEMISGNPRFDEIRNRINAYSPDIRSAFDHAQTIHEFKSI 302
                        +Q    R E  S + R   IR RI +Y+PD+RSAF HA+++HEF+SI
Sbjct: 249 RMNRRIAERQLMAQQQRISRDENTSTSFRLQSIRERIQSYTPDVRSAFHHAESLHEFRSI 308

Query: 303 LENIAPVTLQDCGAELISLYTEYRSYLLQNWATRRVQNS 341
           L+N+APVTLQ+C  EL++L+TE+R+ LLQNWA  RV+N+
Sbjct: 309 LQNVAPVTLQECEEELMALFTEFRNQLLQNWAIERVRNT 347

>YDL013W Chr4 (429067..430926) [1860 bp, 619 aa] {ON}  SLX5Subunit
           of the Slx5-Slx8 SUMO-targeted ubiquitin ligase (STUbL)
           complex, stimulated by SUMO-modified substrates;
           contains a RING domain and two SIMs (SUMO-interacting
           motifs); forms SUMO-dependent nuclear foci, including
           DNA repair centers
          Length = 619

 Score =  284 bits (726), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 173/217 (79%), Gaps = 3/217 (1%)

Query: 432 EEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDSTPKT 491
           +E + TQNII+MIQEREERE D   K  M  T++Q+E    +A +LP+GYSA+FD+TPK 
Sbjct: 405 DEERHTQNIIDMIQEREERERDVVMKNLMNKTRAQQEEFEARAASLPEGYSASFDTTPKM 464

Query: 492 VVKAMKNGKEEEIIV-DDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRGLSFQ 550
            +   KNGKEE IIV DDD+A    L ++P+C LCGAELG+GIPDDF GI ++DRG+SF+
Sbjct: 465 KLDITKNGKEETIIVTDDDLA--KTLEDIPVCCLCGAELGVGIPDDFTGISQKDRGVSFE 522

Query: 551 FLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKPKKEL 610
            LVSKYK +CPYQ+LA+PS +DR LSKRTF+A CGH +CGRC ARI NAK+ S+ PKK+L
Sbjct: 523 GLVSKYKFHCPYQTLARPSMLDRDLSKRTFIASCGHAFCGRCFARIDNAKKKSKMPKKKL 582

Query: 611 AKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
           A+L GS+HP+NYGPK CPAD+CK L+RSRG+L EVYF
Sbjct: 583 AQLKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 619

 Score =  187 bits (475), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/334 (36%), Positives = 165/334 (49%), Gaps = 21/334 (6%)

Query: 21  DSVILIXXXXXXXXXXXXXXXXXXLVPDRRIGRPRDILNRFVSTRDPGDDNETTTHV--- 77
           ++VILI                  L PDRR+GR RD LNRFV + D    N   TH+   
Sbjct: 22  ETVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRS-DSRSRNSQRTHITAS 80

Query: 78  SQEGXXXXXXXXVEIVGAIEAPRDPNGPIDPGAEYIDLDTEDQYASGHHGFNTPRIVVIX 137
           S+          + I+  +      +GPIDP A Y+DLD E     G     TPR + + 
Sbjct: 81  SERPDFQANNDDITIIREVGRFFGDDGPIDPSAHYVDLDQE----PGSETLETPRTIQVD 136

Query: 138 XXXX------XXXXXXXXLEIIEERTTRPTVTLNLPGGESLQINASDSDRPAHRSFEWQD 191
                             L I+EERTTRP VTLNLPGGE L++ A+ +D P  RSFE+Q+
Sbjct: 137 NTNGYLNDNGNNNESDDGLTIVEERTTRPRVTLNLPGGERLEVTATTTDIPIRRSFEFQE 196

Query: 192 ALPEPXXXXXXXXXXXXXXXFLNNSDDENNDTAAGRQNNRYLPSNIXXXXXXXXXXXXXX 251
            L                  F++ SD+ + D      N   LP  I              
Sbjct: 197 DLGASRRQLLRRSATRARNLFVDRSDENDEDWTDDTHN---LPEAIQRARRESRMRMSRR 253

Query: 252 XXXXXXXNEQRP----EMISGNPRFDEIRNRINAYSPDIRSAFDHAQTIHEFKSILENIA 307
                   +Q+     E IS + R   IR RI +Y+PDIRSAF  A+++HEF+SIL+N+A
Sbjct: 254 IAERQRRVQQQRVSSDENISTSIRLQSIRERIQSYTPDIRSAFHRAESLHEFRSILQNVA 313

Query: 308 PVTLQDCGAELISLYTEYRSYLLQNWATRRVQNS 341
           P+TLQ+C  EL++L+TE+R+ LLQNWA  RV+N+
Sbjct: 314 PITLQECEEELMALFTEFRNQLLQNWAIDRVRNT 347

>Suva_4.236 Chr4 (422236..424128) [1893 bp, 630 aa] {ON} YDL013W
           (REAL)
          Length = 630

 Score =  283 bits (725), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 138/220 (62%), Positives = 175/220 (79%), Gaps = 3/220 (1%)

Query: 429 NEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDST 488
           NE +E + TQNII+MIQEREERE D   K  M  TK+Q++   ++A NLP+GYSA+FD+T
Sbjct: 413 NEADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERAANLPEGYSASFDTT 472

Query: 489 PKTVVKAMKNGKEEEI-IVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRGL 547
           PK  +  MKNGKEE I ++DDD+A    L +V +C LCG ELG+GIPDDF G+ ++DRG+
Sbjct: 473 PKMKLDIMKNGKEETITVLDDDLA--KTLEDVSVCCLCGVELGVGIPDDFVGMSQKDRGI 530

Query: 548 SFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKPK 607
           SF+ LVS+YK +CPYQ+LA+PS +DR LSKRTFVA CGH YCGRC ARI NAK+ S+ PK
Sbjct: 531 SFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVASCGHTYCGRCYARIDNAKKKSKSPK 590

Query: 608 KELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
           K+LA+L GS+HP+NYGPK CPAD+CK L+RSRG+L EVYF
Sbjct: 591 KKLAELKGSAHPDNYGPKLCPADSCKKLIRSRGRLKEVYF 630

 Score =  184 bits (468), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 161/341 (47%), Gaps = 24/341 (7%)

Query: 21  DSVILIXXXXXXXXXXXXXXXXXXLVPDRRIGRPRDILNRFV--STRDPGDDNETTTHVS 78
           +SVILI                  L PDRR+GR RD LNRF+   T D       TT  S
Sbjct: 22  NSVILIDSDKEEDASIREANLPVRLYPDRRVGRRRDALNRFIRSDTTDATPQRIGTTLRS 81

Query: 79  QEGXXXXXXXXVEIVGAIEAPRDPNGPIDPGAEYIDLDTEDQYASGHHGFNTPRIVVIXX 138
                      V I+  +      +GPIDP A Y+DLD E     G     TPRI+ +  
Sbjct: 82  DGPDTQNDIDDVTIIREVGRFFGDDGPIDPSALYVDLDQE----PGSETVETPRIIQVNN 137

Query: 139 X------------XXXXXXXXXXLEIIEERTTRPTVTLNLPGGESLQINASDSDRPAHRS 186
                                  L I+EERT RP +TLNLPGGE L++NA+  D P  RS
Sbjct: 138 TNGYLNENSNENNNDNDNDNDDGLTIVEERTARPRITLNLPGGERLEVNATPRDIPIRRS 197

Query: 187 FEWQDALPEPXXXXXXXXXXXXXXXFLNNSDDENNDTAAGRQNNRYLPSNIXXXXXXXXX 246
           FE+Q+ L                  F+  SD+++ +     +N   LP  I         
Sbjct: 198 FEFQEDLAASRRQLLRRSAARARNLFVERSDEDDENDEEWTENTNDLPETIQRARRESHM 257

Query: 247 XXXXXXXXXXXX-NEQRPEMISGN-----PRFDEIRNRINAYSPDIRSAFDHAQTIHEFK 300
                          Q+  M+S        R   IR RI AY PDIRSAF HA+++HEF+
Sbjct: 258 RMSRRVAERQHRIRAQQQRMVSNENMGTAIRLQSIRERIQAYVPDIRSAFHHAESLHEFR 317

Query: 301 SILENIAPVTLQDCGAELISLYTEYRSYLLQNWATRRVQNS 341
           SIL+N+APVTLQ+C  EL++L+TE+R+ LLQNWA  RV+N+
Sbjct: 318 SILQNVAPVTLQECEGELMALFTEFRNQLLQNWAIDRVRNT 358

>AER213C Chr5 complement(1028170..1029843) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL013W
           (HEX3)
          Length = 557

 Score =  273 bits (699), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 163/211 (77%), Gaps = 1/211 (0%)

Query: 437 TQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDSTPKTVVKAM 496
           TQNII++IQ REER+ DSR + +M +TKSQ++A   +A+ LP+GY A+FD TPK  +   
Sbjct: 348 TQNIIDIIQAREERDLDSRKRKYMEDTKSQQQAFVARAQRLPEGYYASFDPTPKMKMTLE 407

Query: 497 KNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRGLSFQFLVSKY 556
           KNGK EE++V DD+A ++  +EVP+C LCG ELG+GIPDDF GI   DRG+SF+ LVSKY
Sbjct: 408 KNGKTEEVVVADDLAAKS-YVEVPVCCLCGVELGLGIPDDFAGISAVDRGVSFESLVSKY 466

Query: 557 KSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKPKKELAKLIGS 616
             +CPYQ+LA PS  DR LS++TFVA CGH +CGRC ARI+NAK  S+  KK LA+L G 
Sbjct: 467 DFHCPYQALAHPSIADRDLSRKTFVAHCGHTFCGRCFARINNAKRFSKISKKRLAELHGP 526

Query: 617 SHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
           SHP+NYGP+ CPA+ C+G LR+RGK+ EV+F
Sbjct: 527 SHPDNYGPRVCPAEGCRGQLRTRGKMREVFF 557

 Score =  113 bits (282), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 94/295 (31%), Positives = 132/295 (44%), Gaps = 42/295 (14%)

Query: 45  LVPDRRIGRPRDILNRFVSTRDPGDDNETTTHVSQEGXXXXXXXXVEIVGAIEAPRDPNG 104
           LVPDRR+ RPRD  NRFVS       +      + EG        VEIV   E   D  G
Sbjct: 33  LVPDRRLNRPRDAANRFVSV------SGRVAAAAGEGDDE-----VEIVN--EVYLDDEG 79

Query: 105 PIDPGAEYIDLDTEDQYASGHHGFNTPRIVVIXXXXXXXXXXXXXLEIIEERTTRPTVTL 164
           PID  A+++DLD E Q  S     N                    + IIEERTT PT  L
Sbjct: 80  PIDSTADFVDLD-EQQGPSSSMVIN------------HDGGGDDDVAIIEERTTHPTFLL 126

Query: 165 NLPGGESLQINASDSDRPAHRSFEWQDALPEPXXXXXXXXXXXXXXXFLNNSDDENNDTA 224
           NLP G++L+I+ S  DRP  RSFE Q                     F+N +D E ++  
Sbjct: 127 NLPNGQTLRISGSVHDRPLRRSFETQRT---ARANMLRRAARSAQRLFMNENDGEPSERE 183

Query: 225 AGRQNNRYLPSNIXXXXXXXXXXXXXXXXXXXXXNEQRPEMISGNPRFDEIRNRINAYSP 284
           A   +  YLP ++                     + ++ E I+ +P+ D       A +P
Sbjct: 184 AS--DREYLPQSV---LRQRQQALMQERLQRQREHARQHEHIA-DPQVD-------ALAP 230

Query: 285 DIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELISLYTEYRSYLLQNWATRRVQ 339
           ++RS F HA+T+HE +++L      T      +L+ LY ++RS  + NWA +R Q
Sbjct: 231 ELRSIFYHAETLHEVRTMLNASGLGTSAAAMQDLLQLYMQFRSRQINNWARQRAQ 285

>Skud_4.240 Chr4 (423826..425685) [1860 bp, 619 aa] {ON} YDL013W
           (REAL)
          Length = 619

 Score =  274 bits (701), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 133/219 (60%), Positives = 168/219 (76%), Gaps = 1/219 (0%)

Query: 429 NEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDST 488
           N+ +E + TQNII+MIQEREERE D   K  M+ TK+Q+E    +A  LP+GYSA+FD+T
Sbjct: 402 NDADEERHTQNIIDMIQEREERERDVVMKNLMSKTKAQQEEFEDRAARLPEGYSASFDTT 461

Query: 489 PKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRGLS 548
           PK  +  MKN KEE I V DD   R  L  +P+C LCG ELG+GIPDDF G+ ++DRG+S
Sbjct: 462 PKMKLDIMKNDKEETITVTDDDLART-LEVIPVCCLCGVELGVGIPDDFIGMNQKDRGIS 520

Query: 549 FQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKPKK 608
           F+ LVSKYK +CPYQ+LA+PS +DR LS+RTF+A CGH YCGRC ARI NAK+ S+ PKK
Sbjct: 521 FEGLVSKYKFHCPYQTLARPSMLDRDLSRRTFIAACGHAYCGRCFARIDNAKKKSKTPKK 580

Query: 609 ELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
           +LA L GS+HP+NYGPK CPA++CK  +RSRG+L EVYF
Sbjct: 581 KLASLRGSAHPDNYGPKFCPAESCKKPIRSRGRLKEVYF 619

 Score =  187 bits (474), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/334 (36%), Positives = 164/334 (49%), Gaps = 20/334 (5%)

Query: 21  DSVILIXXXXXXXXXXXXXXXXXXLVPDRRIGRPRDILNRFVSTRDPGDDNET--TTHVS 78
           DSVILI                  L PDRR+GR RD LNRFV +   G + +   TT   
Sbjct: 21  DSVILIESDKEEDASIREANLPVRLYPDRRVGRRRDALNRFVRSDSVGINPQRIHTTARP 80

Query: 79  QEGXXXXXXXXVEIVGAIEAPRDPNGPIDPGAEYIDLDTEDQYASGHHGFNTPRIV---- 134
                      V IV  +      +GPIDP A ++DLD E    +      TP  +    
Sbjct: 81  NRSDPQNDNDDVTIVREVGRFFGDDGPIDPSAHFVDLDHEPDSET----LETPTTLQVDN 136

Query: 135 ---VIXXXXXXXXXXXXXLEIIEERTTRPTVTLNLPGGESLQINASDSDRPAHRSFEWQD 191
               +             L I+EERTTRP VTLNLPGGE L++NA+ +D P  RSFE+QD
Sbjct: 137 INGYLNDNFNDNDNNDDGLTIVEERTTRPRVTLNLPGGERLEVNATTTDMPIRRSFEFQD 196

Query: 192 ALPEPXXXXXXXXXXXXXXXFLNNSDDENNDTAAGRQNNRYLPSNIXXXXXXXXXXXXXX 251
            L                  F++ SD+ + +      N   +P  I              
Sbjct: 197 DLAVSRRQLLRRSAARARTLFVDRSDENDEEWTEDTDN---VPEAIQRARRESHMRMSRR 253

Query: 252 XXXXXXXNEQRP----EMISGNPRFDEIRNRINAYSPDIRSAFDHAQTIHEFKSILENIA 307
                   +Q      E ++ + RF  IR RI AY+PDIRSAF HA+++HEF+SIL+N+A
Sbjct: 254 IAERQLRAQQHRMASNENMNTSIRFQSIRERIQAYAPDIRSAFYHAESLHEFRSILQNVA 313

Query: 308 PVTLQDCGAELISLYTEYRSYLLQNWATRRVQNS 341
           PVTLQ+C  EL++L+TE+R+ LLQ+WA  RV+N+
Sbjct: 314 PVTLQECEGELMALFTEFRNQLLQDWAIDRVRNT 347

>Kwal_27.9824 s27 (74597..76354) [1758 bp, 585 aa] {ON} YDL013W
           (HEX3) - involved in hexose metabolism [contig 43] FULL
          Length = 585

 Score =  270 bits (691), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 123/221 (55%), Positives = 169/221 (76%), Gaps = 1/221 (0%)

Query: 427 GENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFD 486
           G  E +E Q+TQNII MIQEREE+E+++R + +M +TKS++    +KA  LP+GYS++FD
Sbjct: 366 GYGEVDEEQQTQNIIQMIQEREEQEYEARKRKYMEDTKSKQLGYLEKAVKLPEGYSSSFD 425

Query: 487 STPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRG 546
           +TPK  +   KNGKEEE+ V DD A     M++P C+LCG ELG+GIPD+F+G+  +DRG
Sbjct: 426 TTPKMNITIKKNGKEEELTVTDDQAA-AFYMDLPSCSLCGVELGVGIPDEFQGLSTQDRG 484

Query: 547 LSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKP 606
           +SF+ L +KY+ +CPYQ+L+KPS +DR LS+RT+VA CGH +CGRC ARI NA+  +R  
Sbjct: 485 VSFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAACGHSFCGRCFARIDNARSFNRAS 544

Query: 607 KKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
           K++L  L G+SHP+NYGPKKCPA +C   LR+RGK+ EVYF
Sbjct: 545 KQKLKDLKGASHPDNYGPKKCPAKDCNNQLRNRGKMREVYF 585

 Score =  100 bits (249), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 107/236 (45%), Gaps = 20/236 (8%)

Query: 108 PGAEYIDLDTEDQYASGHHGFNTPRIVVIXXXXXXXXXXXXXLEIIEERTTRPTVTLNLP 167
           P  EY+DLD   +   G  G   P+                 L I+EERT+ P+  LNLP
Sbjct: 90  PETEYVDLD---RSGEGSLGQRRPQAA----------SSEEDLVILEERTSSPSFVLNLP 136

Query: 168 GGESLQINASDSDRPAHRSFEWQDALP----EPXXXXXXXXXXXXXXXFLNNSDDENNDT 223
           GGE L+IN S  D+P  RSF+ Q                         F+  SDDE  ++
Sbjct: 137 GGEYLRINGSPLDQPVRRSFQAQAPRQFDSAGARRRLARRTARTASNLFMQPSDDEQEES 196

Query: 224 AAGRQNNRYLPSNIXXXXXXXXXXXXXXXXXXXXXNEQRPEMISGNPRFDEIRNRINAYS 283
             G  N   LPS +                       +   MI  +P    +  +IN   
Sbjct: 197 VEG--NTYQLPSTVMARRQRNALLMQRRPQPSRRQPVRGFGMIQ-SPELSALEAQINRLP 253

Query: 284 PDIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELISLYTEYRSYLLQNWATRRVQ 339
           P++RSAFDHAQ++HEF+SIL++I          +L SL++EYR+ LL++ + +R++
Sbjct: 254 PNVRSAFDHAQSVHEFRSILQSIDWQNYHQRQDDLTSLFSEYRANLLRSRSNQRIR 309

>SAKL0C07964g Chr3 (740340..742211) [1872 bp, 623 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 623

 Score =  271 bits (694), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 125/221 (56%), Positives = 164/221 (74%), Gaps = 2/221 (0%)

Query: 427 GENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFD 486
           G+  DEE + TQNII MIQ REERE D+R K +M +TK Q++   ++A  +P+GYSA+FD
Sbjct: 405 GQQADEEIE-TQNIIEMIQAREEREQDTRKKRYMEDTKFQQQGFLRRAEGVPEGYSASFD 463

Query: 487 STPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRG 546
           + PK  +   +NG+EEE+ V DD A +    +VP C LCG ELG+GIPD+F GI +EDRG
Sbjct: 464 TAPKMKIAMTRNGREEEVTVTDDHAAKQ-YEDVPACCLCGIELGVGIPDEFSGITKEDRG 522

Query: 547 LSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKP 606
           +SF+ LV+KY  +CPYQSLA+PS  DR LSKRT+VA CGH +CGRC AR+ NA+  SR  
Sbjct: 523 VSFESLVAKYGFHCPYQSLARPSVADRDLSKRTYVASCGHTFCGRCFARVDNARAYSRAS 582

Query: 607 KKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
           KK+LA L G+SHP+NYGPK CPA+ C   LRS+G++ EV+F
Sbjct: 583 KKKLAGLQGASHPDNYGPKTCPAEGCSMQLRSKGRMKEVFF 623

 Score =  122 bits (306), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 90/312 (28%), Positives = 144/312 (46%), Gaps = 29/312 (9%)

Query: 45  LVPDRRIGRPRDILNRFVSTRDPGDDNETTTHVSQEGXXXXXXXXVEIVGAIEAPRDPNG 104
           LV DRRI RPRD LNRF++++  G++    T  + E         +++VG  E   D +G
Sbjct: 51  LVGDRRINRPRDSLNRFLNSQ--GENR--NTRAALEPDDDEDDDDLQVVG--ETMLDRHG 104

Query: 105 PIDPGAEYIDLDTEDQYAS-------GHHGFNTPRIVVIXXXXXXXXXXXXXLEIIEERT 157
           PI   A+++DL +     +         +G  T   ++              +EI+EERT
Sbjct: 105 PIGEDADFVDLSSFGGGDTGSGGSGDNRNGVPTRTAIIRHSTGANGSDRGDDIEILEERT 164

Query: 158 TRPTVTLNLPGGESLQINASDSDRPAHRSFEWQDALPEPXXXXXXXXXXXXXXXFLN--- 214
           T P   LNLPGGESL+I+ + +D+P  RSF+ Q    +P                LN   
Sbjct: 165 TAPNFVLNLPGGESLRISGTTADQPVRRSFQNQ----QPSRTRAVSAAAAARRRLLNRTA 220

Query: 215 --------NSDDENNDTAAGRQNNRYLPSNIXXXXXXXXXXXXXXXXXXXXXNEQRPEMI 266
                   +S     D  +   +  Y+P+ +                      ++   M 
Sbjct: 221 RSATNLFFSSGQGPQDGYSEENDPDYIPAGVRQLRQQNAMRDRQASLEQRREQQRLNGMD 280

Query: 267 SG-NPRFDEIRNRINAYSPDIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELISLYTEY 325
            G N     +R+RIN Y  DI+SAFDHAQ+++EF+ I++++ P   ++   EL  LY+ Y
Sbjct: 281 PGANAELTALRSRINGYPLDIQSAFDHAQSLYEFEGIIQSVEPRMNENRKQELRELYSRY 340

Query: 326 RSYLLQNWATRR 337
           R +++ +WA  R
Sbjct: 341 RGHVMHSWAQNR 352

>KLLA0C04411g Chr3 (403257..405080) [1824 bp, 607 aa] {ON} similar
           to uniprot|P32828 Saccharomyces cerevisiae YDL013W HEX3
           Ring finger protein involved in the DNA damage response
           with possible recombination role genetically identified
           by synthetic lethality with SGS1 (DNA helicase) and TOP3
           (DNA topoisomerase) sporulation role interacts with
           Slx8p and Lin1p
          Length = 607

 Score =  266 bits (681), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 191/569 (33%), Positives = 274/569 (48%), Gaps = 66/569 (11%)

Query: 102 PNGPIDPGAEYIDLDTEDQYASGHHGFNTPRIVVIXXXXXXXXXXXXXLEIIEER---TT 158
           P+GPI+  AEYI+LD    Y + ++G      VV+             L ++EER   + 
Sbjct: 82  PDGPINDDAEYINLDN---YRASNNG-----TVVVDHREGDDD-----LMLVEERIQESG 128

Query: 159 RPTVTLNLPGGESLQINASDSDRPAHRSFEWQDALPEPXXXXXXXXXXXXXXXFLNNSDD 218
           RP V L LP G++LQ++AS ++ P  RSF+ Q                     F+   + 
Sbjct: 129 RP-VLLQLPAGQTLQVDASWNELPVGRSFQNQVYRNPNQLRRLRRHIDHATAMFMGGYNQ 187

Query: 219 ENN-DTAAGRQNNRYLPSNIXXXXXXXXXXXXXXXXXXXXXNEQRPEMISGNPRFDEIRN 277
               D+     +  Y+P +I                       QR +  +     DE   
Sbjct: 188 SGTGDSDFSDNDADYIPPDIVNERNQYTMQTRMREQRERQNQMQRLQRAA-----DET-- 240

Query: 278 RINAYSPDIRSAFDHAQTIHEFKSILE--NIAPVTLQ-------DCGAELISLYTE---Y 325
            I++  PD+RS F  +Q++ +F+  L   N  P  L+       D  A  +  + E    
Sbjct: 241 -IDSLDPDLRSLFFESQSLSQFREGLARFNFPPARLEQLLGQYRDFRARAMQSWAEGRRT 299

Query: 326 RSYLLQNWATRRVQNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFD----MESNEGGLT 381
           RS   QN  + R Q +                              D    M+ N    T
Sbjct: 300 RSMSYQNRNSLRPQRTRSGTQQNHSRGSNGDSRDNALYQQMLFGMPDDDENMDGNNFTGT 359

Query: 382 ANNLARIF--LANNGFQNVFXXXXXXXXXXXXXXXXXXXXXXXXXEHGENED-EEAQRTQ 438
             +L RI     N  F N+                          E G  ED ++A  T+
Sbjct: 360 TQSLQRIISNTMNRRFGNL--------------------PFGVGPEFGFYEDGDDAANTE 399

Query: 439 NIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDSTPKTVVKAMKN 498
            II MIQEREER+  +RTK     TKSQ++    KA +LP+GYSA+F++ P   +     
Sbjct: 400 LIIRMIQEREERDASTRTKKLNEVTKSQQQKYIDKANSLPEGYSASFNTAPLMSMTMENE 459

Query: 499 GKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRGLSFQFLVSKYKS 558
           G+EE ++V DDVA +   ++VP+C LCG ELG+GIPDD+KG+ EED+G+SF+ L S YK 
Sbjct: 460 GREETVMVTDDVAAKT-YIDVPVCVLCGVELGVGIPDDWKGVSEEDKGVSFEALQSHYKF 518

Query: 559 YCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKPKKELAKLIGSSH 618
           +CPYQ+LA+P+ +DR LS+RT+V+ CGH +CGRC  RI NA++ S K K +L    G SH
Sbjct: 519 HCPYQTLARPTLVDRDLSRRTYVSSCGHTFCGRCQVRIKNARDISAKEKNKLKNSQGPSH 578

Query: 619 PENYGPKKCPADNCKGLLRSRGKLSEVYF 647
           P+NYGPKKCPA+ C   LR +G + EVYF
Sbjct: 579 PDNYGPKKCPAEGCNSNLRKKGIMREVYF 607

>KLTH0E15884g Chr5 complement(1408264..1410024) [1761 bp, 586 aa]
           {ON} similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013W HEX3 Ring finger protein involved in the DNA
           damage response with possible recombination role
           genetically identified by synthetic lethality with SGS1
           (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
           role interacts with Slx8p and Lin1p
          Length = 586

 Score =  248 bits (634), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 124/219 (56%), Positives = 166/219 (75%), Gaps = 1/219 (0%)

Query: 429 NEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDST 488
           N+ +E ++TQNII MIQEREERE +SR + +M +TK ++    +KA  LPDGYSA+FD+T
Sbjct: 369 NDADEERQTQNIIQMIQEREEREFESRKRKYMEDTKPKQSGYLQKAAKLPDGYSASFDTT 428

Query: 489 PKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRGLS 548
           P+  +  MKNG+ EE+ V DD A     M++P C LCG ELG+GIPD F+G+ EEDRG+S
Sbjct: 429 PRMNISIMKNGQNEELTVVDDHA-DALYMDIPACCLCGVELGVGIPDGFQGLYEEDRGVS 487

Query: 549 FQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKPKK 608
           F+ L +KY  +CPYQ+L+KPS  DR LS+RT+VA+CGH +CGRC ARI NA+  +R  KK
Sbjct: 488 FEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQCGHSFCGRCFARIDNARSFNRASKK 547

Query: 609 ELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
           +L++L G+S+P+NYGPK CPA +C   LRSRGK+ EVYF
Sbjct: 548 KLSELKGASNPDNYGPKNCPAKDCNNRLRSRGKMREVYF 586

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 96/199 (48%), Gaps = 18/199 (9%)

Query: 150 LEIIEERTTRPTVTLNLPGGESLQINASDSDRPAHRSFEWQ----DALPEPXXXXXXXXX 205
           L I+EER   P+  LNLPGGE LQI+ S  D+P  RSF+ Q                   
Sbjct: 120 LVILEERNNSPSFVLNLPGGEHLQISGSPLDQPVRRSFQTQGNRHTNSANGRRRLLRRTA 179

Query: 206 XXXXXXFLNNSDDENNDTAAGRQNNRYLPSNIXXXXXXXXXXXXXXXXXXXXXNEQRPEM 265
                 FL+ SD+E  D     +N   LP+ +                     N  R ++
Sbjct: 180 RRASSLFLHPSDEE--DEGFAYENTDLLPTGV-------RLRRQRNSMMQRRPNPPRRQL 230

Query: 266 ISG-----NPRFDEIRNRINAYSPDIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELIS 320
           +       +P    +  +IN++  ++RSAFDHAQ+IHEF+SIL+++   + +    EL  
Sbjct: 231 LGTGDDVDDPELLSLEAQINSFPFEVRSAFDHAQSIHEFRSILQSVDRQSYEQRQDELTH 290

Query: 321 LYTEYRSYLLQNWATRRVQ 339
           L+T YR +++++WA  R++
Sbjct: 291 LFTVYRGHVMRSWANDRLR 309

>Kpol_1036.52 s1036 complement(140685..142460) [1776 bp, 591 aa]
           {ON} complement(140685..142460) [1776 nt, 592 aa]
          Length = 591

 Score =  237 bits (605), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 151/222 (68%), Gaps = 5/222 (2%)

Query: 429 NEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDST 488
           ++D+E  RTQ+II MIQEREE E D RTK +  +TK +++   ++A  LPDGYS++F++ 
Sbjct: 372 DDDDEEGRTQSIITMIQEREEVEKDLRTKKYSESTKEKQDEFERRATELPDGYSSSFNTE 431

Query: 489 PKTVVKAMKNGKEEEI-IVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRGL 547
           PK  V   KNG    + +VDD +A   +  E+PIC LCG  L  GIPD+F+G+  EDR L
Sbjct: 432 PKAKVDMTKNGVNGSVSVVDDTMA--EDWEEIPICCLCGVTLSEGIPDEFQGMSNEDRFL 489

Query: 548 SFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKPK 607
            F+ L  KY S+CPYQ L +PS+ DR  SKR +VA CGH YCGRC  RI N+KE S+ PK
Sbjct: 490 PFEELKEKYDSFCPYQCLIRPSQSDRDFSKRVYVANCGHTYCGRCYRRIQNSKEKSKLPK 549

Query: 608 KELAKLIGSSHPENYGPKKCPADNCKGLLR-SRG-KLSEVYF 647
            +LAKL G+ HP+NYGPKKCP  +C  LLR SRG    E YF
Sbjct: 550 SQLAKLKGACHPDNYGPKKCPVTSCNRLLRISRGVAFREAYF 591

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 268 GNPRFDEIRNRINAYSPDIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELISLY 322
            NP  DEI   I+ Y  +IRSAF HA + +EF +I+E    + + D   +L+ LY
Sbjct: 247 SNPEIDEIAREISLYHTNIRSAFIHANSFNEFMAIIEVAPRLGITD---DLVDLY 298

>TBLA0F00720 Chr6 (182887..184836) [1950 bp, 649 aa] {ON} Anc_3.186
           YDL013W
          Length = 649

 Score =  229 bits (585), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 148/222 (66%), Gaps = 2/222 (0%)

Query: 426 HGENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANF 485
           +G  E +E   TQNII MI+ERE  E DS+ K  M  TK Q+E    KA+ LP G+SA+F
Sbjct: 430 YGGTESDEEATTQNIIRMIEEREANERDSKVKQLMKKTKKQQEDFENKAKYLPKGFSASF 489

Query: 486 DSTPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDR 545
              PK ++    +  + EI+ D+ +A      E+P+C LCG ELG+GIPD F+GI  E+ 
Sbjct: 490 SLVPKKIISIDGDDSKREIVTDEFLA--EEYEELPVCCLCGVELGVGIPDSFRGITPEES 547

Query: 546 GLSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRK 605
            +SF  LV KY   CPY +L+ P +IDR LS+RT+VA CGH +CGRCV RI++AKE+ + 
Sbjct: 548 KVSFDSLVKKYNIPCPYNALSAPGDIDRDLSRRTYVASCGHSFCGRCVRRINHAKESGKI 607

Query: 606 PKKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
            K++L +L+G  +P+ YGPK CPA +C G LR +G++ EVYF
Sbjct: 608 SKQKLKELVGPENPDIYGPKTCPATDCTGKLRRKGQMREVYF 649

 Score =  145 bits (366), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 85/252 (33%), Positives = 132/252 (52%), Gaps = 9/252 (3%)

Query: 98  APRDPNGPIDPGAEYIDLDTEDQYASGHHGFNTPRIVVIXXXXXXXXXX-----XXXLEI 152
           AP DP+GP++P  EY+DLD E +Y+S ++ +   R +++                  L I
Sbjct: 141 APVDPSGPLNPSTEYVDLDNEAEYSSNNN-YGHSRTLIVDGDNDNADVIDDGNGADDLVI 199

Query: 153 IEERTTRPTVTLNLPGGESLQINASDSDRPAHRSFEWQDALPEPXXXXXXXXXXXXXXXF 212
           ++ERT+ PTVTL LPG  S+QINA+ +DRP   SF WQ  +P+                F
Sbjct: 200 VQERTSAPTVTLTLPGNRSIQINAAPTDRPVRSSFGWQGGVPDSRRGMLARRYNSVRQLF 259

Query: 213 LNNSDDEN-NDTAAGRQNNRYLPSNIXXXXXXXXXXXXXXXXXXXXXNEQRPEMISGN-- 269
            N+ +D + N + +   ++ Y P+ +                      +   +  S N  
Sbjct: 260 FNSDEDASRNGSDSDSYDDDYTPARLQRIQNRERNAVRQRMMQQRRQQQILRQEQSRNES 319

Query: 270 PRFDEIRNRINAYSPDIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELISLYTEYRSYL 329
           P   E+R RINAY PD+RS FDHA T++EF +++++ AP+TL+D   +LI ++T YR  L
Sbjct: 320 PIMAELRRRINAYPPDVRSIFDHATTLNEFLALMQSTAPITLEDNRTDLIDIFTLYRGNL 379

Query: 330 LQNWATRRVQNS 341
            QNW   R+ +S
Sbjct: 380 TQNWMINRMNSS 391

>TDEL0D04350 Chr4 complement(793070..794740) [1671 bp, 556 aa] {ON}
           Anc_3.186 YDL013W
          Length = 556

 Score =  224 bits (572), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 155/218 (71%), Gaps = 3/218 (1%)

Query: 432 EEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDSTPKT 491
           EE  RTQ+I+N IQEREE+E D++TK  M  T+SQ E   +K +NLP+GYSA+FD+TP T
Sbjct: 340 EEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKCKNLPEGYSASFDTTPTT 399

Query: 492 V-VKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRGLSFQ 550
           V ++ + +G ++ I+V+D+ A+     E+ +C LCG ELG+G+PDDF GI  +DR LSF 
Sbjct: 400 VRLEPLNDGNKQAIVVEDESAI-AEWEEIAVCCLCGVELGVGLPDDFTGISADDRHLSFD 458

Query: 551 FLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKPKKEL 610
            LV+KY S+CPYQSL   +  +R LS +TFVA CGH +CGRCV RI NA+ +S+  KKEL
Sbjct: 459 ELVTKYCSHCPYQSLTSANGTERALSMKTFVASCGHTFCGRCVVRIENARTHSKSSKKEL 518

Query: 611 AKLIGSSHPENYGPKKCPADNCKGLLR-SRGKLSEVYF 647
           +K  G  HP+NYGP+ CPA  CK  +R  R K+ E +F
Sbjct: 519 SKFKGPLHPDNYGPRLCPATGCKQNIRLGRTKMREAFF 556

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 94/241 (39%), Gaps = 48/241 (19%)

Query: 101 DPNGPIDPGAEYIDLDTE-------DQYASGHHGFNTPRIVVIXXXXXXXXXXXXXLEII 153
           D   P+   AEYIDL+ E       D         +TPR                 L  +
Sbjct: 69  DSVSPMGSTAEYIDLEMEPAGNEEQDDMIVYDERLSTPR-----------DAEDDELIFV 117

Query: 154 EERTTRPTVTLNLPGGESLQINASDSDRPAHRSFEWQDALPEPXXXXXXXXXXXXXXXFL 213
           +E+T   T+ LNLPG   ++I A++ DRPA RSFE Q                       
Sbjct: 118 QEQTRPSTIQLNLPGRNPMRITATEYDRPARRSFEQQ----------------------A 155

Query: 214 NNSDDENNDTAAGRQNNRYLPSNIXXXXXXXXXXXXXXXXXXXXXNEQRPEMISGNPRFD 273
           +N    +    A RQ  R                           N   PE  +   R D
Sbjct: 156 SNRQLRHQTRVARRQPMRRAARRANHSMNGYESDDGGLTSNRNQINYD-PEFAAIQRRLD 214

Query: 274 EIRNRINAYSPDIRSAFDHAQTIHEFKSILENIAPVTLQDCGAELISLYTEYRSYLLQNW 333
                  +Y  DIRSAF HAQ ++EF SI+EN+ P+T QDC  +L  L+ +YR  + +  
Sbjct: 215 -------SYPLDIRSAFLHAQNMNEFSSIIENVDPLTWQDCRYDLERLFMDYRRMMARRA 267

Query: 334 A 334
           A
Sbjct: 268 A 268

>CAGL0K01881g Chr11 (167939..169459) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P32828 Saccharomyces cerevisiae
           YDL013w Hexose metabolism-related protein
          Length = 506

 Score =  213 bits (543), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 148/222 (66%), Gaps = 13/222 (5%)

Query: 427 GENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFD 486
           G  +DEEAQ TQ+II++IQ+REE E D R K +   ++SQ++  +++A+ LP GYSA+F 
Sbjct: 297 GSEDDEEAQ-TQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEAKQLPPGYSASF- 354

Query: 487 STPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRG 546
           +TP+ + +            +D +          +C LCG ELGIGIP++F GI +ED  
Sbjct: 355 ATPEVIRENDDEDNSNNDDDEDMI----------VCNLCGVELGIGIPEEFTGISKEDFA 404

Query: 547 LSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSR-K 605
           LSF  L+ KY S CPYQSL KPSE+DR LSKRT+V+ CGHL+CGRC  R  NA+   + K
Sbjct: 405 LSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNARSLMKTK 464

Query: 606 PKKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
             K L   +G+SHP+N+ PK CPADNCK  +RS+GK+ EVYF
Sbjct: 465 AGKSLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF 506

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 3/89 (3%)

Query: 100 RDPNGPIDPGAEYIDLDTEDQYASGHHGFNTPRIVVIXXXXXXXXXXXXXLEIIEERTTR 159
           R P   I     YI+LD E   A+ H   +    +               + ++EER   
Sbjct: 71  RVPRRQISTPVAYINLDDE---AAHHDASDDIEFLGGNLVPNAGDNDEDAVTLLEERLAD 127

Query: 160 PTVTLNLPGGESLQINASDSDRPAHRSFE 188
             V LNLPGG  + +NA++ + P   SFE
Sbjct: 128 GLVPLNLPGGRRIIVNAANGEAPVRSSFE 156

>KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3.186
           YDL013W
          Length = 547

 Score =  203 bits (517), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 106/221 (47%), Positives = 138/221 (62%), Gaps = 9/221 (4%)

Query: 427 GENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFD 486
           G   D+E   TQNII+MIQERE+ E D+R K F   +K   ++  K+A++LP  YSA+F 
Sbjct: 336 GYPNDDEETTTQNIISMIQEREDTERDTRVKNFTDKSKPLLKSILKEAKSLPSNYSASFH 395

Query: 487 STPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGIGEEDRG 546
                    +  G   E    +         EV  C LCG+ELG+GIPD F G   EDR 
Sbjct: 396 YPSSPSKPQIPGGSTSETAESE---------EVSCCVLCGSELGVGIPDSFIGRSAEDRD 446

Query: 547 LSFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNAKENSRKP 606
           L F  L+SKY   CPYQSL +P+++DR LSKRTF++KCGH+YCGRC ARI NAK  S+  
Sbjct: 447 LDFSSLISKYSFPCPYQSLIRPNQLDRDLSKRTFMSKCGHVYCGRCFARIDNAKAKSKIS 506

Query: 607 KKELAKLIGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
           KKELA L G S+P  YGP+ C AD C  ++R++ +L E+YF
Sbjct: 507 KKELASLKGCSNPNIYGPRICVADGCTAVIRAKARLRELYF 547

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 46/73 (63%), Gaps = 8/73 (10%)

Query: 263 PEMISGN--------PRFDEIRNRINAYSPDIRSAFDHAQTIHEFKSILENIAPVTLQDC 314
           PE  SGN        P+   IR RIN+Y P+I+S F +AQ++ EF  I++N  P+T  +C
Sbjct: 193 PEYTSGNHPAALDEDPQRRRIRARINSYPPNIQSTFHYAQSLPEFTYIVQNTDPITFAEC 252

Query: 315 GAELISLYTEYRS 327
             +L +L+++Y+S
Sbjct: 253 RDDLTNLFSQYQS 265

>TPHA0A04370 Chr1 (980168..982162) [1995 bp, 664 aa] {ON} Anc_3.186
           YDL013W
          Length = 664

 Score =  203 bits (517), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 105/239 (43%), Positives = 151/239 (63%), Gaps = 26/239 (10%)

Query: 435 QRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFDS-TP-KTV 492
           Q TQ++I MIQEREEREHD RT+ F    +  ++   +KA+ +P+GYS++F +  P K +
Sbjct: 426 QETQDLIAMIQEREEREHDIRTRKFTKKNEKLQQLIREKAKTIPEGYSSSFSTEVPVKLI 485

Query: 493 VKAMKNG------KEEEIIVDDDVAVRNN--LMEVPICTLCGAELGIGIPDDFKGIGEED 544
            K  KNG      +E+++ VDD+   + N  ++EVP+C LCG ELGIGIP+ F GI  ED
Sbjct: 486 DKQDKNGNNVIMLEEQQVEVDDEFGNKKNESVIEVPVCCLCGVELGIGIPETFAGISAED 545

Query: 545 RGL-SFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAKCGHLYCGRCVARISNA---- 599
           + L  F+ + +KY   CPYQ++ +P+E+DR LS+RTF++ CGH +CGRC  RI  A    
Sbjct: 546 KKLECFKDIATKYGFSCPYQTMVRPTELDRDLSRRTFISNCGHAFCGRCYNRIHLAKAET 605

Query: 600 -KENSRKPKKELAKL----------IGSSHPENYGPKKCPADNCKGLLRSRGKLSEVYF 647
            K N R    +L +L          +GS +P+NYGPK CP  +CK  +R+R K+ E YF
Sbjct: 606 KKNNGRDITNKLTRLSQSNRISPVILGSLNPDNYGPKICPGSDCKYQIRARTKMREAYF 664

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 111 EYIDLDTEDQYASGHHGFNTPRIVVIXXXXXXXXXXXXXLEIIEERTTRPTVTLNLPGGE 170
           E +DLD E +  S  +  N   ++++              ++IE     P + LNLPGG 
Sbjct: 93  EVVDLDREPEITSVANNTNDDDLMIVGE------------QVIEN----PHILLNLPGGR 136

Query: 171 SLQINASDSDRPAHRSFEWQDAL 193
           + +++ + +D P   SFE    L
Sbjct: 137 TFELSTTTNDLPFRSSFEMLQNL 159

>Kpol_480.7 s480 (15455..17272) [1818 bp, 605 aa] {ON}
           (15455..17272) [1818 nt, 606 aa]
          Length = 605

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 467 REANHKKARNLPDGYSANFDSTPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVP 520
           R + HKK  N+ D  S N+      ++   +  K E I++D+++ +  N +EVP
Sbjct: 233 RSSLHKKIENI-DSISRNYTIKLGNIINEFQTNKNE-IVIDENIKILQNFLEVP 284

>SAKL0H08580g Chr8 complement(737581..741684) [4104 bp, 1367 aa]
           {ON} similar to uniprot|Q02979 Saccharomyces cerevisiae
           YPL110C Hypothetical ORF
          Length = 1367

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 50/114 (43%), Gaps = 7/114 (6%)

Query: 427 GENEDEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKARNLPDGYSANFD 486
           G + D E  +  N IN I +R       R K    N +S  + N   A  + +G  ++F 
Sbjct: 238 GFSNDAEIVKDLNAINEILDRIS----PRVKNIEENMRSDTKFNTSNADLVSNGSDSSF- 292

Query: 487 STPKTVVKAMKNGKEEEIIVDDDVAVRNNLMEVPICTLCGAELGIGIPDDFKGI 540
             P  VV  + +  +EE ++ + ++V  +++ +P  TL        +   FK I
Sbjct: 293 --PVDVVSQLIDADDEEGLIKELISVHRSVVLIPTRTLISLLNKSALSQSFKCI 344

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,269,715
Number of extensions: 2278931
Number of successful extensions: 5740
Number of sequences better than 10.0: 34
Number of HSP's gapped: 5872
Number of HSP's successfully gapped: 58
Length of query: 647
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 531
Effective length of database: 40,180,143
Effective search space: 21335655933
Effective search space used: 21335655933
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)