Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_83527.125ON57957929250.0
SAKL0F05390g7.125ON59558317310.0
KLLA0D14355g7.125ON58859217250.0
KLTH0F12540g7.125ON59549416840.0
Kwal_55.208327.125ON57556516680.0
NCAS0E021307.125ON52650416420.0
Skud_16.187.125ON55051816410.0
Suva_16.447.125ON54951816280.0
Smik_6.4677.125ON54851916240.0
YPL260W7.125ON55151516170.0
TDEL0H028707.125ON58756716130.0
NDAI0E036707.125ON52249515970.0
CAGL0H09108g7.125ON53249715830.0
ZYRO0C05192g7.125ON58852215570.0
ADL019W7.125ON52550515340.0
KNAG0L009407.125ON54952515270.0
KAFR0L004607.125ON51149614260.0
TBLA0A009307.125ON58654514280.0
Kpol_322.77.125ON53448713920.0
TPHA0C016107.125ON55149513700.0
Kpol_1062.587.125ON4914173947e-41
TBLA0E043708.254ON67647715.7
KLTH0G17358gna 1ON117860706.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_8352
         (579 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...  1131   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   671   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   669   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   653   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   647   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   637   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   636   0.0  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   631   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   630   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   627   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   625   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   619   0.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   614   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   604   0.0  
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   595   0.0  
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   592   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   553   0.0  
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   554   0.0  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   540   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   532   0.0  
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   156   7e-41
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...    32   5.7  
KLTH0G17358g Chr7 (1503299..1506835) [3537 bp, 1178 aa] {ON} con...    32   6.5  

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score = 1131 bits (2925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/579 (95%), Positives = 555/579 (95%)

Query: 1   MSSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELD 60
           MSSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELD
Sbjct: 1   MSSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELD 60

Query: 61  KIRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASL 120
           KIRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 61  KIRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASL 120

Query: 121 STVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDK 180
           STVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDK
Sbjct: 121 STVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDK 180

Query: 181 RKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKS 240
           RKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKS
Sbjct: 181 RKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKS 240

Query: 241 RVXXXXXXXXXXXLCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQ 300
           RV           LCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQ
Sbjct: 241 RVEQEEQDENDDELCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQ 300

Query: 301 FVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETD 360
           FVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETD
Sbjct: 301 FVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETD 360

Query: 361 LFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXR 420
           LFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYK             R
Sbjct: 361 LFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKLLESSEPVSESLER 420

Query: 421 IHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTL 480
           IHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTL
Sbjct: 421 IHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTL 480

Query: 481 NALLAECFDILHEMKIEAEVREEAAQSNEAGEKPPNNINNQTIQMTKDGTNRDVAEVRPN 540
           NALLAECFDILHEMKIEAEVREEAAQSNEAGEKPPNNINNQTIQMTKDGTNRDVAEVRPN
Sbjct: 481 NALLAECFDILHEMKIEAEVREEAAQSNEAGEKPPNNINNQTIQMTKDGTNRDVAEVRPN 540

Query: 541 IRYLDVYNPNREDDGIYDDVYTHYSDHSYEEDETTNLDD 579
           IRYLDVYNPNREDDGIYDDVYTHYSDHSYEEDETTNLDD
Sbjct: 541 IRYLDVYNPNREDDGIYDDVYTHYSDHSYEEDETTNLDD 579

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/583 (61%), Positives = 437/583 (74%), Gaps = 29/583 (4%)

Query: 9   QGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKIRKTTHE 68
           Q +PKEEE+IL+YFL++R++LS+LKQNR+QFL SKDV+ TYQ+VLTKVRELD  RK++H 
Sbjct: 7   QEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDDTRKSSHN 66

Query: 69  SSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLD 128
           +  +    TTLIHSVDLHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTVQ LL+
Sbjct: 67  TPASSA--TTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 124

Query: 129 HLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDK-------- 180
           HLNESNV+TH+DL+PIKERLDE+SEIVEKNSY N P +        +  ED+        
Sbjct: 125 HLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQEPEAQEDEQDIELKKA 184

Query: 181 ---RKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAAS 237
              + +N +EE+LLLRAKL++CL+ Y  IE+KLE I   LQ  ME+LFQIRRGLLSLAAS
Sbjct: 185 DIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLLSLAAS 244

Query: 238 AKSRVXXXXXXXXXXXLCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPE 297
            K                 +S   +N +L  L+ EL+++ SHR+ SGKF S+ + + V E
Sbjct: 245 TKRNARSKESLEDKKRTHTVSPNFVNSKLNELQVELSELESHRDPSGKFKSL-ETDKVEE 303

Query: 298 KGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLR 357
           +GQ VLNGLLDDCHDLI DLSHQTS G+ LD  +QPIYD+L+ IKT LENLLVTRRWTLR
Sbjct: 304 RGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIYDNLIDIKTTLENLLVTRRWTLR 363

Query: 358 ETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKXXXXXXXXXXX 417
           ETDLFTYQK+L E+D+LRV+GKFP+ES DSKGQ+ILLYLLRRCYAIIYK           
Sbjct: 364 ETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLYLLRRCYAIIYKLLESSEPVSEA 423

Query: 418 XXRIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQ 477
             RIHNQLSTVR CLLELKRMGGV+N+RELYPYQMKLASLDNMRVDGKFYD DGNIPEGQ
Sbjct: 424 LQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDNMRVDGKFYDADGNIPEGQ 483

Query: 478 GTLNALLAECFDILHEMKIEAEVREEAAQSNEAGEKPPNNINNQTIQMTKDGTNRDVAE- 536
           GTLNALLAECFDILHE+KIEA       +  E+G+   NN  +  +++TKD  +RD  E 
Sbjct: 484 GTLNALLAECFDILHELKIEA-----EEREEESGD---NNATSDELELTKDPESRDEFED 535

Query: 537 ---VRPNIRYLDV---YNPNREDDGIYDDVYTHYSDHSYEEDE 573
               +   ++LDV   Y+   ED+   +D   +YS+HSYE+++
Sbjct: 536 DKTAQHKAKFLDVPKQYDDEEEDEEEDEDDLANYSEHSYEDED 578

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/592 (61%), Positives = 437/592 (73%), Gaps = 31/592 (5%)

Query: 3   SANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKI 62
           S N     +P EEE+IL+YFL++R++LS++KQNR+QFL SKDV+ TYQ+VLTKVRELD++
Sbjct: 2   SVNSHPMAVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDEL 61

Query: 63  RKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLST 122
           RK +H +  N    TTLIHS +LHNRVDSVIDDVFQLLSL FLTVGLKNSAPATYASLST
Sbjct: 62  RKNSHATPSNSA--TTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLST 119

Query: 123 VQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSY------WNIPTDGGDGNAFADD 176
           VQSLL+HLNESNVYTH+DL+PIKERL+E+S IVE+N Y       ++  D  D   FA  
Sbjct: 120 VQSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQ 179

Query: 177 LEDKRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAA 236
            +++  +N IEE+LLLRAKL++C+  YN IE+KLE I  DLQ  ME LFQIRRGLLSLA+
Sbjct: 180 KDEELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLAS 239

Query: 237 SAK---------SRVXXXXXXXXXXXLCILSHEKINERLKALETELADVRSHRNESGKFV 287
           S K                         +L  + I+E+LK L+ +L  + SHR+ +GKF 
Sbjct: 240 STKRPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDEKLKQLQEQLEKLESHRDINGKFK 299

Query: 288 SVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILEN 347
           S+ + + V EKGQ VLNGLLDDCHDL+ DLSHQ   G+ LD  +QPIYD LV IKT LEN
Sbjct: 300 SL-ETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLEN 358

Query: 348 LLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKX 407
           LLVTRRWTLRETDLFTYQKKL E+D+LRVNGKFP++  DSKGQ+ILLYLLRRCYAIIYK 
Sbjct: 359 LLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKL 418

Query: 408 XXXXXXXXXXXXRIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFY 467
                       R+HNQLSTVR CLLELKRMGGVDN+RELYPYQMKLASLDNMRVDGKFY
Sbjct: 419 LESSEPVSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFY 478

Query: 468 DPDGNIPEGQGTLNALLAECFDILHEMKIEAEVREEAAQS-NEAGEKPPNNINNQTIQMT 526
           D DGNIPEGQGTLNALLAECFDI+HE+KIEAE R E     ++ GE        ++++MT
Sbjct: 479 DTDGNIPEGQGTLNALLAECFDIIHELKIEAEERVEERVDIHDDGE--------ESVEMT 530

Query: 527 KDGTNRDVAEVRPNIRYLDVY---NPNREDDGIYDDVYTHYSDHSYEEDETT 575
           KD T RDV E RP  RY+DVY   +   +DD   D    ++S+HSY+E+E T
Sbjct: 531 KDPTMRDVQE-RPTARYMDVYAHDDEGNDDDDEDDADDNNFSEHSYDEEEYT 581

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/494 (67%), Positives = 391/494 (79%), Gaps = 6/494 (1%)

Query: 9   QGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKIRKTTHE 68
           Q +P EEE  L YFLE+RN+LSRLKQNR+Q+L SKDV+ TYQ+VLTKVRELD IRK++H 
Sbjct: 6   QEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSSHH 65

Query: 69  SSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLD 128
              N    TTLIH+V+LHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTVQ LL+
Sbjct: 66  RPANSA--TTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 123

Query: 129 HLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDKRKENNIEE 188
           HL+ESNV+TH+DL+PIKERLDEISEIV ++SY +  T+  DG      ++D++  N IEE
Sbjct: 124 HLDESNVFTHHDLRPIKERLDEISEIVSQSSYLD-GTEISDGRIDFAKIQDEKDRNKIEE 182

Query: 189 NLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKSRVXXXXXX 248
           +LLLRAKL++CL+ Y  IE+KLE I   LQ  ME+LFQ+RRGLLSLAAS K         
Sbjct: 183 DLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNAMSKQGV 242

Query: 249 XXXXXLCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQFVLNGLLD 308
                L  L  E I +RL  LE EL ++ SHR+ SGKFVS+ +  ++  KGQ VLNGLLD
Sbjct: 243 KTPDSL--LPQEGIKQRLHELEAELTEIESHRDSSGKFVSL-ETGEIAGKGQNVLNGLLD 299

Query: 309 DCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETDLFTYQKKL 368
           DCHDLI DLSH  +  + LD  +QPIYD+L+ IKT LENLLVTRRWTLRETDLF+YQK+L
Sbjct: 300 DCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFSYQKRL 359

Query: 369 AELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXRIHNQLSTV 428
           +E+D LRV GKFP+E++D+KGQAILLYLLRRCYAIIYK             +IHNQLSTV
Sbjct: 360 SEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTV 419

Query: 429 RHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALLAECF 488
           R CLLELKRMGGV+N+RELYPYQMKLASLDN+RVDGKFYD DGNIPEGQGTLNALLAECF
Sbjct: 420 RRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECF 479

Query: 489 DILHEMKIEAEVRE 502
           DILHE+KIEAE RE
Sbjct: 480 DILHELKIEAEERE 493

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/565 (60%), Positives = 417/565 (73%), Gaps = 6/565 (1%)

Query: 9   QGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKIRKTTHE 68
           Q +P EEE  L+YFLE+RNYLSRLKQNR+Q+L SK+V+  YQ+VLTKVRELD+IRK +H 
Sbjct: 6   QEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIRKRSHS 65

Query: 69  SSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLD 128
           +  N    TTLIH+V+LHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTVQ LL+
Sbjct: 66  APRN--SATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLE 123

Query: 129 HLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDKRKENNIEE 188
           HL+ESNV+TH+DL+PIKERLDEISEIV ++S++    +  +G+     + D++  N IEE
Sbjct: 124 HLDESNVFTHHDLRPIKERLDEISEIVTQSSFFKEGGEINNGSIDFTKISDEKDRNKIEE 183

Query: 189 NLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKSRVXXXXXX 248
           +LLLRAKL++CL+ Y  IE+KLE I   LQ  ME+LF++RRGLLSLAAS K         
Sbjct: 184 DLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLAASTKRNAMLKDGH 243

Query: 249 XXXXXLCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQFVLNGLLD 308
                   LS E + E+L +LE +L  + S RN SG FVS  D  ++ E+GQ VLNGLLD
Sbjct: 244 KAPE--SPLSQESVKEKLHSLEAKLTQIESQRNASGYFVSA-DTGEIVERGQSVLNGLLD 300

Query: 309 DCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETDLFTYQKKL 368
           DCHDLI DLSH  +  + LD  +QPIYD+L+ IKT LENLLVTRRWTLRETDLF YQK+L
Sbjct: 301 DCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKTTLENLLVTRRWTLRETDLFAYQKRL 360

Query: 369 AELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXRIHNQLSTV 428
           +E+D LRV GKFP+ES D+KGQAILLYLLRRCYAIIYK             +IHNQLSTV
Sbjct: 361 SEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQLSTV 420

Query: 429 RHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALLAECF 488
           R CLLELKRMGGV+N+RELYPYQMKLASLDN+RVDGKFYD DGNIPEGQGTLNALLAECF
Sbjct: 421 RRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALLAECF 480

Query: 489 DILHEMKIEAEVREEAAQSNEAGEKPPNNINNQTIQMTKDGTNRDVAEVRPNIRYLDVYN 548
           DILHE+KIEAE R + + + +A         + T   T   T  D  +V+        + 
Sbjct: 481 DILHELKIEAEYR-DGSGAEDAESDAGFEAASSTATATATATATDHGKVKATFLDDSKHQ 539

Query: 549 PNREDDGIYDDVYTHYSDHSYEEDE 573
              +DD   D+  T+YS+HSYE+DE
Sbjct: 540 YAHDDDDDDDEYTTNYSEHSYEDDE 564

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/504 (64%), Positives = 397/504 (78%), Gaps = 8/504 (1%)

Query: 9   QGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKIRKTTHE 68
           Q +PKEEEDIL+Y L++R++LS+LKQNR Q+L SKDV +TYQ VLTKVRELD+IRK +H+
Sbjct: 12  QEVPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVRELDEIRKNSHD 71

Query: 69  SSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLD 128
           +       TTLIHS +LHNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLL+
Sbjct: 72  TPSKSA--TTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLE 129

Query: 129 HLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTD--GGDGNAFADDLEDKRKENNI 186
           HL+ESN++TH+DL PIK+RL+EIS+IVEK S   +P +    D      D++ +R +N I
Sbjct: 130 HLSESNIFTHHDLSPIKDRLNEISKIVEK-SCGKLPDEQLNDDEEQNLKDIDTERNKNKI 188

Query: 187 EENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKSRVXXXX 246
           E++LLLRAKL++CL  Y QIE+KLE I   L   ME+LFQIRRGLLSLAAS K  +    
Sbjct: 189 EQDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLLSLAASTKKNMNQGS 248

Query: 247 XXXXXX--XLCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQFVLN 304
                      ++S E +N++L ALE E+  + ++R+ESGKF S+ + N+V E GQ VLN
Sbjct: 249 LTSEKELENKHLVSQEYVNKKLHALEAEVQALEANRDESGKFKSL-ETNEVAENGQNVLN 307

Query: 305 GLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETDLFTY 364
           GLLDDC DLI DLSHQT+  L+LDP +QPIY+ L+ IKT LENL++TRRWTLRETDLFTY
Sbjct: 308 GLLDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTTLENLMITRRWTLRETDLFTY 367

Query: 365 QKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXRIHNQ 424
           QK+L E+D++RV G+FP++  DSKGQ ILLYLLRRCYAIIYK              IHNQ
Sbjct: 368 QKQLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAIIYKLLESSEPVSESLQPIHNQ 427

Query: 425 LSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALL 484
           LSTVR CL+ELKRMGGVDN+RELYPYQMKLASLDN+RVDGKFYD +GNIPEGQGTLNALL
Sbjct: 428 LSTVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDGKFYDSEGNIPEGQGTLNALL 487

Query: 485 AECFDILHEMKIEAEVREEAAQSN 508
           A CFDI+HE+K+EAE REE ++S+
Sbjct: 488 AACFDIMHELKVEAEEREEQSKSD 511

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/518 (63%), Positives = 394/518 (76%), Gaps = 22/518 (4%)

Query: 1   MSSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELD 60
            SSA Q  Q +PKEEE IL+Y LE+R+ L++LKQNR Q+L SKDV  TYQ VLTKVRELD
Sbjct: 2   FSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 61

Query: 61  KIRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASL 120
            IRK +H++        TLIHS +LHNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 62  DIRKNSHDTPAKSA--ATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 119

Query: 121 STVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVE-KNSYWNIPTDGGDGNAFADDLED 179
           STV+SLL+HLNESNV+TH+DL PIKERLDEIS+IVE KNS      D  D  A   ++++
Sbjct: 120 STVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDAND--ARIREIDN 177

Query: 180 KRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAK 239
           +RK+N IEE+LLLRAKL++C   Y+ +E+KLE I   L   ME+LF+IRRGLLSL ASAK
Sbjct: 178 ERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVASAK 237

Query: 240 SRVXXXXXXXXXXXL----------------CILSHEKINERLKALETELADVRSHRNES 283
             +                             ++S E ++E+L  L+ EL+++ S+R++S
Sbjct: 238 KTMSKSSANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDS 297

Query: 284 GKFVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKT 343
           GKF S+ + ++V EKGQ VLNGLLDDCHDLI DLSHQT+ GL LDPH+QP Y+ L+ IKT
Sbjct: 298 GKFKSL-ETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKT 356

Query: 344 ILENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAI 403
            LENL++TRRWTLRETDLF+YQKKL E+DS R+NGKFP++S DSKGQ+ILLYLLRRCYAI
Sbjct: 357 TLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAI 416

Query: 404 IYKXXXXXXXXXXXXXRIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVD 463
           IYK              IHNQLSTVR CLLELKRMGGV+NERELYPYQMKLASLDN+R +
Sbjct: 417 IYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTN 476

Query: 464 GKFYDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVR 501
           G FYD DGNIPEGQG LNALLAECFDI+HE+K+EAE R
Sbjct: 477 GIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEER 514

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/518 (62%), Positives = 392/518 (75%), Gaps = 21/518 (4%)

Query: 2   SSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDK 61
           S+  Q  Q +PKEEE IL+Y LE+R+ L++LKQNR Q+L SKDV  TYQ VLTKVRELD 
Sbjct: 4   SAGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDD 63

Query: 62  IRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLS 121
           IRK +H++        TLIHS +LHNRVDSV+DDVFQL+SLCFLTVGLKNSAPATYASLS
Sbjct: 64  IRKNSHDTPAK--SAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLS 121

Query: 122 TVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDKR 181
           TV+SLL+HLNESNV+TH+DL PIKERL+EI +IVEKN+  N   DG D      +++++R
Sbjct: 122 TVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQL--REIDNER 179

Query: 182 KENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAK-- 239
            +N IEE+LLLRAKL++C   Y+ +E+KLE I   L   ME+LF+IRRGLLSL ASAK  
Sbjct: 180 NKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKT 239

Query: 240 ---SRVXXXXXXXXXXXL-----------CILSHEKINERLKALETELADVRSHRNESGK 285
              S V           L            ++S E +NE+L AL+ EL ++ S+R+ESGK
Sbjct: 240 MSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGK 299

Query: 286 FVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTIL 345
           F S+ + + V E GQ VLNGLLDDCHDL+ DLSHQT+ GL LDP +QPIY+ L+ IKT L
Sbjct: 300 FKSL-ESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTL 358

Query: 346 ENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIY 405
           ENL++TRRWTLRETDLF+YQKKL E+DS RV GKFP+++ DSKGQ+ILLYLLRRCYAIIY
Sbjct: 359 ENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIY 418

Query: 406 KXXXXXXXXXXXXXRIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGK 465
           K              +HNQLSTVR CLLELKRMGGV+NERELYPYQMKLASLDN+R DG 
Sbjct: 419 KLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGI 478

Query: 466 FYDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVREE 503
           FYD DGNIPEGQG LNALLAECFDI+HE+K+EAE R +
Sbjct: 479 FYDSDGNIPEGQGILNALLAECFDIMHELKVEAEERAQ 516

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/519 (62%), Positives = 391/519 (75%), Gaps = 22/519 (4%)

Query: 2   SSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDK 61
           S+  Q  Q +PKEEE IL+Y LE+R+ L++LKQNR Q+L SKDV  TYQ VLTKVRELD 
Sbjct: 4   SAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDD 63

Query: 62  IRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLS 121
           IRK +HE+        TLIH+ +LHNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASLS
Sbjct: 64  IRKNSHETPAKSA--ATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 121

Query: 122 TVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVE-KNSYWNIPTDGGDGNAFADDLEDK 180
           TV+SLL+HLNESNV+TH+DL PIKERLDEIS+IVE KNS      DG D      +++++
Sbjct: 122 TVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRL--REIDNE 179

Query: 181 RKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKS 240
           RK+N IEE+LLLRAKL++C   Y+ +E+KLE I   L   ME+LF+IRRGLLSL ASAK 
Sbjct: 180 RKKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVASAKK 239

Query: 241 RVXXXXXXXXXXXL----------------CILSHEKINERLKALETELADVRSHRNESG 284
            +                             ++S E ++E+L  L+ EL ++ S+R++SG
Sbjct: 240 TMSKSSANINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSG 299

Query: 285 KFVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTI 344
           KF S+ + + V   GQ VLNGLLDDCHDLI DLSHQT+ GL LDP++QPIY+ L+ IKT 
Sbjct: 300 KFKSL-ETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTT 358

Query: 345 LENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAII 404
           LENL++TRRWTLRETDLF+YQKKL E+D+ R+NGKFP++S DSKGQ+ILLYLLRRCYAII
Sbjct: 359 LENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAII 418

Query: 405 YKXXXXXXXXXXXXXRIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDG 464
           YK              IHNQLSTVR CLLELKRMGGV+NERELYPYQMKLASLDN+R DG
Sbjct: 419 YKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDG 478

Query: 465 KFYDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVREE 503
            FYD DGNIPEGQG LNALLAECFDILHE+K+EAE R +
Sbjct: 479 IFYDSDGNIPEGQGILNALLAECFDILHELKVEAEERAQ 517

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/515 (63%), Positives = 392/515 (76%), Gaps = 22/515 (4%)

Query: 2   SSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDK 61
           S+  Q  Q +PKEEE IL+Y LE+R+ L++LKQNR Q+L SKDV  TYQ VLTKVRELD 
Sbjct: 4   SAGQQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDD 63

Query: 62  IRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLS 121
           IRK +HE+        TLIHS +LHNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASLS
Sbjct: 64  IRKNSHETPAKSA--ATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 121

Query: 122 TVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVE-KNSYWNIPTDGGDGNAFADDLEDK 180
           TV+SLL+HLNESNV+TH+DL PIKERL+EIS+IVE KNS      DG D      +++++
Sbjct: 122 TVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRL--REIDNE 179

Query: 181 RKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAK- 239
           RK+N IEE+LLLRAKL++C   Y+ +E KLE I   L   ME+LF+IRRGLLSL ASAK 
Sbjct: 180 RKKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKK 239

Query: 240 ----SRVXXXXXXXXXXXLC-----------ILSHEKINERLKALETELADVRSHRNESG 284
               S +           L            ++S E ++E+L  L+ EL+++ S+R++SG
Sbjct: 240 TMSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSG 299

Query: 285 KFVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTI 344
           KF S+ + + V EKGQ VLNGLLDDCHDL+ DLSHQ + GL LDP++QPIY+ L+ IKT 
Sbjct: 300 KFKSL-ESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTT 358

Query: 345 LENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAII 404
           LENL++TRRWTLRETDLF+YQKKL E+D+ R+NGKFP++S DSKGQ+ILLYLLRRCYAII
Sbjct: 359 LENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAII 418

Query: 405 YKXXXXXXXXXXXXXRIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDG 464
           YK              IHNQLSTVR CLLELKRMGGV+NERELYPYQMKLASLDN+R +G
Sbjct: 419 YKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEG 478

Query: 465 KFYDPDGNIPEGQGTLNALLAECFDILHEMKIEAE 499
            FYD DGNIPEGQG LNALLAECFDILHE+K+EAE
Sbjct: 479 IFYDSDGNIPEGQGILNALLAECFDILHELKVEAE 513

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/567 (59%), Positives = 414/567 (73%), Gaps = 52/567 (9%)

Query: 2   SSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDK 61
           +S +Q  Q +PKEEE IL+Y L +RN L +LKQNR Q+L SK+V   YQ+VLTKVRELD+
Sbjct: 9   ASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQ 68

Query: 62  IRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLS 121
           IRK+ H++  N    TTLIHS +LHNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASLS
Sbjct: 69  IRKSNHDTPSNSA--TTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLS 126

Query: 122 TVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLED-- 179
           TVQ LL+HLNESNV+T +DL+PI+ERL EIS+IVE +SY N            D+LED  
Sbjct: 127 TVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKN--------EVSGDNLEDID 178

Query: 180 ------------KRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQI 227
                       +R +N IEE+LLLRAKL++CL  Y+  E+K+E I   L   ME+LF+I
Sbjct: 179 EKLPEADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEI 238

Query: 228 RRGLLSLAASAKSRVXXXXXXXXXXXLCILSHEKINERLKALETELADVRSHRNESGKFV 287
           RRGLLSLAAS+K                 LS E ++E+++ LE++L ++ SHR+E+GKF 
Sbjct: 239 RRGLLSLAASSK-------RSNPSLEKSPLSQEHVHEQVEKLESQLTELESHRDENGKFK 291

Query: 288 SVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILEN 347
           S+ + + V +KGQ VLNGLLDDCHDLI DLSHQ + G++LD  +QPIY+ L+ IKT LEN
Sbjct: 292 SL-ETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLEN 350

Query: 348 LLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKX 407
           LLVTRRWTLRETDLFT+QK+L+E+DSLRV+GKFP++S  SKGQ+ILLYLLRRC+AIIYK 
Sbjct: 351 LLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKL 410

Query: 408 XXXXXXXXXXXXRIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFY 467
                        IHNQLSTVR CLLELKRMGGV+N+RELYPYQMKLASLD++R DGKFY
Sbjct: 411 LESSEPVSESLQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFY 470

Query: 468 DPDGNIPEGQGTLNALLAECFDILHEMKIEAEVRE--EAAQSNEAGEKPPNNINNQTIQM 525
           D DGNIPEGQGTLNALLAECFDI+HE+KIEA+ R   E+AQ +EA +             
Sbjct: 471 DSDGNIPEGQGTLNALLAECFDIVHELKIEAQERAETESAQQSEAEQ------------- 517

Query: 526 TKDG----TNRDVAEVRPNIRYLDVYN 548
             DG    T+ D    +P  RYLDV+N
Sbjct: 518 -DDGLVNDTDNDNDGDQPVARYLDVHN 543

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/495 (64%), Positives = 381/495 (76%), Gaps = 8/495 (1%)

Query: 9   QGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKIRKTTHE 68
           Q +PKEEE IL Y L++RNYL  LK+NR Q+L S+ V  TYQEVLTKVRELD+IRK  H 
Sbjct: 16  QLVPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVLTKVRELDEIRKNNHA 75

Query: 69  SSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLD 128
           +  N    TTLIHS++LHNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLL+
Sbjct: 76  TPSNSA--TTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLE 133

Query: 129 HLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDG-GDG--NAFADDLEDKRKENN 185
           HLNESN++TH+DL PIKERLD+IS+IVE++    I  D  GD   N + D+ E ++ +N 
Sbjct: 134 HLNESNIFTHHDLGPIKERLDQISKIVEESCSQEIKLDNEGDDQFNQYLDETELEQNQNK 193

Query: 186 IEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKSRVXXX 245
           IE++LLLRAKL++CL  Y++IE+KLE I   L   +E+LFQIRRGLLSL ASAK      
Sbjct: 194 IEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLFQIRRGLLSLVASAKKNSLLS 253

Query: 246 XXXXXXXXLCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQFVLNG 305
                   L  +S E +N++L  LE E  D+ S+R+E GKF S+ +  ++PE GQ VL G
Sbjct: 254 QKELDEKHL--ISPEYLNKKLLELEKEFKDLESNRDEFGKFKSL-ETGEIPENGQNVLKG 310

Query: 306 LLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETDLFTYQ 365
           L DDC+DLI DLSHQT+  L LDP +QP+Y+ L+ IKT LE L++TRRWTLRETDLFTYQ
Sbjct: 311 LEDDCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTTLEKLMITRRWTLRETDLFTYQ 370

Query: 366 KKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXRIHNQL 425
           KKL E+D+LRV GKFPS+SSDSKGQ I+LYLLRRCYAIIYK              IHNQL
Sbjct: 371 KKLGEIDNLRVKGKFPSKSSDSKGQFIILYLLRRCYAIIYKLLECSEPVSESLQPIHNQL 430

Query: 426 STVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALLA 485
           STVR CLL++KR+GGV NERELYPYQMKLASLDN+R DG FYD DGNIPEGQGTLNALLA
Sbjct: 431 STVRRCLLDIKRLGGVSNERELYPYQMKLASLDNLRKDGIFYDSDGNIPEGQGTLNALLA 490

Query: 486 ECFDILHEMKIEAEV 500
            CFDI+HEMK+EAE 
Sbjct: 491 ACFDIVHEMKVEAEA 505

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/497 (61%), Positives = 386/497 (77%), Gaps = 8/497 (1%)

Query: 3   SANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKI 62
           S     Q +PKEEE IL+Y LE+R++LS+LK+NR Q+L SKDV+ TYQEVLT+VRELD I
Sbjct: 9   SGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGI 68

Query: 63  RKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLST 122
           RK++ + +      TTLIH  D+HNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASLST
Sbjct: 69  RKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 128

Query: 123 VQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDKRK 182
           VQ LL+HL ESNV+TH+DL+PIKERLDEIS+IVEK+    + +   D  A   +++ +R 
Sbjct: 129 VQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKS----VESRPEDEVAEFKEIDTERN 184

Query: 183 ENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKSRV 242
           +N IE++LLL+AKL++C+  YN++E+KLE IP DL   MERLF++RRGLLSLAAS+K  +
Sbjct: 185 KNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKKNI 244

Query: 243 XXXXXXXXXX---XLCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKG 299
                           +LS E ++  L+  + E+A + + R+E+G+FVS        ++G
Sbjct: 245 PDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVS-KSTGKAEQRG 303

Query: 300 QFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRET 359
           Q +LNGLLDDC+DLI DLSHQT+ GL LDP++QPIY+ L+ IKT LENL++TRRWTLRET
Sbjct: 304 QNILNGLLDDCNDLINDLSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTLRET 363

Query: 360 DLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXX 419
           DLFTYQK+L E+D++RV+GKFP++S DSKGQ+I+LYLLRRCYAIIYK             
Sbjct: 364 DLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKLLESSEPVSESLQ 423

Query: 420 RIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGT 479
            +HNQLSTVR CLLELKRMGGV+NERELYPYQMKLASLDN+R DGKFYD DGNIPEGQG 
Sbjct: 424 PVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEGQGI 483

Query: 480 LNALLAECFDILHEMKI 496
           LNALLA CFDILHE+K+
Sbjct: 484 LNALLAGCFDILHELKV 500

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/522 (59%), Positives = 383/522 (73%), Gaps = 22/522 (4%)

Query: 3   SANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKI 62
           +++Q  Q +P+EEE +L+YFLE+R  LS+LKQNR ++L SK V  TY++VLT+VRELD +
Sbjct: 11  TSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDV 70

Query: 63  RKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLST 122
           RK+ HE+  +    TTLIH+ +LHNRVDSV+DDVFQLLSLCFLTVGLKNSAPA Y+SLST
Sbjct: 71  RKSNHETPSSSA--TTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLST 128

Query: 123 VQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYW-------------NIP-TDGG 168
           VQ LL+HLNESNV+T +DL+PIKERL EI +IVEK+                N P  D  
Sbjct: 129 VQRLLEHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLKNAPDLDEA 188

Query: 169 DGNAFADDLEDKRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIR 228
           D N     L ++ + N IEE+LLLRAKL++CL  Y   EAK+E +   L   M++LFQIR
Sbjct: 189 DRN-----LSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIR 243

Query: 229 RGLLSLAASAKSRVXXXXXXXXXXXLCILSHEKINERLKALETELADVRSHRNESGKFVS 288
           R LLSLAASAK                +L+ E +N R++ L+ EL ++ S+R+E+GKF S
Sbjct: 244 RELLSLAASAKKTTSSASAEKELENKHVLAPESVNTRVELLQKELNEIESYRDETGKFKS 303

Query: 289 VNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENL 348
             +     EKGQ VLNGLL DC+DL+ DLSHQ + G++LDP +QPIY  L+ IKT LENL
Sbjct: 304 P-ESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENL 362

Query: 349 LVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKXX 408
           L+TRRWTLRETDLFTYQK+L E+DSLRVN KFP++S D+KGQ ILLYLLRRCYAIIYK  
Sbjct: 363 LITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKLL 422

Query: 409 XXXXXXXXXXXRIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYD 468
                       +HNQLSTVR CLL L+RMGG++N RELYPYQMKLASLD +RVDGKFYD
Sbjct: 423 ESSEPVSESLQPLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYD 482

Query: 469 PDGNIPEGQGTLNALLAECFDILHEMKIEAEVREEAAQSNEA 510
            DGNIPEGQ TLNALLAECFDI+HEMKIEAE + E+   +EA
Sbjct: 483 LDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESETQSEA 524

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/505 (63%), Positives = 379/505 (75%), Gaps = 14/505 (2%)

Query: 46  VMTYQEVLTKVRELDKIRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFL 105
           + TYQ VLTKVR LD++RK  H +    G   TLIHS  LHNRVDSV+DDVFQLLSL FL
Sbjct: 1   MATYQAVLTKVRLLDQVRKQRHGAEDTTGG-FTLIHSAALHNRVDSVLDDVFQLLSLSFL 59

Query: 106 TVGLKNSAPATYASLSTVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPT 165
           TVGLKN+APATYASLSTVQ LL+H+ E+NVYT++DL+PIKERLDEI EIVEKNSY ++  
Sbjct: 60  TVGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVE 119

Query: 166 DGGDGNAFADDLEDKRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLF 225
           D     A  D+L ++++ N +EE+LL+RAKL++C+  Y ++++K   IP +LQP  ++LF
Sbjct: 120 D----EAPLDELAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLF 175

Query: 226 QIRRGLLSLAASAKSRVXXXXXXXXXXXLCILSHEKINERLKALETELADVRSHRNESGK 285
            IRR LLSLAASAK+                 S   +  RLK LE+ + +V SHR++SGK
Sbjct: 176 HIRRELLSLAASAKTD-RAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGK 234

Query: 286 FVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTIL 345
           F+S +DP+ VP+KGQ  LNGLLDDC +L  DLSHQTS  L LDP +QPIY++L+ IKT L
Sbjct: 235 FISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTL 294

Query: 346 ENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIY 405
           ENLLVTRRWTLRETDLF YQK+LAELD+LRVN K PS SS SKGQA++LYLLRRCYA IY
Sbjct: 295 ENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQALILYLLRRCYATIY 354

Query: 406 KXXXXXXXXXXXXXRIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGK 465
           K             +IHNQLSTVR CL ELKRMGGVD+ER+LYPYQMKLASLDNMRVDGK
Sbjct: 355 KLLESSEPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGK 414

Query: 466 FYDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVREEA-AQSNE--AGEKPPNNINNQT 522
           FYD DGNIPEGQGTLNALLAECFDILHEMKIEAEVREE   Q NE  AGE      ++  
Sbjct: 415 FYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVNEDDAGEYN----SSPC 470

Query: 523 IQMTKDGTNRDV-AEVRPNIRYLDV 546
           I+MTKD T+RDV A+     RYL V
Sbjct: 471 IEMTKDPTDRDVAADTSSTSRYLSV 495

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/525 (58%), Positives = 380/525 (72%), Gaps = 32/525 (6%)

Query: 1   MSSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELD 60
             ++ Q  Q +PKEEE IL+YFL++R  LS+LK+NR Q+L S +V  TYQEVLTKVRELD
Sbjct: 5   FQTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELD 64

Query: 61  KIRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASL 120
            IRK  H++     P  TLIH+ DLHNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 65  AIRKKNHDAVATNVP--TLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 122

Query: 121 STVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKN-SYWNIPTDG--GDGNAFADDL 177
           STV+SLL HL E+ +YTH+DLKPIK+RL+EIS+IVE++ +  N   D    D      D+
Sbjct: 123 STVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDI 182

Query: 178 EDKRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAAS 237
           + +R  N +E+NLLL+AKL++C+  YN++E+KLE I   L   ME+LFQIRRGLLSL AS
Sbjct: 183 DAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVAS 242

Query: 238 AK--------------SRVXXXXXXX--------XXXXLCILSHEKINERLKALETELAD 275
           ++              SR                       +SH+ + E+ + L  +L +
Sbjct: 243 SRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKN 302

Query: 276 VRSHRNESGKFVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAG----LDLDPHI 331
           + +HR+E GKF S+ + + V E GQ VLNGLLDDC+DL+ DLSHQ   G    L +DP +
Sbjct: 303 LEAHRDEDGKFKSL-ETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSL 361

Query: 332 QPIYDDLVSIKTILENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQA 391
           QP+Y+ L+ IKT LENL++TRRWTLRETDLF+YQKKL E+D+LRVNG+FP+E++DS+GQ+
Sbjct: 362 QPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQS 421

Query: 392 ILLYLLRRCYAIIYKXXXXXXXXXXXXXRIHNQLSTVRHCLLELKRMGGVDNERELYPYQ 451
           ILLYLLRRCYAIIYK              IHNQLSTVR CLLELKRMGGV+NERELYPYQ
Sbjct: 422 ILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQ 481

Query: 452 MKLASLDNMRVDGKFYDPDGNIPEGQGTLNALLAECFDILHEMKI 496
           MKLASLDN+R DG FYD DGNIPEGQG LNALLA CFDI+HE+K+
Sbjct: 482 MKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/496 (58%), Positives = 362/496 (72%), Gaps = 23/496 (4%)

Query: 5   NQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKIRK 64
           N+  Q +PKEEE  L Y L++R  LS LKQNR+QFL SKD+  TYQ VLTKVRELD+IR+
Sbjct: 6   NRDLQAVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDEIRR 65

Query: 65  TTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ 124
             H +S     +T  +HS +LHNRVD+V+DDVFQLLSLCF+T GLKNSAPATYASLSTVQ
Sbjct: 66  QKHGNSQETEIKT-FVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLSTVQ 124

Query: 125 SLLDHLNESNVYTHNDLKPIKERLDEISEIV----EKNSYWNIPTDGGDGNAFADDLEDK 180
           SLL+HL ES +YTH+DLKPIKERLDEI++IV    E N+Y +  T   D N  +  ++++
Sbjct: 125 SLLEHLIESKIYTHHDLKPIKERLDEIAKIVDQNCESNTYQDASTLDDDDNEVSR-IDNE 183

Query: 181 RKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKS 240
           R +N IE+NLLL+AKL +CL  YN IE++LE +       +E+LFQIRR L+SL   +KS
Sbjct: 184 RNKNKIEQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLVEISKS 243

Query: 241 RVXXXXXXXXXXXLCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQ 300
                              ++I+++LK L+ +L ++ ++R+  G FVS+   N +  KG 
Sbjct: 244 NTGV--------------QDQIDKKLKHLQLQLNEIENNRDPDGNFVSIESGNPII-KGS 288

Query: 301 FVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETD 360
            VLNGL DDCHDLI DL+H T   LD  P +Q +YD+L+ +K  LENL+VTRRWTLRETD
Sbjct: 289 NVLNGLSDDCHDLISDLTHHTKTFLD--PDLQNVYDNLIDVKGSLENLMVTRRWTLRETD 346

Query: 361 LFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXR 420
           LF+Y KKL E+D+LRV+GKFP++S  +KGQAILLYLLRRCY +IYK              
Sbjct: 347 LFSYLKKLNEIDNLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYKLLESSEPVSEALQP 406

Query: 421 IHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTL 480
           IHNQLSTVR CLL+LKRMGGV+NERELYPYQMKLASLDN+R DGKFYD  GNIPEGQG L
Sbjct: 407 IHNQLSTVRRCLLDLKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSKGNIPEGQGIL 466

Query: 481 NALLAECFDILHEMKI 496
           NALLA CFDILHE+KI
Sbjct: 467 NALLAGCFDILHELKI 482

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 444 ERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVREE 503
           E +L+ Y  KL  +DN+RVDGKF    G+  +GQ  L  LL  C+ +++++   +E   E
Sbjct: 344 ETDLFSYLKKLNEIDNLRVDGKFPTKSGST-KGQAILLYLLRRCYTLIYKLLESSEPVSE 402

Query: 504 AAQ 506
           A Q
Sbjct: 403 ALQ 405

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/545 (53%), Positives = 385/545 (70%), Gaps = 23/545 (4%)

Query: 1   MSSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELD 60
           ++S N   Q +P EEEDIL++ LE+R  L++LKQNR QFL +K V +TYQ VLTKVRELD
Sbjct: 8   LASRNNHPQIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELD 67

Query: 61  KIRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASL 120
           +IRK +  +       TTLIH   LHNRVDSV+DDVFQLLSLCFLTVG+KNSAPATY+SL
Sbjct: 68  EIRKNSLTTPAKTA--TTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSL 125

Query: 121 STVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFAD----- 175
           STVQ LL+HLNES ++T +DL+PIKERLDEI EIVEK+SY N   D  + +A        
Sbjct: 126 STVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRN---DEFNDSALVGLSKQE 182

Query: 176 ----DLEDKRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGL 231
               ++E++R  N IEE+LL+RAKL++C++ +NQ+E++LE I  +L   +++L+ IRRGL
Sbjct: 183 HELIEIENERTRNRIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGL 242

Query: 232 LSLAASAK---SRVXXXXXXXXXXXLCILSHEKINERLKALETELADVRSHRNESGKFVS 288
           LSLA+      S+            +   SH+++   L  ++ +L ++ S R+E+G + S
Sbjct: 243 LSLASPTNDTLSKSDNNHIASTNHNVSDKSHKEL--VLLKMKKQLVEIESQRDENGYYKS 300

Query: 289 VNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENL 348
           + + N V  +GQ ++N L+DDC+DLI DLSH  +  +  DP++Q IY +L+ IKT L NL
Sbjct: 301 L-ETNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANL 359

Query: 349 LVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKXX 408
           +VTRRWTLRETDLF+YQKKLAE+DSLRVNGKF S +SD+KGQ+I+LYLLRRCYAIIYK  
Sbjct: 360 MVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKLL 419

Query: 409 XXXXXXXXXXXRIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYD 468
                       IH QLSTVR CL+ LKR+GGV + +ELYPYQMKLASLD +R+DGKFYD
Sbjct: 420 ESSEPISESLQSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYD 479

Query: 469 PDGNIPEGQGTLNALLAECFDILHEMKIEAEV---REEAAQSNEAGEKPPNNINNQTIQM 525
            +G+IPEGQG LNA+LAECFD++HE+K +AE     E A   N   E    N+ +  I  
Sbjct: 480 ANGDIPEGQGILNAMLAECFDMVHELKCDAEAYSSSENATPINTDKEDSSLNLKSLNIND 539

Query: 526 TKDGT 530
             DG+
Sbjct: 540 KLDGS 544

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/487 (58%), Positives = 367/487 (75%), Gaps = 12/487 (2%)

Query: 10  GIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKIRKTTHES 69
           G+PKEEE IL Y L++R  L++LK NR+QFL SK+V   +QEVLTKVRELD IRK   ++
Sbjct: 19  GVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRK--RQA 76

Query: 70  SPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLDH 129
             +     T+IH+  LHN+VDS++DDVFQLLSLCFLTVGLKNSAPATY+SLSTVQ LL+H
Sbjct: 77  GEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEH 136

Query: 130 LNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDKRKENNIEEN 189
           L+ESN++T++DL+PIK+RLDEIS IVE NSY N   D  +    AD+ E+KR +N IEE+
Sbjct: 137 LDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNP---ADETEEKRNKNKIEED 193

Query: 190 LLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKSRVXXXXXXX 249
           LLLRAKL++CL  YN+I +KLE I  +L   ME+L+ IRR LLSLA+ ++ ++       
Sbjct: 194 LLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLLSLASPSR-KIDTREDFS 252

Query: 250 XXXXLCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQFVLNGLLDD 309
                   S ++  E L +LE EL ++ SHR+E+G F S+ +  +V  KGQ VL GL+D+
Sbjct: 253 QFN-----SSKESQEALSSLEQELEELESHRDENGNFKSL-ETGEVVLKGQNVLAGLVDN 306

Query: 310 CHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETDLFTYQKKLA 369
           CHDLI D ++  +    +DP ++PIYD+L++IKT L NL++TRRWTLR+TDLF YQKKL 
Sbjct: 307 CHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQYQKKLQ 366

Query: 370 ELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXRIHNQLSTVR 429
            +D+ RVNGKFP++S D+KGQAILLYLLRRCYAIIYK              IHNQLST R
Sbjct: 367 AIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVPVSESLQSIHNQLSTAR 426

Query: 430 HCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALLAECFD 489
            CLL LKRMGGV++ERELYPYQ+KLASLD +R+DGKF+D +G IPEGQGTLNALLAECFD
Sbjct: 427 RCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNALLAECFD 486

Query: 490 ILHEMKI 496
           I+HE++I
Sbjct: 487 IMHELEI 493

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/495 (56%), Positives = 362/495 (73%), Gaps = 14/495 (2%)

Query: 10  GIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKIRKTT--- 66
           G+P+ E DIL Y +++R  L++LK NR+++L SK+V + +QEVLTKVRELD IRK+    
Sbjct: 16  GVPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKVRELDDIRKSKLKD 75

Query: 67  -HESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLSTVQS 125
             +        TTL+ ++ LHN+VDS++DDVFQLLSLCFLTVGLKNSAPATY SLSTVQ 
Sbjct: 76  DGQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNSAPATYTSLSTVQK 135

Query: 126 LLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDKRKENN 185
           LL+HL+ESN++T++DL+PIKERLDEIS+IV+ NSY N   +  + N    D +D+ K+N 
Sbjct: 136 LLEHLDESNIFTNHDLRPIKERLDEISKIVQNNSYKNYEFNEDEINPNQVD-DDEIKQNL 194

Query: 186 IEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKSRVXXX 245
           IEE+LLLRAKL++C   + +I +KLE I  +L   ME+L+ IRR LLSLA+         
Sbjct: 195 IEEDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRRNLLSLASPTHK----- 249

Query: 246 XXXXXXXXLCILSH-EKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQFVLN 304
                   + I ++ E+  + LK L  EL ++ +HR+E G F S+ + N+V  KGQ  L 
Sbjct: 250 --IDTTENISIFNNNEESRKMLKHLSDELTELETHRDEDGNFKSL-ETNEVKLKGQNALA 306

Query: 305 GLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETDLFTY 364
           GL+D+CHDLI D ++ +     LD ++QPIY++L++IKT L NL++TRRWTLRETDLF Y
Sbjct: 307 GLVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMITRRWTLRETDLFQY 366

Query: 365 QKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXRIHNQ 424
           QK+L E+D  RVNGKFPSES ++KGQ+ILLYLLRRCYAIIYK              IHNQ
Sbjct: 367 QKRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESSEPVSESLQPIHNQ 426

Query: 425 LSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALL 484
           LST R CLL LKRMGGV++ RELYPYQ+KLASLD +R+DGKFYD  G IPEGQGTLNALL
Sbjct: 427 LSTTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSGEIPEGQGTLNALL 486

Query: 485 AECFDILHEMKIEAE 499
           AECFD+LHE++IE+E
Sbjct: 487 AECFDMLHELEIESE 501

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  156 bits (394), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 120/417 (28%), Positives = 210/417 (50%), Gaps = 35/417 (8%)

Query: 115 ATYASLSTVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKN---------------- 158
           + Y+S+  ++ LL+ LN+SN++T  DL P+K RLDEI +I+E +                
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECEENDNEDNE 132

Query: 159 -------SYWNIPTDGGDGNAF-----ADDLEDKRKENNIEENL--LLRAKLEYCLKGYN 204
                  +   +   GG+         + D E+ + +   + NL   +  +L+ C K +N
Sbjct: 133 DNEDNDENIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQELDDCYKVHN 192

Query: 205 QIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKSRVXXXXXXXXXXXLCILSHEKINE 264
            IE K + I  +L   ++++  +R+ LL +  S    V              +S+   ++
Sbjct: 193 VIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFSRVKSVFPQCFVLKDPNH--MSNSTFDK 250

Query: 265 RLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAG 324
           +L  ++  L  ++    E  +  S  + N+    GQ +LNGL+D C ++I D+       
Sbjct: 251 KLNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVIHDVKLLAIDK 310

Query: 325 LDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSES 384
           +D D     +++  + +K  LE +LVT R +L+  DLF   K+L++L+  R    +  E 
Sbjct: 311 ID-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEK-RTIRHYNIED 368

Query: 385 SDSKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXRIHNQLSTVRHCLLELKRMGGVDNE 444
           S  + ++I+++ LRRC+ IIYK              ++NQLST+   LL+LK  GGV+  
Sbjct: 369 S-FQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKIAGGVEKM 427

Query: 445 RELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVR 501
            +L P ++KL ++ + R++  F D  GNIP GQ  LNALL EC ++L  ++I+ E R
Sbjct: 428 DDLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEIDFEGR 484

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 100 LSLCFLTVGLKNS------APATYASLSTVQSLLDHLNESNVYTHND 140
           +S+C +T+ + N       AP TY  L ++  L++HL  S  + H D
Sbjct: 8   VSICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKD 54

>KLTH0G17358g Chr7 (1503299..1506835) [3537 bp, 1178 aa] {ON}
            conserved hypothetical protein
          Length = 1178

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 9/60 (15%)

Query: 98   QLLSLCFLTVGLKNSAPATYASLSTVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEK 157
            QLLS  F       +AP   A  +TV+SL DH N S  ++  DL P+  +++ IS I E+
Sbjct: 968  QLLSKAF-------NAPEALAKAATVRSLFDH-NGSMPFSKKDL-PLVSKIESISAIPEE 1018

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,834,019
Number of extensions: 2893898
Number of successful extensions: 9543
Number of sequences better than 10.0: 82
Number of HSP's gapped: 9708
Number of HSP's successfully gapped: 91
Length of query: 579
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 464
Effective length of database: 40,294,809
Effective search space: 18696791376
Effective search space used: 18696791376
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)