Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_83507.127ON44544522840.0
ADL017C7.127ON44344520650.0
SAKL0F05346g7.127ON44744619530.0
KLTH0F12584g7.127ON44144418970.0
Kwal_55.208437.127ON44144418730.0
KLLA0D14311g7.127ON44344518340.0
TDEL0H028907.127ON44244518200.0
TBLA0A009507.127ON46946718060.0
YPL259C (APM1)7.127ON47547417940.0
Suva_16.457.127ON47847717850.0
ZYRO0C05236g7.127ON44744517770.0
NCAS0E021407.127ON48144917740.0
Smik_6.4667.127ON47647517710.0
Skud_16.197.127ON47647517670.0
Kpol_1062.567.127ON45045017630.0
KNAG0L009507.127ON46146017500.0
TPHA0C043207.127ON45445217410.0
NDAI0E036807.127ON44444617380.0
KAFR0L004707.127ON46546817140.0
CAGL0K00539g7.127ON45645516780.0
Ecym_52393.165ON4644665841e-69
KLTH0F06534g3.165ON4664675413e-63
SAKL0C07414g3.165ON4824835406e-63
KLLA0C03894g3.165ON4754835283e-61
SAKL0D13090g2.555ON4995175261e-60
Kwal_33.141823.165ON4674685195e-60
Kwal_26.81462.555ON5055324912e-55
ADR315W3.165ON4923664883e-55
CAGL0C05203g3.165ON4754884848e-55
Kpol_1045.443.165ON4694704821e-54
TDEL0D045803.165ON4824944822e-54
ZYRO0B04840g3.165ON4764824803e-54
NDAI0G029203.165ON4864924796e-54
YOL062C (APM4)3.165ON4914964771e-53
ABR047W2.555ON4984704781e-53
NCAS0C035803.165ON4915034761e-53
Suva_15.1033.165ON4914994701e-52
TBLA0F008403.165ON4814844663e-52
Smik_15.963.165ON4914964674e-52
KLTH0D07502g2.555ON5045354657e-52
Skud_15.913.165ON4914964517e-50
KLLA0F25432g2.555ON5074864361e-47
TDEL0B064302.555ON5255494301e-46
Ecym_45912.555ON5015304221e-45
TPHA0P006603.165ON4734164156e-45
KNAG0K011503.165ON4744833666e-38
TPHA0I023902.555ON5595833652e-37
Kpol_1056.132.555ON5415643467e-35
ZYRO0E05874g2.555ON5493383405e-34
KAFR0C010203.165ON4284573331e-33
CAGL0K03223g2.555ON5983673353e-33
KAFR0A020602.555ON5403373273e-32
NCAS0A126502.555ON5883573115e-30
Skud_8.262.555ON5963663001e-28
Smik_8.232.555ON6033662912e-27
KNAG0C055502.555ON5823522903e-27
Suva_8.332.555ON5963732771e-25
TBLA0B067602.555ON6572812488e-22
NDAI0B016102.555ON6722592151e-17
YHL019C (APM2)2.555ON6052501901e-14
SAKL0A09218g2.522ON4732691845e-14
AGL061W2.522ON4112281623e-11
KLTH0D06556g2.522ON4562541542e-10
KAFR0D035602.522ON4553831508e-10
TPHA0C041302.522ON5331461472e-09
TDEL0A029702.522ON4961471444e-09
KLLA0E18789g2.522ON4971701437e-09
Kwal_26.79572.522ON4561311392e-08
ZYRO0B01738g2.522ON4922401392e-08
TBLA0I006202.522ON6091491293e-07
Kpol_1018.422.522ON5751901152e-05
NCAS0A048702.522ON4894831142e-05
Suva_4.5482.522ON4841601106e-05
Skud_2.4192.522ON4842441081e-04
YBR288C (APM3)2.522ON4832521081e-04
Smik_2.4302.522ON4841301018e-04
CAGL0L02145g2.522ON543138960.003
Ecym_72662.522ON517242950.005
KLLA0D11396g3.575ON536135940.007
NDAI0K019302.522ON612154850.086
ZYRO0E09746g3.575ON538134830.12
TBLA0E001403.575ON543135830.15
TDEL0D064303.575ON53685820.16
Ecym_60073.575ON537140800.31
KNAG0A069702.522ON505143770.62
Smik_4.7485.595ON500148751.1
Smik_7.3713.575ON598115751.3
KNAG0D030003.575ON563134751.3
Kpol_507.73.575ON53374732.1
KLTH0H11770g1.388ON156136702.3
Skud_6.1423.575ON546115697.0
TDEL0B061901.388ON156112667.9
KLLA0E06579g7.435ON800102688.0
YFR051C (RET2)3.575ON546115689.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_8350
         (445 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   884   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   800   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   756   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   735   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   726   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   711   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   705   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   700   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   695   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   692   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   689   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   687   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   686   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   685   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   683   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   678   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   675   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   674   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   664   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   650   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   229   1e-69
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   213   3e-63
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   212   6e-63
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   207   3e-61
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   207   1e-60
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   204   5e-60
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   193   2e-55
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   192   3e-55
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   191   8e-55
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   190   1e-54
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   190   2e-54
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   189   3e-54
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   189   6e-54
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   188   1e-53
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   188   1e-53
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   187   1e-53
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   185   1e-52
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   184   3e-52
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   184   4e-52
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   183   7e-52
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   178   7e-50
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   172   1e-47
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   170   1e-46
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   167   1e-45
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   164   6e-45
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   145   6e-38
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   145   2e-37
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   137   7e-35
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   135   5e-34
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   132   1e-33
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   133   3e-33
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   130   3e-32
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   124   5e-30
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   120   1e-28
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   116   2e-27
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   116   3e-27
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   111   1e-25
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...   100   8e-22
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    87   1e-17
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...    78   1e-14
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    75   5e-14
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    67   3e-11
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    64   2e-10
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    62   8e-10
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    61   2e-09
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    60   4e-09
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    60   7e-09
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    58   2e-08
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    58   2e-08
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    54   3e-07
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    49   2e-05
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    49   2e-05
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    47   6e-05
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    46   1e-04
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    46   1e-04
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    44   8e-04
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    42   0.003
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    41   0.005
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    41   0.007
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    37   0.086
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    37   0.12 
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    37   0.15 
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    36   0.16 
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    35   0.31 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    34   0.62 
Smik_4.748 Chr4 complement(1321088..1322590) [1503 bp, 500 aa] {...    33   1.1  
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    33   1.3  
KNAG0D03000 Chr4 complement(537905..539596) [1692 bp, 563 aa] {O...    33   1.3  
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    33   2.1  
KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highl...    32   2.3  
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    31   7.0  
TDEL0B06190 Chr2 complement(1094337..1094807) [471 bp, 156 aa] {...    30   7.9  
KLLA0E06579g Chr5 (594361..596763) [2403 bp, 800 aa] {ON} simila...    31   8.0  
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    31   9.2  

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/445 (96%), Positives = 430/445 (96%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
           SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFT            
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEEEDEPSS 240

Query: 241 XXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300
              ITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD
Sbjct: 241 QPSITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300

Query: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360
           AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA
Sbjct: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360

Query: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE 420
           ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE
Sbjct: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE 420

Query: 421 PKLQYNSYPWVRYITQSGEDYIIRM 445
           PKLQYNSYPWVRYITQSGEDYIIRM
Sbjct: 421 PKLQYNSYPWVRYITQSGEDYIIRM 445

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/445 (85%), Positives = 412/445 (92%), Gaps = 2/445 (0%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+SGIYFCD+KGKLLLSRRYKDDIP +AIEQFP+LLIEKEQES+V+PPCFS NGVQYLFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHNDLY+LTLT+SM  NVAQVFS+LH L++VL+EYMKVVEEESIKDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPP++LT +VSWRPEGI YKKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           DV+ESINM++TQQGQVLRSEILGKVKV+SRLSGMPDLKLGLNDKGIF             
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDEEGAS 240

Query: 241 XXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300
               T+KKSNIELEDLKFHQCVRL+KFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD
Sbjct: 241 GG--TKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 298

Query: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360
            K+QVHSRSR+E+HCRAKAQIK KSTANNVEILIPVP DADSPKFRYSHG+IKWVP +NA
Sbjct: 299 VKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNA 358

Query: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE 420
           ILWKIKSFPGGKDYSMAAEMGLPSV+D +D+  KRPVQIKFQIPYFTTSGIQVRYLKINE
Sbjct: 359 ILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINE 418

Query: 421 PKLQYNSYPWVRYITQSGEDYIIRM 445
           PK+QYNSYPWVRYITQSG+DY IRM
Sbjct: 419 PKMQYNSYPWVRYITQSGDDYTIRM 443

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/446 (79%), Positives = 403/446 (90%), Gaps = 1/446 (0%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S IYFCD+KGK +LSRRYKDDIP +AI++FP LL+E+EQES+VIPPC +HNG+QYLF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHNDLY+LT+TRS+  NVAQ+F+FL+ +V+VL EY+KVVEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKL++SAKK KNV+RPP +LT +VSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           DV+ESINM++TQQGQVLRSEILGKVKV+S LSGMPDLKLGLNDKGIF+            
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240

Query: 241 XXXIT-RKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWC 299
               T +KK+NIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRL+TPIKPLIWC
Sbjct: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300

Query: 300 DAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKN 359
           D KIQVHS+SR+EVHCRAKAQIK KSTANNVEILIPVP DADSPKFRYSHGSIKW PEKN
Sbjct: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360

Query: 360 AILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKIN 419
           AILWKIKSFPGGK+YSMAA++GLPSV+D  +   KRPVQ+KFQIPYFTTSGIQVRYLKIN
Sbjct: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420

Query: 420 EPKLQYNSYPWVRYITQSGEDYIIRM 445
           EPK+QY SYPWVRYITQSG+DY IRM
Sbjct: 421 EPKMQYQSYPWVRYITQSGDDYTIRM 446

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/444 (78%), Positives = 393/444 (88%), Gaps = 5/444 (1%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S IYFCD KGK++LSRRY+DD+P SAIE+FP LL+E EQES+++PPC +HNGVQYLFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHND+Y+LT++RS+  NVAQVFSFL+ LV+VL EY+K VEEESI+DNFVIIYELLDE++D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKS+KLI+SAKK KNV+RPPS LT +VSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           DV ESINM++T  GQVLRSEILGKV VRSRLSGMPDLKLGLNDKGIFT            
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVESASSSEATE 240

Query: 241 XXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300
                 KKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELM+YRLSTPIKPLIWCD
Sbjct: 241 G-----KKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLSTPIKPLIWCD 295

Query: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360
           AKIQVHS+SR+E+HCRAKAQIK KSTANNVEILIPVP DADSPKFRYSHGS+K+VPEK+A
Sbjct: 296 AKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSA 355

Query: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE 420
           ILWKIK+F GGK+YS AA++GLPS+ D      KRP+Q+KFQIPYFTTSGIQVRYLKINE
Sbjct: 356 ILWKIKTFNGGKEYSFAAQLGLPSMTDAEVPRAKRPIQVKFQIPYFTTSGIQVRYLKINE 415

Query: 421 PKLQYNSYPWVRYITQSGEDYIIR 444
           PKLQY SYPWVRYITQSG+DY IR
Sbjct: 416 PKLQYQSYPWVRYITQSGDDYTIR 439

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/444 (76%), Positives = 394/444 (88%), Gaps = 5/444 (1%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S IYFCD  GK++LSRRY+DD+P SAIE+FP LL+E EQES+V+PPC +HNG+QY+FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHND+Y+LT++RS+  NVAQVFSFL+ LV+VL EY+K VEEESI+DNFVIIYELLDE++D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKS+KLI+S KK KNVVRPP+ LT +VSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           DV ESINM++T  GQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFT            
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTSEEGGNNAEGG- 239

Query: 241 XXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300
               + KKSNIELEDL+FHQCVRLSKFENEKII+FIPPDGDF+LM+YRLSTPIKPLIWCD
Sbjct: 240 ----SGKKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCD 295

Query: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360
           AKIQVHS+SR+E+HCRAKAQIK KSTANNVEILIPVP DADSPKFRYSHGS+K+VPEK+A
Sbjct: 296 AKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSA 355

Query: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE 420
           ILW+IK+F GGK+YS AA++GLPS+ D+     KRP+Q+KFQIPYFTTSGIQVRYLK++E
Sbjct: 356 ILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHE 415

Query: 421 PKLQYNSYPWVRYITQSGEDYIIR 444
           PKLQY SYPWVRYITQSG+DY IR
Sbjct: 416 PKLQYQSYPWVRYITQSGDDYTIR 439

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/445 (74%), Positives = 386/445 (86%), Gaps = 2/445 (0%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S + FCD+KGK LLSRRY+DD+  SA+E F +LL+E+EQES+V+PPCF HNG+ Y+++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           Q+ND+Y+L LTRS+  N   +F+F++ L++V++EY+K VEEESI+DN++IIYELLDE+MD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            G+PQ+T+TKML+QYITQKSFKL RSAKK+KNV RPP+ LT +VSWRPEGIKYKKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           DVIESINM+MTQQGQVLRSEILG VKVRSRLSGMPDLKLGLNDKGIFT            
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240

Query: 241 XXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300
                +K SNIELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM+YRLSTPIKPLIWCD
Sbjct: 241 SSK--KKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCD 298

Query: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360
            K+QVHS SR+E+HCRAKAQIK KS ANNVEILIP+P DADSP F+YS G+IKWVPEKNA
Sbjct: 299 VKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNA 358

Query: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE 420
           ILWK  SF GGK+YSMAA++GLPSV+D      KRPVQIKFQIPYFTTSGIQVRYLKI E
Sbjct: 359 ILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEE 418

Query: 421 PKLQYNSYPWVRYITQSGEDYIIRM 445
           PKLQYNSYPWVRYITQSG+DY IR+
Sbjct: 419 PKLQYNSYPWVRYITQSGDDYTIRL 443

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/445 (73%), Positives = 383/445 (86%), Gaps = 4/445 (0%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M SGIYFCD KG+ +LSRRY+DDIP+SAI++F  LL + E+ES+VIPPC +H G+QYLFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           +H DLY++ L+ S+  N AQVF+FLH LV+ L +Y+K VEEES++DNFVIIYELLDE+MD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKLI++ KK K   RPP+ LT +VSWR +GI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           D++ESINM+M QQGQVLRSEI+G+V VRSRLSGMPDLKLG+NDKGIFT            
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTRDPETGESQVTA 240

Query: 241 XXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300
                +KKS+ ELEDLKFHQCVRLSKFENEKIITFIPPDG+FELMSYRL+TP+KPLIWCD
Sbjct: 241 ----GKKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTTPVKPLIWCD 296

Query: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360
             +QVHS+SR+E+HCRAKAQIK KS ANNVEILIPVP+DAD+P FRYSHGSIKWVPEKNA
Sbjct: 297 VNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNA 356

Query: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE 420
           ILWKI+SF GGK+YSMAA+MGLPS+N +    FKRPVQ+KFQIPYFTTSGIQVRYLKINE
Sbjct: 357 ILWKIRSFYGGKEYSMAAQMGLPSINGVEKPKFKRPVQVKFQIPYFTTSGIQVRYLKINE 416

Query: 421 PKLQYNSYPWVRYITQSGEDYIIRM 445
           PKLQY SYPWVRYITQ+G+DY IR+
Sbjct: 417 PKLQYKSYPWVRYITQNGDDYTIRL 441

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/467 (71%), Positives = 390/467 (83%), Gaps = 22/467 (4%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M S I FCD+KGK LLSR+Y+DDIP++AI+ F  LL++ E+ES+V+PPC +HNG+ YLFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHNDLYI+ LT S+  N +QVF+FLH LV+V+ EY+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKL+++AKKK+N  RPP +LT +VSWRPEGIKYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           D++ESINM+MTQQGQVLRSEI+G+VKVRSRLSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 241 XXXI----------------------TRKKSNIELEDLKFHQCVRLSKFENEKIITFIPP 278
                                     +RK SN+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 279 DGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPN 338
           DG+FELMSYRL+TPIKPLIWCD  I VHS+SRVE+HCRAKAQIK KS ANNVEILIPVP+
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 339 DADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQ 398
           DAD+P FRYSHGSIKWVPEKNAILWKI+SF GGK+YSMAA++GLPS++D      KRPVQ
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420

Query: 399 IKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445
           IKFQIPYFTTSGIQVRYLK+NEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/474 (68%), Positives = 387/474 (81%), Gaps = 29/474 (6%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S +YFCD  GK LLSRRY+DDIP+SAI++FP LL + E++SN+IPPC +HNG++YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHNDLY++ +  S+ AN A +F+FLH LV+VL +Y+K VEEESI+DNFVIIYELLDEVMD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKL++SAKKK+N  RPP +LT +VSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTX----------- 229
           D++ESINM+MTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240

Query: 230 --------XXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGD 281
                                   +KK NIELEDLKFHQCVRLSKFENEKIITFIPPDG 
Sbjct: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300

Query: 282 FELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDAD 341
           F+LM+YRLST IKPLIWCD  +QVHS SR+E+HC+AKAQIK KSTA NVEILIPVP+DAD
Sbjct: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360

Query: 342 SPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYN--------- 392
           +P F+YSHGS+K+VPEK+AILWKI+SFPGGK+YSM+AE+GLPS+++  D N         
Sbjct: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420

Query: 393 -FKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445
             K PVQIKFQIPYFTTSGIQVRYLKINEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/477 (67%), Positives = 388/477 (81%), Gaps = 32/477 (6%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S +YFCD  GK LLSRRY+DDIP+SAI++FP LL + E++SN+IPPC +HNG++YLFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHNDLY++ +  S+ AN A +F+FLH LV+VL +Y+K VEEESI+DNFVIIYELLDEVMD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKL++SAKKK+N  RPP +LT +VSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIF------------- 227
           D++ESINM+MTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF             
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 228 ---------TXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPP 278
                    T                +++K NIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 279 DGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPN 338
           DG F+LM+YRLST IKPLIWCD  +QVHS SR+E+HC+AKAQIK KSTA NVEILIPVP+
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 339 DADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYN------ 392
           DAD+P F+YSHGS+K+VPEK+AILWK++SFPGGK+YSM+AE+GLPS+++  D +      
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 393 ----FKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445
                K PVQIKFQIPYFTTSGIQVRYLKINEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/445 (70%), Positives = 382/445 (85%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M S +YFCD KG+ +LSRRY+DDIPISAI++F  LL++ E+ES+VIPPC SH+G+QYLFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHNDLY++ L  S+  NVAQVF+FLH L++VL+EY+K VEEES++DNF+IIYELLDE+MD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKL+++ KK K   RPP+ +T +VSWR   I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           D++ESINM+M QQGQVLRSEI+G++KV+S+LSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT 240

Query: 241 XXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300
                +KK+NIELEDLKFHQCVRLSKFENEKIITFIPPDG FELM+YRLS P+KPLIWCD
Sbjct: 241 AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD 300

Query: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360
             +QVHS+SR+E+HCRA+AQIK +S AN+VEILIPVP+DAD+P F+Y+HGS+KWVP+KNA
Sbjct: 301 VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360

Query: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE 420
           ILWKI+SF GGK+YSM+A+MGLPS+N +     KRPVQIKFQIPYFTTSGIQVRYLKI E
Sbjct: 361 ILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITE 420

Query: 421 PKLQYNSYPWVRYITQSGEDYIIRM 445
           PKL Y SYPWVRYITQSG+DY I++
Sbjct: 421 PKLLYKSYPWVRYITQSGDDYTIKL 445

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/449 (72%), Positives = 388/449 (86%), Gaps = 4/449 (0%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S +YFCD+KG  LL+RRY+DDIPISAIE+FP LL + E+E+N++PPC S+NG+QYLFI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHND+Y++ +  SM AN AQ+F+FL+ LVDVL  Y+K VEEESI+DNFVIIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKL+++AKKK+N  RPP +LT +VSWR   IKYKKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXX----XXXXXX 236
           D+IESINM+MTQ+GQ+LRSEI+G+VKV+SRLSGMPDLKLG+NDKGIF+            
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271

Query: 237 XXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPL 296
                    +KK+NIELEDLKFHQCVRLSKFE EKIITFIPPDGDFELM+YRLST IKPL
Sbjct: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331

Query: 297 IWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVP 356
           IWCD  IQVHS+SR+E+HCRAKAQIK KSTA NV+I+IPVP DAD+P+F+YSHGSIK+VP
Sbjct: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391

Query: 357 EKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYL 416
           EKN I+WKI+SFPGGK+YSM+A+M LPS+ +I ++  KRPVQIKFQIPYFTTSGIQV+YL
Sbjct: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451

Query: 417 KINEPKLQYNSYPWVRYITQSGEDYIIRM 445
           KINEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 452 KINEPKLQYKSYPWVRYITQSGDDYTIRL 480

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/475 (67%), Positives = 386/475 (81%), Gaps = 30/475 (6%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S +YFCD  GK LLSRRY+DD+P+SAI++F  LL + E++SN+IPPC +HNG++YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHNDLY++ +  S+ AN A +F+FLH LV+VL +Y+K VEEESI+DNFVIIYELLDEVMD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKL++SAKKK+N  RPP +LT +VSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           D++ESINM+MTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 241 XXXIT--------------------RKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDG 280
               T                    ++K NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 VSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 281 DFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDA 340
            F+LM+YRLST IKPLIWCD  +QVHS SR+E+HC+AKAQIK KSTA NVEILIPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 360

Query: 341 DSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYN-------- 392
           D+P F+YSHGS+K+VPEK+AILWK++SFPGGK+YSM+AE+GLPS++   D +        
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNA 420

Query: 393 --FKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445
              K PVQIKFQIPYFTTSGIQVRYLKINEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 421 KLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/475 (68%), Positives = 387/475 (81%), Gaps = 30/475 (6%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S +YFCD  GK LLSRRY+DDIP+SAI++FP LL + E++SN+IPPC +HNG++YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHNDLY++ +  S+ AN A +F+FLH LV+VL +Y+K VEEESI+DNFVIIYELLDEVMD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQI +TKML+QYITQKSFKL++SAKKK+N  RPP +LT +VSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           D++ESINM+MTQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 241 XXXIT--------------------RKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDG 280
               T                    ++K NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 TSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 281 DFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDA 340
            F+LM+YRLST IKPLIWCD  +QVHS SR+E+HC+AKAQIK KSTA NVEI+IPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360

Query: 341 DSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSV-NDIADYN------- 392
           D+P F+YSHGS+K+VPEK+AILWK++SFPGGK+YSM+AE+GLPS+ NDI  +        
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420

Query: 393 --FKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445
              K PVQIKFQIPYFTTSGIQVRYLKINEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/450 (73%), Positives = 385/450 (85%), Gaps = 6/450 (1%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M SG+YFCDA GK +LSRRY+DDIP+SAI++F  +L+E E+ES+V+PPC  + G+ YLFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QH+D+Y++ LT S   N+AQ+F FLH LV VL +Y+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKLI++AKKK+N  RPP +LT +VSWR EGIKYKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           D+IESINM+M QQGQVLRSEI+G+VKV+SRLSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240

Query: 241 XXXITR------KKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIK 294
              I        KKSNIELEDLKFHQCVRLSKFENEKIITFIPPDG+FELM+YRL+TPIK
Sbjct: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300

Query: 295 PLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKW 354
           PLIWCD  IQVHS+SR+E+HCRAKAQIK KS ANNVEILIPVP+DAD+P F+YSHGSIKW
Sbjct: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360

Query: 355 VPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVR 414
           +PEKNAILWK++SF GGK+YSM A++GLPSV+ I     KRPVQIKFQIPYFTTSGIQVR
Sbjct: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420

Query: 415 YLKINEPKLQYNSYPWVRYITQSGEDYIIR 444
           YLKINEPKLQY S+PWVRYITQSG+DY IR
Sbjct: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/460 (69%), Positives = 383/460 (83%), Gaps = 15/460 (3%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S +YFCD KGK LLSRRYKDD+P+SAI++F  LL + E ES VIPPC +HNG++YLFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHNDLY++ L  S+  N+A+VF+FLH L+ VL EY+K VEEESI+DNFVIIYEL+DE+MD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+ +ML++YITQKSFKL ++ KKK+N  RPPS L  +VSWR EGIKYKKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXX-------- 232
           D++ESINM++TQ+GQVLRSEI+G VK++SRLSGMPDLKLG+ND+GIFT            
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 233 ---XXXXXXXXXXXIT----RKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELM 285
                         IT    ++K+NIELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM
Sbjct: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300

Query: 286 SYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKF 345
           +YRL+T IKPLIWCD  IQVHS+SR+E+ CRAKAQIK KS A NV+ILIPVP+DAD+P F
Sbjct: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360

Query: 346 RYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPY 405
           +YSHGSIK+VPE++AILWKIKSFPGGK+Y+M AEMGLPS++   +   KRPVQ+KF+IPY
Sbjct: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420

Query: 406 FTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445
           FTTSGIQVRYLKINEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/452 (70%), Positives = 381/452 (84%), Gaps = 7/452 (1%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M SGIYFCD  GK +L+RRY+DDI I+AI+ F  LL++ E+E+ VIPPC  H G+ YLFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           +H+D+Y++ LT S   NVAQ+F FLH LV+VL+EY+K+V EES++DNFVIIYELLDE+MD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKK--NVVRPPSSLTTAVSWRPEGIKYKKNEA 178
            GIPQIT+TKML++YITQKSFKLI+++  KK  N  RPP+ LT +VSWRPEGI YKKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXX 238
           FLD+IESINM++TQQGQVLRSEI+G V+VRSRLSGMPDLKLG+ND+GIF+          
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240

Query: 239 XXXXX-----ITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPI 293
                     +  KK  IELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM+YRL+TPI
Sbjct: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300

Query: 294 KPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIK 353
           KPLIWCD  IQVHS+SR+E+HCRAKAQIK KS ANNVEILIPVP+DAD+P+FRYSHGSIK
Sbjct: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360

Query: 354 WVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQV 413
           W+PEKNAILWK++SF GGK+YSM+A++ LPSV+ +     +RPVQ+KFQIPYFTTSGIQV
Sbjct: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420

Query: 414 RYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445
           RYLK+NEPKLQY SYPWVRYITQSGEDY IR+
Sbjct: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/446 (71%), Positives = 386/446 (86%), Gaps = 4/446 (0%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S IYFCD KG+ LLSR+Y+DDIP++AI++F  LL + E+ES+VIPPC ++N  QYLFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QH+D+Y++ +T  +  N+A+VF+FL+ ++DVL +Y+K VEEESI+DN+VIIYELLDE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKL+++AKKK+N  RPPS+LT +VSWR EGIKYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           D++ESINM+MTQ+GQ+LRSEILG VK++SRLSGMPDLKLG+NDKGIF+            
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA 240

Query: 241 XXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300
               ++K++ IELEDLKFHQCVRLSKFE EKIITFIPPDGDFELM+YRLST IKPLIWCD
Sbjct: 241 T---SKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCD 297

Query: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360
             +QVHS SR+E+HCRAKAQIK KSTA NVEILIPVP DAD+P F+YSHGSIKWVPEK+A
Sbjct: 298 MNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSA 357

Query: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIA-DYNFKRPVQIKFQIPYFTTSGIQVRYLKIN 419
           ILWKI+SFPGGK+YSMAAE+ LPS +  + +   K+PVQ+KFQIPYFTTSGIQVRYLKIN
Sbjct: 358 ILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKIN 417

Query: 420 EPKLQYNSYPWVRYITQSGEDYIIRM 445
           EPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 418 EPKLQYKSYPWVRYITQSGDDYTIRL 443

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/468 (66%), Positives = 380/468 (81%), Gaps = 26/468 (5%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S +YFCD KGK LLSR+Y+DDIP+SAI++F  LL +KE+ESN++PPC SHNG+QY+FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHNDLY+  L  S+ AN++ +F+FLH ++DVL  Y+K VEEESI+DNF+IIYELLDE+MD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            G+PQIT+TKML++YIT KSFKL ++ KKK+N  RPP+ LT +VSWRPEGIKYKKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTX----------- 229
           D+IESINM++TQ+GQVLRSEI+G V+V+SRLSGMPDLKLG+ND+GIFT            
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAK 240

Query: 230 ------XXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFE 283
                                 ++K+NIELEDLKFHQCVRLSKFENEKII+FIPPDG+F+
Sbjct: 241 NGDDEDADDTNNESSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGEFD 300

Query: 284 LMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSP 343
           LM+YRLST IKPLIWCD  IQ +   R+E+HC+AKAQIK KS A NVEILIPVP DADSP
Sbjct: 301 LMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDADSP 357

Query: 344 KFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNF------KRPV 397
            F+YSHG IK++PEKN +LWKI SFPGGK+YSMAA+MGLPS++   D N       K+PV
Sbjct: 358 IFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPV 417

Query: 398 QIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445
           Q+KF+IPYFTTSGIQVRYLK+NEPKLQY +YPWVRYITQSG+DY IR+
Sbjct: 418 QVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/455 (70%), Positives = 379/455 (83%), Gaps = 10/455 (2%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M+S IYFCD KG+ LLSR+Y+DDIP SAI++FP LL   E+E+N+IPPC  HNG+Q+LFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
           QHNDLY++ +  S+  N A +FSFLH +++VL EY+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180
            GIPQIT+ KML+QYITQKSFKL ++AKKK+N  RPP+SLT +VSWRPEGIK+KKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXX 240
           D+IESINM+MTQ+GQVLRSEI+G+VKV+S+LSGMPDLKLG+NDKG+F+            
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 241 XXXIT---------RKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLST 291
               +         ++ +N+ELEDLKFHQCVRLSKFENEK ITFIPPDGDFELMSYRLST
Sbjct: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300

Query: 292 PIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGS 351
            IKPLIWCD  I+ HS+SR+E+ CRAKAQIK KSTA NVEILIPVP DAD+P F+YSHGS
Sbjct: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360

Query: 352 IKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYN-FKRPVQIKFQIPYFTTSG 410
           IK+VPEKNAILWKI++FPG K+YSMAAEMGLPS N   +    KRPVQ+KFQIPYFTTSG
Sbjct: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420

Query: 411 IQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445
           IQVRYLKI E  LQY SYPWVRYIT+SG+DY IR+
Sbjct: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRL 455

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  229 bits (584), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 146/466 (31%), Positives = 241/466 (51%), Gaps = 36/466 (7%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M S ++    +G L++S+  KD+I +   E F   +I      +V  P  +     +  I
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVI---NNLDVRSPILTLGSTTFHHI 57

Query: 61  QHND-LYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVM 119
           + N  L+++T++R    + A ++ FL+    +L+ Y  +  E+S++ +F++ YE+LD V+
Sbjct: 58  RSNGGLWLVTVSRGN-TDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115

Query: 120 DSGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVS-------------- 165
           D+GIP+ T+   +  YI++K   L  +     +++  PS L  A +              
Sbjct: 116 DNGIPRDTELTHIMPYISKK--PLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKD 173

Query: 166 ---WRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLN 222
              WR EGI+YKKNE +LDV E I++++ + G +L+S + G V+  + LSGMP  + G N
Sbjct: 174 MCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFN 233

Query: 223 DKGIFTXXXXXXXXXXXXXXXITRKK------SNIELEDLKFHQCVRLSKFENEKIITFI 276
           D    +                  K        ++ LED KFHQCV+L KF+ E++I F+
Sbjct: 234 DYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFV 293

Query: 277 PPDGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPV 336
           PPDG FELM Y +   +         +       VE     K+   +K  A +VE+ IP 
Sbjct: 294 PPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPA 353

Query: 337 PNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKR- 395
           P D  + K   S G  K++PE+NAI+WKI  + G  +   +A + +P  N     N ++ 
Sbjct: 354 PPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSLNLEQW 412

Query: 396 ---PVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSG 438
              P+ ++F+I  F+ SG+ VRYLK+ E  L YN+  WV+YI++SG
Sbjct: 413 SRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG 458

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  213 bits (541), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 136/467 (29%), Positives = 243/467 (52%), Gaps = 36/467 (7%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M S ++    +G+LL+S+  +  +P S  E F   +I      +V  P  +     +  +
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVI---NNLDVRSPVLTLGSTTFHHV 57

Query: 61  QH-NDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVM 119
           +   +L+I+ ++RS  A+ A ++ FL+ L  +L+ +  +  E  +K++F+  YELLD V+
Sbjct: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAF-GLHSENELKEDFMTCYELLDIVL 115

Query: 120 DSGIPQITDTKMLRQYITQK---------SF---------------KLIRSAKKKKNVVR 155
           + G+P  T+   +   ++ K         +F               + +R+     N+  
Sbjct: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHD 175

Query: 156 PPSSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMP 215
             S + + + WR  GIKYKKNE FL+V E I++++++ G +L+S + G V+  + LSGMP
Sbjct: 176 SHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKS-NIELEDLKFHQCVRLSKFENEKIIT 274
             + GLND    +               I +  + ++ LED KFHQCV+L KF++E+ I 
Sbjct: 236 VCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTIN 295

Query: 275 FIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILI 334
           FIPPDG FELM Y +   +         + +   + ++     K+   +K TA +V++ I
Sbjct: 296 FIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDVQLRI 355

Query: 335 PVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLP---SVNDIADY 391
           PVP +        S+G  K+VPE++AI+WK   + G  + S++A   +P   S  +I  +
Sbjct: 356 PVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSA-TAVPMKDSALNIDQW 414

Query: 392 NFKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSG 438
           + K P+ +KF+I  F+ SG+ VR+  ++E    Y    W++Y+++SG
Sbjct: 415 S-KPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG 460

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  212 bits (540), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 149/483 (30%), Positives = 250/483 (51%), Gaps = 52/483 (10%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M + ++    KG+L++S+  +D I  S  E F   +I      +V  P  +     +  I
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVI---NNLDVRSPVLTLGSTTFHHI 57

Query: 61  QHN-DLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVM 119
           + + +L+I+ +TRS  A+ A ++ FL+    +L+ Y  +  EES+K+ F+  YELLD V+
Sbjct: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115

Query: 120 DSGIPQITD-----TKMLRQYITQK-----SFKLIRSAKKKKNV-VRPPSSLT------- 161
           ++G+P  T+     +KM R+ +        + +L+ SA    ++  R P  L        
Sbjct: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSS 175

Query: 162 --------------TAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKV 207
                          A  WR  GIKYKKNE FLDV E IN+++++ G +L+S + G V +
Sbjct: 176 SVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235

Query: 208 RSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKS-------NIELEDLKFHQ 260
            + LSG P  + GLND                    +  KK+       +++LED KFHQ
Sbjct: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQ 295

Query: 261 CVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSRS-RVEVHCRAKA 319
           CV+L++F  ++II F+PPDG FELM Y +   +           V S +  VE     K+
Sbjct: 296 CVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKS 355

Query: 320 QIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAE 379
              +K TA +V + IPVP      K   S+G  ++VPE+NA+LWK   + G  + +++A 
Sbjct: 356 LFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSA- 414

Query: 380 MGLPSVNDIADYNFKR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYIT 435
           + +P +++ +  N ++    P+ + F+I  F+ SG+ VR+ K++E    Y++  WV+YI+
Sbjct: 415 LTVP-MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVKYIS 473

Query: 436 QSG 438
           +SG
Sbjct: 474 RSG 476

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  207 bits (528), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 142/483 (29%), Positives = 249/483 (51%), Gaps = 48/483 (9%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGV--QYL 58
           M S I+  +AKG LL+S+  KD +  S  + F   +I    + +V  P  +      Q++
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVI---NDPHVRSPILTLGSTTFQHV 57

Query: 59  FIQHND---LYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELL 115
             + +D   ++++ ++RS   + + ++ +LH L  +++ +  + +E+ +KD F+++YE+L
Sbjct: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEIL 115

Query: 116 DEVMDSGIPQITDTKMLRQYITQKSFKLIRSAKKKK-----------NVVRPP------- 157
           +  +++GIPQ TD   L Q I + S K I +    K           N+++ P       
Sbjct: 116 ELTLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSS 172

Query: 158 ----SSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSG 213
                S  +   WRP G+KYKKNE +LD+ E I +++ + G +++S + G V   S LSG
Sbjct: 173 SSIALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSG 232

Query: 214 MPDLKLGLNDKGIF--TXXXXXXXXXXXXXXXITRKKS-------NIELEDLKFHQCVRL 264
           MP  +LGLND                      I  KK+       ++ LED KFHQCV+L
Sbjct: 233 MPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQL 292

Query: 265 SKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAK 324
           +K+E   +I F+PPDG F+LM YR+   I        ++++   S +      ++   + 
Sbjct: 293 NKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSN 352

Query: 325 STANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPS 384
            +A +V + IPVP       F  S G  K+   +  ++WK   + G  + +++ ++ +P+
Sbjct: 353 VSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPA 412

Query: 385 V-NDIAD-YNFKR-PVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDY 441
             +D++D   + R P+ + F+I  F+ SG+ VR+LK  EP+L Y    W++YI+ SG  Y
Sbjct: 413 TSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGA-Y 471

Query: 442 IIR 444
            IR
Sbjct: 472 EIR 474

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  207 bits (526), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 148/517 (28%), Positives = 254/517 (49%), Gaps = 98/517 (18%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           MSS IY  D   + L+ + +K    IS  E+    L ++    + + P F + G+ +++I
Sbjct: 1   MSSCIYILDETLQPLIYKNFK---AISNGEE-SIELFQQAHSKHPMVPVFHYKGIHFVYI 56

Query: 61  QHNDLYILTL--------TRSMYANVAQVFSFLHTLVDVLQEYM--KVVEEESIKDNFVI 110
           + +  Y ++          +  + NV  + ++L     +L+ Y   + +    I DNF +
Sbjct: 57  RRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNFHL 116

Query: 111 IYELLDEVMDSGIPQITDTKMLRQYITQK---SFKLIRSAKK--KKNVVRP--------- 156
           IYELLDE +D G+PQ+TD  +++ YI  +     +L  S+KK  KK  +           
Sbjct: 117 IYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESYMN 176

Query: 157 ---PSSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMT-QQGQVLRSEILGKVKVRSRLS 212
                + T+A+SWRP+GI Y KNE FLDVIE I   M   + ++ ++ + G+++ RS LS
Sbjct: 177 SFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYLS 236

Query: 213 GMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKI 272
           GMP LK+GL+                     + +++    + + KFHQCV L   + + I
Sbjct: 237 GMPKLKIGLS----------------KITSSLPKEREQF-MNNAKFHQCVSLEDLQ-KNI 278

Query: 273 ITFIPPDGDFELMSYRLST-----PIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTA 327
           ++FIPPDG+F+L  Y+L       P+  L+  D K +   R ++ +        K++++ 
Sbjct: 279 VSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLTITTDFKSQNST 338

Query: 328 NNVEILIPVP--------NDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGK---DYSM 376
           + + I IP+         + A  P+F+   G++ +    + +LW++ S  GG    ++SM
Sbjct: 339 SVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSM 398

Query: 377 AAEMGL--------------------------------PSVNDIADYNFKRPVQIKFQIP 404
             E  L                                  V++  + N  R V ++F+IP
Sbjct: 399 YCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLVSMEFEIP 458

Query: 405 YFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDY 441
           Y+T SG++V+YLKI E +LQY+S+PWVRY T + E+Y
Sbjct: 459 YYTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEY 495

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  204 bits (519), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 138/468 (29%), Positives = 241/468 (51%), Gaps = 37/468 (7%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M + ++    +G+LL+S+  K  +  S  E F   +I      +V  P  +     +  I
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVI---NNLDVRSPVLTLGSTTFHHI 57

Query: 61  QH-NDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVM 119
           +   +L+I+ ++RS  A+ A ++ FL+ L ++L+ +  +  E  +K+ F+I YELLD V+
Sbjct: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIVL 115

Query: 120 DSGIPQITDTKMLRQYITQK------SFKL------------------IRSAKKKKNVVR 155
           + G+P  T+   +   ++ K      +F +                  +R      N+  
Sbjct: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175

Query: 156 PPSSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMP 215
             S   + + WR  GIKYKKNE FL+V E I++++++ G +L+S + G V+  + LSGMP
Sbjct: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGLNDK-GIFTXXXXXXXXXXXXXXXITRKKS-NIELEDLKFHQCVRLSKFENEKII 273
             + GLND   + T               I +  + ++ LED KFHQCV+L KF++E+ I
Sbjct: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSERTI 295

Query: 274 TFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEIL 333
            FI PDG FELM Y +   +         + V   + ++     K+   +K TA +V++ 
Sbjct: 296 NFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKDVQLR 355

Query: 334 IPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLP---SVNDIAD 390
           IPVP +  S     S+G  K+VPE++AI+WK   + G  + S++A   +P   S  +I  
Sbjct: 356 IPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISA-TAVPMKDSTLNIEQ 414

Query: 391 YNFKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSG 438
           +  + P+ +KF+I  F+ SG+ VR+  ++E    Y    W++Y+++SG
Sbjct: 415 WP-RPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG 461

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  193 bits (491), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 152/532 (28%), Positives = 249/532 (46%), Gaps = 114/532 (21%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           MSS I+  D +   L+ + +K    +   E F Y   E  + SNV  P   H G+ ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHNDLYILTLT-RSMYANVAQVFSFLHTLVDVLQEYMKV--VEEESIKDNFVIIYELLDE 117
             + LY ++++  S+ +++     +L+    +L++Y++V  ++   I DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 VMDSGIPQITDTKMLRQYITQK-----SFKLIRS-------AKKKKNVVRPPS------- 158
            +D GIPQ+TD  ++R  I  +       K+ RS        +++ NV            
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 159 -------------SLTTAVSWRPEGIKYKKNEAFLDVIESINMMMT-QQGQVLRSEILGK 204
                        + T A+SWRP+GI Y KNE F+DVIES   +M  +  QV ++ I G+
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 205 VKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRL 264
           +  RS LSGMP +K+ +N                        K  +  L   KFHQCV L
Sbjct: 236 IICRSYLSGMPVVKICINK---------------------MLKDRDQFLSSAKFHQCVSL 274

Query: 265 SKFENEKIITFIPPDGDFELMSYRL-----STPIKPLIWCDAKIQVHSRSRVEVHCRAKA 319
               ++  I FIPPDGDF+L  Y++      +P+  LI     ++   + ++++  + + 
Sbjct: 275 ESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKV-VEKPKKHKLQISMKIQP 333

Query: 320 QIKAKSTANNVEILIPVPNDADS--------PKFRYSHGSIKWVPEKNAILWKIKSFPGG 371
             KA+++A  ++I +P+ +  ++        P+F+   GSI +      +LWK     GG
Sbjct: 334 HFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKANGMKGG 393

Query: 372 KD---YSMAAEMGL-------------------PSVNDIADY------------NFKRPV 397
                +SM  E  L                   P + +                    PV
Sbjct: 394 HGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKGQINNPV 453

Query: 398 Q----IKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445
           +     +F++PYFT+SG++V YLKI E +LQY S+PWVRY T +  +Y  +M
Sbjct: 454 RNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRYKTINDTEYAFQM 505

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  192 bits (488), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 117/366 (31%), Positives = 194/366 (53%), Gaps = 25/366 (6%)

Query: 65  LYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMDSGIP 124
           L+++ + R   A+ A ++ FL+ +  +L  Y  +  EE++ D+F++ YELLD V+DSG+P
Sbjct: 63  LWMVVVVRG-NADSAAIWEFLYHMNKLLDAY-AINTEEALLDDFMLCYELLDVVLDSGLP 120

Query: 125 QITDTKMLRQYITQK--------------SFKLIRSAKKKKNVVRPPSSLTTAVSWRPEG 170
           Q T+   +   +++K              S +L R+  K  +V            WR EG
Sbjct: 121 QDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEG 180

Query: 171 IKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXX 230
           IKYKKNE +LDVIE +++++ + G +L++ + G V+  + LSGMP    G ND    +  
Sbjct: 181 IKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDSQ--SLR 238

Query: 231 XXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLS 290
                         T ++ ++ LED KFHQCV+L+KF+ E++I F+PPDG+FELM Y + 
Sbjct: 239 QRSPRRQYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIR 298

Query: 291 TPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHG 350
             ++P       +   +   +E     ++    K +A +VE+ IP P    S K   S G
Sbjct: 299 DDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCG 358

Query: 351 SIKWVPEKNAILWKIKSFPGGKDYSMAA-----EMGLPSVNDIADYNFKRPVQIKFQIPY 405
             K+VPE+NAI+WKI  F G  + +++A     E G      + D   + P+ +K +I  
Sbjct: 359 KCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQG--HYAQVLDQWPRPPISMKLEIMM 416

Query: 406 FTTSGI 411
           F+T+ +
Sbjct: 417 FSTAAL 422

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  191 bits (484), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 147/488 (30%), Positives = 241/488 (49%), Gaps = 58/488 (11%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M S +    ++G+L++S+ +K+++  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVI---NNLDVRSPILTLGSTTFQHI 57

Query: 61  QHN----DLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLD 116
           + N    DL+++++TRS   N   V+ FL+    +L+ Y  +  EE +K+ F++ YELLD
Sbjct: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELLD 115

Query: 117 EVM-DSGIPQITDTKMLRQYITQKSFK------LIRSAKKKKNVVRPPSSLTTAVS---- 165
            ++ ++G P  TD   + + ++ K  K       I    K   + + P  L    S    
Sbjct: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175

Query: 166 -----------------WRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVR 208
                            WRP+GI +KKNE FL V E I+++++++G +L+S + G + + 
Sbjct: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235

Query: 209 SRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKS-------NIELEDLKFHQC 261
           + LSG P  + GLND                    I  KK+       ++ LED KFHQC
Sbjct: 236 THLSGTPVCQFGLNDS-----LSVKNDDYGDSFDYIKNKKAIPKAAAGSVLLEDCKFHQC 290

Query: 262 VRLSKFENEKIITFIPPDGDFELMSYRLSTPIK-PLIWCDAKIQVHSRSRVEVHCRAKAQ 320
           V L KF+ ++II F+PPDG  ELM Y + + I  P           S + VE     K+ 
Sbjct: 291 VSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSL 350

Query: 321 IKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAA-- 378
             +K TA NV + IPVP +    K   S+GS K+ PE+ A+LW    + G  + +++A  
Sbjct: 351 FPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVT 410

Query: 379 --EMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQ 436
                 P +N I  +  K P+ + F+I  F+ SG+ VRY  I E + +Y +  W+RY+++
Sbjct: 411 ITSKDAPRLN-IQQWQ-KPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSK 467

Query: 437 SGEDYIIR 444
           SG  Y IR
Sbjct: 468 SGS-YEIR 474

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  190 bits (482), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 139/470 (29%), Positives = 228/470 (48%), Gaps = 39/470 (8%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M +G+     KG+L++S+  K +   S  + F   +I      +V  P  +     +  I
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVI---NNLDVRSPILTLGSTTFHHI 57

Query: 61  QHND---LYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDE 117
           + N    L+++ +TRS  AN   ++ FL+   D L     +  E ++K+ F+  YELLD 
Sbjct: 58  RSNSRDHLWLVAVTRS-NANSGAIWEFLYKF-DSLLNAFGLDNETTLKEEFMTCYELLDL 115

Query: 118 VMD-SGIPQITDTKMLRQYITQKSFKLIRSAK-----------------KKKNVVRPPSS 159
           +++  G+P  T+   +   ++ K    I S                    + N      +
Sbjct: 116 MLNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDT 175

Query: 160 LTTAVS---WRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPD 216
           + T  S   WRP GIKYKKNE FL++ E I++++++   +L++ + G V + S LSG P 
Sbjct: 176 MNTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTPT 235

Query: 217 LKLGLNDKGIFT--XXXXXXXXXXXXXXXITRKKSN-IELEDLKFHQCVRLSKFENEKII 273
            + GLND                      I R  +  + LED KFH+CV L KF  ++II
Sbjct: 236 CQFGLNDSLSVDEPNYYNSDDNGFRNQQNIPRATAGTVVLEDCKFHECVSLDKFNRDRII 295

Query: 274 TFIPPDGDFELMSYRLSTPIK-PLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEI 332
            F+PPDG  ELM Y +   I  P       I   SR+ ++     K+   +K +AN+V +
Sbjct: 296 KFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLFPSKLSANDVVL 355

Query: 333 LIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYN 392
            IPVP+     K   S+G  ++VPE++ I+WK   + G  +  ++A     S ND     
Sbjct: 356 KIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAVT--VSSNDTTQLM 413

Query: 393 FKR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSG 438
            ++    P+ + F+I  F+ SG+ VRYLKI E   +Y +  W++YI++SG
Sbjct: 414 LQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSG 463

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  190 bits (482), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 139/494 (28%), Positives = 244/494 (49%), Gaps = 63/494 (12%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M S I    ++G+L++++  K  +  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVI---NNLDVRSPILTLGSTTFHHI 57

Query: 61  QHN---DLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDE 117
           + +    L+++ ++RS  AN   ++ FL+ L +V+ +   + +E ++K+NF+  YE+LD 
Sbjct: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILDT 115

Query: 118 VMD-SGIP------------------QITDTKMLR-QYITQKSFKLIRSAKKKKNVVRP- 156
           V++  GIP                  QI+   + R   +T  S  L         +  P 
Sbjct: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175

Query: 157 -------------PSSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILG 203
                         S+  + +SWRP GIKYKKNE  L+V E I++++++ G +L+S + G
Sbjct: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235

Query: 204 KVKVRSRLSGMPDLKLGLNDKGI--FTXXXXXXXXXXXXXXXITRKKSN-IELEDLKFHQ 260
            + + + LSGMP  + GLND     F                I +  +  + LED KFHQ
Sbjct: 236 TIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQ 295

Query: 261 CVRLSKFENEKIITFIPPDGDFELMSY----RLSTPIK--PLIWCDAKIQVHSRSRVEVH 314
           CV L KF  +++I F+PPDG  ELM Y     L+ P K  P++       +   + ++  
Sbjct: 296 CVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV-----TSIGRGNTIDYR 350

Query: 315 CRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDY 374
              K+    K +A +V + IPVP      +   S+G  K+VPE++A++WK   + G  + 
Sbjct: 351 VTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTEN 410

Query: 375 SMAAEMGLPSVNDIADYNFKR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPW 430
           +++A + +PS +D      ++    P+ + F+I  F+ SG+ VRY K+++   +Y +  W
Sbjct: 411 TLSA-VTVPS-SDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKW 468

Query: 431 VRYITQSGEDYIIR 444
           ++YI++SG  Y IR
Sbjct: 469 IKYISKSGS-YEIR 481

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  189 bits (480), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 138/482 (28%), Positives = 240/482 (49%), Gaps = 56/482 (11%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M + I+    +G+L++S+ + + +  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVI---NNLDVRSPILTLGSTTFHHI 57

Query: 61  QHN---DLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDE 117
           + N    L+I+T++R+  AN   ++ FL+    +L  Y  + +EE +K++F+I YE+LD 
Sbjct: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDV 115

Query: 118 VMDS-GIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVR---PPSSLTTA---------- 163
           V+ + GIP  T+   +   I+ K  K   ++ + K+      P S+L+T+          
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 164 ----------------VSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKV 207
                             WRP GIKYKKNE FL V E IN+++++ G +L++ + G + +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 208 RSRLSGMPDLKLGLNDKGI--FTXXXXXXXXXXXXXXXITRKKS-NIELEDLKFHQCVRL 264
            + LSG P  + GLND     F                + +  + ++ LED KFHQCV L
Sbjct: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295

Query: 265 SKFENEKIITFIPPDGDFELMSY----RLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQ 320
            KF  E+II F+PPDG+ ELM Y     L+ P K        +     S VE     K+ 
Sbjct: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKI-----TPVVTPCGSTVEYRITLKSL 350

Query: 321 IKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEM 380
              K +A +V + IPVP      K   S+G  K+  E+NA++W+   + G  + +++A +
Sbjct: 351 FPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA-V 409

Query: 381 GLPSVNDIADYNFKR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQ 436
            +P+ +D      ++    P+ + F+I  F+ SG+ VRY ++++   +Y    W++YI++
Sbjct: 410 TVPT-SDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYISK 468

Query: 437 SG 438
           SG
Sbjct: 469 SG 470

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  189 bits (479), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 143/492 (29%), Positives = 238/492 (48%), Gaps = 55/492 (11%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M +GI     +G+L++S+ +K  +  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVI---NNLDVRSPILTLGSTTFHHI 57

Query: 61  QH----NDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLD 116
           +     ++L+++  TR+  AN A ++ FL+ L  +L EY  + +EE +K+ F+I++ELLD
Sbjct: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLD 115

Query: 117 EVMDS-GIPQITDTKMLRQYITQKSFKLIRS----------AKKKKNVVRPPSSLT---- 161
            ++ S GIP  T+   +   ++ K  KL  +            K  N +  P  L     
Sbjct: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDS 175

Query: 162 ----------TAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRL 211
                        SWRP+ IK+KKNE  L V E IN+++ + G +L++ + G + +++RL
Sbjct: 176 SQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235

Query: 212 SGMPDLKLGLNDKGIF-------------TXXXXXXXXXXXXXXXITRKKS--NIELEDL 256
           SG P  + GLND                 T               +  K S  N+ LED 
Sbjct: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295

Query: 257 KFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIK-PLIWCDAKIQVHSRSRVEVHC 315
           KFHQCV L KF+ E+II F+PPDG  ELM Y +   +  P           +   ++   
Sbjct: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRI 355

Query: 316 RAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYS 375
             K+    + +A  V + IPVP          S+G+ K+VP +NA++WK   + G  + +
Sbjct: 356 ALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENT 415

Query: 376 MAAEMGLPS--VNDIADYNFKR-PVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVR 432
           ++A + +PS  VN      + R P+ + F+I  F+ SG+ VRY  I+E    Y +  W++
Sbjct: 416 LSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIK 474

Query: 433 YITQSGEDYIIR 444
           Y+++SG  Y +R
Sbjct: 475 YVSKSGS-YEVR 485

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  188 bits (477), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 141/496 (28%), Positives = 244/496 (49%), Gaps = 69/496 (13%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M SG+    ++G+L+L++ +K+ +  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVI---NNLDVRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-LYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDE 117
           +  H D L+++T+TRS  AN A ++ FL+ L  V+  Y ++  EE++K+ F+I++E+LD 
Sbjct: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 VMD-SGIPQITDTKMLRQYITQKSFKLIRS------------------------------ 146
           ++  +GIP  T+   L   I Q S K +R+                              
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFP 172

Query: 147 ---AKKKKNVVRPPSSLT-----TAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLR 198
               K+  + +    S +       ++WRP+GI +KK+E FL V E IN+++++ G +L+
Sbjct: 173 KFLTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILK 232

Query: 199 SEILGKVKVRSRLSGMPDLKLGLND---------KGIFTXXXXXXXXXXXXXXXITRKKS 249
           S + G + + + LSG P  + GLND         K                   I +  +
Sbjct: 233 SYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAA 292

Query: 250 -NIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSR 308
            ++ LED KFH+CV L KF    II F+PPDG  ELM Y +   I  L +    I  HS 
Sbjct: 293 GSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNIN-LPFKVTPIVTHST 351

Query: 309 SRVEVHCR--AKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIK 366
              E+  R   K+    K +A +V + IPVP      K   S+G  K+VPE+NA++W+  
Sbjct: 352 RDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFN 411

Query: 367 SFPGGKDYSMAAEMGLPSVNDIADYNFKR----PVQIKFQIPYFTTSGIQVRYLKINEPK 422
            + G  + +++A     S +D    N ++    P+ ++F++  F+ SG+ VRY  I+   
Sbjct: 412 KYNGLTENTLSAVT--VSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKD 469

Query: 423 LQYNSYPWVRYITQSG 438
            ++ +  W++YI+++G
Sbjct: 470 SKHRAVKWIKYISKAG 485

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  188 bits (478), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 129/470 (27%), Positives = 219/470 (46%), Gaps = 108/470 (22%)

Query: 48  PCFSHNGVQYLFIQHNDLYILTLTRSMYANV-AQVFSFLHTLVDVLQEYM-KVVEEESIK 105
           P  SH G  Y++IQ + LY L+L+  +   V   VF++L  L  + ++Y+ + +  + I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFVIIYELLDEVMDSGIPQITDTKMLRQYITQKSFKLIRS--------------AKKKK 151
           DNF ++YEL+DE +D GIPQ+TD  ++R Y+  +  +                  A K++
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 152 NVVRPPS------------SLTTAVSWRPEGIKYKKNEAFLDVIESINMMMT-QQGQVLR 198
               P +            + T+A+SWRP GI Y KNE FLDV+E +  +M  ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKF 258
           +++ G +  RS LSGMP L +GLN                     + + +       + F
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLN-------------------KMVAQDRDFT--SQVHF 259

Query: 259 HQCVRLSKFENEKIITFIPPDGDFELMSYRLS-----TPIKPLIWCDAKIQVHSR----S 309
           HQCV L +   ++ ITF+PPDG+F+L  Y+L+      P+  L  C A ++   R     
Sbjct: 260 HQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVKPRRRPADAD 319

Query: 310 RVEVHCRAKAQIKAKSTANNVEILIPVPNDADS--------PKFRYSHGSIKWVPEKNAI 361
           R+ +        K +   + +++ +P+    +         P+F+   G + +    + +
Sbjct: 320 RLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFNITDDYL 379

Query: 362 LW---KIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRP---------------------- 396
           LW   K K   G + ++M ++  L    D A Y+ +R                       
Sbjct: 380 LWDIGKAKGSHGDRRFTMQSQFHL---YDEAYYSRRRAQLSTSMDPLPAHPGQQLEALYN 436

Query: 397 -------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRY 433
                        +++ F++PY T SG++V +LKI EP+LQY S+PW+RY
Sbjct: 437 QTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRY 486

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  187 bits (476), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 140/503 (27%), Positives = 252/503 (50%), Gaps = 72/503 (14%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M + +    A+G+L++S+ +K  +  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVI---NNLDVRSPILTLGSTTFHHI 57

Query: 61  QH---NDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDE 117
           +    ++L+I+ ++R+   + A ++ FL+ L  +L  Y  +  EE +K+ F+I++ELLD 
Sbjct: 58  KSTRGDNLWIVAVSRN-NVDSAAIWEFLYKLDSLLDSY-GLNHEEYLKEEFMIVHELLDV 115

Query: 118 VM--DSGIPQITDTKMLRQYITQKSFKLIRSAKKK------------------------K 151
           +M    GIP +T+  ++   ++ K  K I  A+                          K
Sbjct: 116 MMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPK 175

Query: 152 NVVRPPSSLTTAVS------WRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKV 205
            + R  +SL+  +S      WRP+GI +KKNE  L V E IN+++++ G VL++ + G +
Sbjct: 176 LLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSI 235

Query: 206 KVRSRLSGMPDLKLGLNDK--------GIFTXXXXXXXXXXXXXXXITRKK------SNI 251
            + + LSG P  + GLND          ++                  +K+       ++
Sbjct: 236 DLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASVGSV 295

Query: 252 ELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYR----LSTPIK--PLIWCDAKIQV 305
            LED KFHQCV L KF+ ++II F+PPDG  ELM Y     L+ P K  P++        
Sbjct: 296 ILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIV-----TNT 350

Query: 306 HSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKI 365
            + + +E     K+    + +A NV + IPVP +    K   ++GS K++PE++A++W+ 
Sbjct: 351 RNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRF 410

Query: 366 KSFPGGKDYSMAAEMGLPSVND----IADYNFKRPVQIKFQIPYFTTSGIQVRYLKINEP 421
             F G  + +++A + +P+ ++    +  ++ K P+ + F+I  F+ SG+ VRY  I E 
Sbjct: 411 NKFNGLTENTLSA-VTIPTKDNTQLSLQQWS-KPPMSLDFEILMFSNSGLVVRYFTITER 468

Query: 422 KLQYNSYPWVRYITQSGEDYIIR 444
             +Y +  W++YI++SG  Y IR
Sbjct: 469 DQKYKAVKWIKYISRSGS-YEIR 490

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  185 bits (470), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 140/499 (28%), Positives = 243/499 (48%), Gaps = 75/499 (15%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M SG+    ++G+L+L++ +K+ +  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVI---NNLDVRSPVLTLGSTTFHHI 57

Query: 61  QH---NDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDE 117
           +    ++L+++T+TRS  AN A ++ FL+ L  V+  Y ++  EE++K+ F+I++E+LD 
Sbjct: 58  RSMRGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 VMD-SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSL---------------- 160
           ++  +GIP  T+   L   I Q S K IR+      ++  P S+                
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPIRNVG---GLLESPDSIDMLSSTSSPSSVGGEL 169

Query: 161 -------------------------TTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQ 195
                                       ++WRP+GI +KK+E FL V E +N+++++ G 
Sbjct: 170 HFPKFLKKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGS 229

Query: 196 VLRSEILGKVKVRSRLSGMPDLKLGLNDK-GIFTXXXXXXXXXXXXXXXITRKKSN---- 250
           +L+S + G + + + LSG P  + GLND  G+ +                  +  N    
Sbjct: 230 ILKSYVDGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPK 289

Query: 251 -----IELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDAKIQV 305
                + LED KFH+CV + KF    II F+PPDG  ELM Y +   I  L +    I  
Sbjct: 290 AAAGSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVA 348

Query: 306 HSRSRVEVHCR--AKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILW 363
           HS    EV  R   K+    K +A +V + IPVP      K   S+G+ K+VPE+NA++W
Sbjct: 349 HSARDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIW 408

Query: 364 KIKSFPGGKDYSMAAEMGLPSVNDIADYNFKR----PVQIKFQIPYFTTSGIQVRYLKIN 419
           +   F G  + +++A     S +D    + ++    P+ + F++  F+ SG+ VRY  I+
Sbjct: 409 RFNKFNGLTENTLSAVT--VSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIS 466

Query: 420 EPKLQYNSYPWVRYITQSG 438
               ++ +  W++YI++SG
Sbjct: 467 SRDSKHRAVKWIKYISKSG 485

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  184 bits (466), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 127/484 (26%), Positives = 235/484 (48%), Gaps = 55/484 (11%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M + +     +G+LL+ + +K  +  +  + F   +I  +   N+  P  +     + FI
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINND---NIRSPILTLGSTTFHFI 57

Query: 61  Q---HNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDE 117
           +    + L+++ +TRS  A+   ++ +L+ L  +++ Y  +  E+ +KD F++ +ELLD 
Sbjct: 58  RTTAGSKLWLVAVTRS-NADSGAIWEYLYKLNSLMEVY-GLTHEDILKDEFIVCHELLDI 115

Query: 118 VMD-SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTT-------------- 162
            +  +G+P  T+   +   +T K  +++ S+  + +++   SS+TT              
Sbjct: 116 TLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDIL--ASSVTTLGHNSTPISMPKFL 173

Query: 163 -------------------AVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILG 203
                               + WR   IKYKKNE  ++VIE IN+++ +   +LR+ + G
Sbjct: 174 SRNSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDG 233

Query: 204 KVKVRSRLSGMPDLKLGLND----KGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFH 259
            + + + LSGMP  ++G+ND    +G                         + LE  KFH
Sbjct: 234 TIDITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSGDRVILEGSKFH 293

Query: 260 QCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSR-SRVEVHCRAK 318
           QCV L K+  + +I FIPPDG FELM Y +S  +        ++ + S  + +    + K
Sbjct: 294 QCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAIKLK 353

Query: 319 AQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAA 378
           +    K +A NV + IPVP      K   S G  K++PE+N ++W    F G  +  + A
Sbjct: 354 SLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHLNA 413

Query: 379 EMGLPSVNDIADYNFKR----PVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYI 434
           +  +P+   IA  + K+    P+ + F++  F+ +G+ VRYLK+ E  + YN+  W++YI
Sbjct: 414 QT-VPT-QSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKYI 471

Query: 435 TQSG 438
           + +G
Sbjct: 472 SAAG 475

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  184 bits (467), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 141/496 (28%), Positives = 240/496 (48%), Gaps = 69/496 (13%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M SG+    ++G+L+L++ +K+ +  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVI---NNLDVRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-LYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDE 117
           +  H D L+++T+TRS  AN A ++ FL+ L  V+  Y ++  EE++K+ F+I++E+LD 
Sbjct: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 VMD-SGIPQITDTKMLRQYITQKSFKLIRSAKK--------------------------K 150
           ++  +GIP  T+   L   I Q S K +R+                              
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFP 172

Query: 151 KNVVRPPSSL------------TTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLR 198
           K + +  SS                ++WRP+GI +KK+E FL V E +N+++++ G +L+
Sbjct: 173 KFLKKSSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 199 SEILGKVKVRSRLSGMPDLKLGLND---------KGIFTXXXXXXXXXXXXXXXITRKKS 249
           S + G + + + LSG P  + GLND         K                   I +  +
Sbjct: 233 SYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAA 292

Query: 250 -NIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSR 308
            ++ LED KFH+CV L KF     I F+PPDG  ELM Y +   I  L +    I  HS 
Sbjct: 293 GSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHST 351

Query: 309 SRVEVHCR--AKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIK 366
              E+  R   K+    K +A +V + IPVP      K   S+G  K+VPE+NA++W+  
Sbjct: 352 RDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFN 411

Query: 367 SFPGGKDYSMAAEMGLPSVNDIADYNFKR----PVQIKFQIPYFTTSGIQVRYLKINEPK 422
            + G  + +++A     S +D    N ++    P+ + F++  F+ SG+ VRY  I    
Sbjct: 412 KYNGLTENTLSAVT--VSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKD 469

Query: 423 LQYNSYPWVRYITQSG 438
            ++ +  W++YI++SG
Sbjct: 470 SKHRAVKWIKYISRSG 485

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  183 bits (465), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 153/535 (28%), Positives = 242/535 (45%), Gaps = 129/535 (24%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           MSS ++  D +   L+ R  K     S      Y L  K        P     G+ Y++I
Sbjct: 1   MSSCVFILDEQLNPLILRNLK-----SIAHPEWYALYFKRVHPQSRGPVIYSKGIIYIYI 55

Query: 61  QHNDLYILTLTRS-MYANVAQVFSFLHTLVDVLQEYMKV--VEEESIKDNFVIIYELLDE 117
             + LY ++++   +  N+  + ++L+    +L +Y+KV  V+   I DNF +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 118 VMDSGIPQITDTKMLRQYI-----------------TQKSFKLIRSAKKKKN-------- 152
            +D GIPQ+TD  ++R  I                  ++S   I  +K+ K+        
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 153 ---------VVRPPSSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMT-QQGQVLRSEIL 202
                    V+R   + T A+SWRP+GI Y KNE F+D+IE  + +M  +  QV ++ + 
Sbjct: 176 DDEQYINSFVLR---TTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVY 232

Query: 203 GKVKVRSRLSGMPDLKLGLN----DKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKF 258
           GK+  RS LSGMP +++ +N    DK +F                         L   KF
Sbjct: 233 GKINCRSYLSGMPIVRVCINKMLKDKDLF-------------------------LGSSKF 267

Query: 259 HQCVRLSKFENEKIITFIPPDGDFELMSYRL-----STPIKPLIWCDAKI-QVHSRSRVE 312
           HQCV L    ++  I FIPPDGDF+L  Y+L      +PI  LI  D KI +   + R+ 
Sbjct: 268 HQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLI--DYKINERQKKHRLH 325

Query: 313 VHCRAKAQIKAKSTANNVEILIPVP--------NDADSPKFRYSHGSIKWVPEKNAILWK 364
           +    +   KA+++A  ++I IP          +   +P+F+  HGS+ +      +LW 
Sbjct: 326 LSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLWD 385

Query: 365 IKSFPGGK---DYSMAAEMGL-------------------PSVNDIADY----------- 391
            +   GG     YSM  E  L                   P + + A             
Sbjct: 386 AQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKSNK 445

Query: 392 ----NFK-RPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDY 441
                F+   +  +F++PY+T+SG++V YLKI+E  L+Y S+ WVRY T +  +Y
Sbjct: 446 EGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKTINDTEY 500

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  178 bits (451), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 137/496 (27%), Positives = 242/496 (48%), Gaps = 69/496 (13%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M SG+    ++G+L+L++ +K+ +  S  + F   +I      +V  P  +     +  I
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVI---NNLDVRSPVLTLGSTTFHHI 57

Query: 61  --QHND-LYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDE 117
             +H D L+++T+TRS  AN A ++ FL+ L  V+  Y ++  EE++K+ F+I++E+LD 
Sbjct: 58  RSKHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 VMD-SGIPQITDTKMLRQYITQKSFKLIRSAKK--------------------------K 150
           ++  +GIP  T+   L   + + S K +R+                              
Sbjct: 116 MLGGNGIPIDTE---LNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFP 172

Query: 151 KNVVRPPSSL------------TTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLR 198
           K + +  SS             +  ++WR  GI +KK+E FL V E +N+++++ G +L+
Sbjct: 173 KFLKKSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 199 SEILGKVKVRSRLSGMPDLKLGLND---------KGIFTXXXXXXXXXXXXXXXITRKKS 249
           S + G + + + L+G P  + GLND         K                   + +  +
Sbjct: 233 SYVDGTIDIVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAA 292

Query: 250 -NIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSR 308
            ++ LED KFH+CV + KF    II FIPPDG  ELM Y +   I  L +    I  HS 
Sbjct: 293 GSVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNIN-LPFKITPIVSHST 351

Query: 309 SRVEVHCR--AKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIK 366
              E+  R   K+    K +A +V + IPVP      K   S+G  K+VPE+NA++W+  
Sbjct: 352 RDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFN 411

Query: 367 SFPGGKDYSMAAEMGLPSVNDIADYNFKR----PVQIKFQIPYFTTSGIQVRYLKINEPK 422
            + G  + +++A     S +D    +F++    P+ + F++  F+ SG+ VRY  I+   
Sbjct: 412 KYNGLTENTLSA--ATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKD 469

Query: 423 LQYNSYPWVRYITQSG 438
            ++ +  W++YI++SG
Sbjct: 470 SKHRAVKWIKYISKSG 485

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  172 bits (436), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 138/486 (28%), Positives = 229/486 (47%), Gaps = 114/486 (23%)

Query: 48  PCFSHNGVQYLFIQHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQ---EYMKV-VEEES 103
           P F  NG  Y  I  ++LY   + +    N     S LH L ++ Q   ++M + + + +
Sbjct: 46  PIFEGNGWHYAVITRDNLYFAMIMQ--VNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLN 103

Query: 104 IKDNFVIIYELLDEVMDSGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVR-----PPS 158
           ++DNF +I+E+++E  D GI Q+T+  ++  +I     ++I+     +N        PP 
Sbjct: 104 VRDNFHLIFEVIEESSDYGIIQVTNYNIIHDFI---KVEVIKPDDDSENTASEKHELPPG 160

Query: 159 -------------SLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEIL-GK 204
                        ++T+AVSWRP+GI Y KNE FLDVIE +  +M  +  V+R+ ++ G 
Sbjct: 161 DQDETFINSYILRTMTSAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGT 220

Query: 205 VKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRL 264
           +  RS LSGMP L +GLN                     + +K  +  ++ LKFH+CV L
Sbjct: 221 IICRSYLSGMPQLSIGLN--------------------KLMQKNVHF-MKRLKFHECVDL 259

Query: 265 SKF--ENEKIITFIPPDGDFELMSYRLSTPI--KPLIWCDA-------KIQVHSRSRVEV 313
                E   +I FIPPDG+FEL +Y+L+ P+  +P+I   +       +    ++ ++ +
Sbjct: 260 HTLIKEESPVIKFIPPDGEFELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLL 319

Query: 314 HCRAKAQIKAKSTANNVEILIPVPN-------DADSPK-FRYSHGSIKWVPEKNAILWKI 365
                   KA+ +A  + I IP+ +       D + P  F+   G + +     +I+WKI
Sbjct: 320 KAAITTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKI 379

Query: 366 KSFPGG---KDYSM-------------AAEMGL------------PSVNDIAD-YNFKRP 396
            +  GG   K+Y +             A E+ L            P +  I D Y+ K  
Sbjct: 380 NNLKGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTT 439

Query: 397 -----------------VQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGE 439
                            + + F+IPY+  SG++V Y KI EP+L Y S+PWVRY T +  
Sbjct: 440 EYDGNENQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYKTVNDN 499

Query: 440 DYIIRM 445
           +YI ++
Sbjct: 500 EYIYQV 505

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  170 bits (430), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 151/549 (27%), Positives = 242/549 (44%), Gaps = 136/549 (24%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           MSS I+  D   + L+S+  K    +  I +    +   E +     P  S +   ++ I
Sbjct: 1   MSSCIFITDENLEPLISKNIKAIPNLQGILRLFKSVYTPESQ-----PVISASSFHFVHI 55

Query: 61  QHNDLYILTLTRS--MYANVAQVFSFLHTLVDVLQEYMKV--VEEESIKDNFVIIYELLD 116
           + + L  +++  +    ANV  + +FL     +L++Y+ V  +++  + DN ++I EL+D
Sbjct: 56  KRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELID 115

Query: 117 EVMDSGIPQITDTKMLRQYITQKS-----------------------------------F 141
           E +D G+ QITD  ++R YI  K                                    +
Sbjct: 116 ESIDFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEEDNKKTKRRSGKPNLY 175

Query: 142 KLIRSAK-------------KKKNVVRPPSSLTTA-----VSWRPEGIKYKKNEAFLDVI 183
           K +R AK             K+ +V    +S         VSWR +GI Y +NE FLDV+
Sbjct: 176 KFLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAKGIHYARNEFFLDVV 235

Query: 184 ESINMMMT-QQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXX 242
           E +  +M    G + ++ I GK+  +S LSGMP LK+  N                    
Sbjct: 236 EQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN-------------------- 275

Query: 243 XITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRL-----STPIKPLI 297
            +++K     +   KFHQCV      NEK I FIPPDGDF L  Y L       P+  L+
Sbjct: 276 KLSQKDEQF-ISHSKFHQCVTWPS-SNEKEIEFIPPDGDFVLCQYELKRHVKDQPMLKLV 333

Query: 298 WCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPN-------DADSP-KFRYSH 349
               K ++  + ++++ C  +   KA+++ + + + IP+         D   P +F+   
Sbjct: 334 SFGVKPKL-KKYKIQMSCTIETHFKARNSTSTLNLKIPLARLFQEYQIDLKKPARFKSDS 392

Query: 350 GSIKWVPEKNAILWKIKSFPGGK---DYSMAAEMGL------------------------ 382
           G + +    + +LW I+   GG      SMAAE  L                        
Sbjct: 393 GKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNPPPLRD 452

Query: 383 -PSVNDIAD--YNFKRP-------VQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVR 432
            P + ++ D  +N K P       + +KF+IPY T SG+QV YLKI+E +LQY S+PWVR
Sbjct: 453 GPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQSFPWVR 512

Query: 433 YITQSGEDY 441
           Y T + E+Y
Sbjct: 513 YKTVNDEEY 521

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  167 bits (422), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 140/530 (26%), Positives = 241/530 (45%), Gaps = 114/530 (21%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M S ++  D + +LL  R  K   P+ ++ +     I   ++S    P   +    Y+FI
Sbjct: 1   MISCLFILDEELQLLTVRLLK---PVPSLLEPLEWFIRHPKKS----PILQNMDYDYIFI 53

Query: 61  QHNDLYILTLTRSMYANV--AQVFSFLHTLVDVLQEYM-KVVEEESIKDNFVIIYELLDE 117
           Q + LY L+L+  +  NV    VFS+L+ L  + Q+Y+ + + +  I  NF +I+EL+DE
Sbjct: 54  QRDGLYFLSLSYQL-TNVYPMVVFSYLNQLHMLFQKYLGENLNKVLITGNFHLIHELIDE 112

Query: 118 VMDSGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRP--------------------- 156
            +  G PQ+TD  ++R YI  +  K       ++  V                       
Sbjct: 113 SIFMGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKDSKKKEEDTEATDE 172

Query: 157 -------PSSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSE-ILGKVKVR 208
                    + T+A+SWRP+GI Y KNE +LDVIE +  ++  Q   ++S  + G ++ R
Sbjct: 173 NYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGYIQCR 232

Query: 209 SRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFE 268
           S LSGMP L +GLN                         ++   +    FHQCV L +  
Sbjct: 233 SYLSGMPMLTIGLNK---------------------LNSENEYFMRRANFHQCVNLDQLT 271

Query: 269 NEKIITFIPPDGDFELMSYRLSTPIK--PLIWC-DAKIQVHSR------SRVEVHCRAKA 319
            +K+I+F PPDG+F+L +Y+L+  +   P+I   D K+++  R       R+ +      
Sbjct: 272 TDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKDGLDRLILAVTIST 331

Query: 320 QIKAKSTANNVEILIPVPN-----DAD---SPKFRYSHGSIKWVPEKNAILWKIKSFPGG 371
             K + + + + I +P+       D D    P+F+   G + +    + +LW++    GG
Sbjct: 332 YFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLLWEVGKVKGG 391

Query: 372 ---KDYSMAAEMGL-------------------------PSVNDI--ADYNFKRP----- 396
              K   M +E  L                         P +  +    +    P     
Sbjct: 392 HGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHELNSPTSEAA 451

Query: 397 -VQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445
            ++++F+IPY+T SG++V +LKI E +LQ+ S+PWVRY T + + Y  ++
Sbjct: 452 LLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRYKTINHDIYAYQL 501

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  164 bits (415), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 120/416 (28%), Positives = 198/416 (47%), Gaps = 44/416 (10%)

Query: 65  LYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMDS-GI 123
           L+I+ +TRS  AN   ++ FL+ L  +L  Y  +  EE + + F++ YE++D ++ S  +
Sbjct: 65  LWIVAITRS-NANSGVIWEFLYKLDSMLTAY-DLNNEEKLMEKFMVYYEMIDVMLTSNAM 122

Query: 124 PQITDTKMLRQYITQKSFKLIRSA----KKKKNVVRPPSSLT---------------TAV 164
           P  T+   +   I+ +  K I ++    K   N +  P  LT               + +
Sbjct: 123 PINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFSNITQSDI 182

Query: 165 SWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDK 224
            WRP GIKYKKNE FL V E IN+++++   +L++ + G + + S LSG P  + GLND 
Sbjct: 183 PWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPICQFGLNDY 242

Query: 225 GIFTXXXXXXXXXXXXXXXITRKK--------SNIELEDLKFHQCVRLSKFENEKIITFI 276
              T               +  +         S++++ED  FHQCV L KF +E++I F+
Sbjct: 243 LSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQCVSLDKFNDERLINFV 302

Query: 277 PPDGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKS------TANNV 330
           PPDG FELM Y +   +        ++ + S       C  + +I  KS      +A + 
Sbjct: 303 PPDGSFELMRYHVRDDLNIPFKVTPRVSISSS-----RCSMRYKIILKSLFPTSLSAADA 357

Query: 331 EILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIAD 390
            + IP+P      K   S G   +    N  +WK   + G  +  +  E    S  DI  
Sbjct: 358 MLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILETVPSSSTDILS 417

Query: 391 YN--FKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIR 444
                + P+ + F+I  F+ SG+ V+YLK+ E   +Y    W++Y+++SG  Y IR
Sbjct: 418 LQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKSGS-YEIR 472

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  145 bits (366), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 114/483 (23%), Positives = 231/483 (47%), Gaps = 49/483 (10%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M + +    A+G+L++S+ +K  +  S  + F   +I      +V  P  +     + ++
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVI---NSLDVRSPILTLGSTTFHYV 57

Query: 61  Q--HNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEV 118
           +     L++++++R+   N A  + FL+    +L  Y ++  EE +K+ F++ +ELLD +
Sbjct: 58  RTPGEGLWVVSVSRN-NENSAATWEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDTM 115

Query: 119 MDSG-IPQITDTKMLRQYITQK---SFKLIRSAKKKKNVVRPPSSLTTA----------- 163
           ++ G IP  TD   +   ++ K   S   +R+  +++       +   A           
Sbjct: 116 VEGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNP 175

Query: 164 --VSWRP----EGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDL 217
             +S  P    +G + K+NE  + V ESI++++++ G +L++ + G + + ++L G    
Sbjct: 176 GGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAVC 235

Query: 218 KLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIE----------LEDLKFHQCVRLSKF 267
           + GLND                       + +N+E          L D KFHQCV L +F
Sbjct: 236 QFGLNDS---LSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCKFHQCVSLERF 292

Query: 268 ENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTA 327
           + ++II F PP+G  ELM Y +   +       + +   + +  +     K+    K +A
Sbjct: 293 DRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTIKSLFPGKLSA 352

Query: 328 NNVEILIPVPNDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPS--V 385
            NV + IPVP      K   S+G+ K++PE+NA++WK   + G  +  ++A + +P+   
Sbjct: 353 KNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITVPTRDT 411

Query: 386 NDIADYNFKR-PVQIKFQIPYFTTSGIQVRYLKI---NEPKLQYNSYPWVRYITQSGEDY 441
             +A   + R P+ + F+I  ++ +G+ VRY  +   +    ++ +  W++Y++ SG  Y
Sbjct: 412 TQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSHSGS-Y 470

Query: 442 IIR 444
            +R
Sbjct: 471 EVR 473

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  145 bits (365), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 147/583 (25%), Positives = 238/583 (40%), Gaps = 170/583 (29%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIE-KEQESNVIPPCFSHNGVQYLF 59
           MSS ++  D   + L+S+  K       +   P ++   KE  +   PP  + +   Y++
Sbjct: 1   MSSCLFILDELLEPLISKNTK------PVRNLPDIIKSFKESWTPTSPPIITVSNWHYVY 54

Query: 60  IQHNDLYILTLTRSM---YANVAQVFSFLHTLVDVLQEYMK--VVEEESIKDNFVIIYEL 114
           ++ + L+ +     M     N+  +  +L  L  +L+ Y K  ++ +  I DN +++ EL
Sbjct: 55  VKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTEL 114

Query: 115 LDEVMDSGIPQITDTKMLRQYITQK---------------SFKLIRSAKKKKNVVRPPSS 159
           +DE +D GI Q+TD  ++R YI  K                     SA  KKN     S 
Sbjct: 115 MDESIDFGIIQMTDPSIIRDYIRVKINNSIATGNNSNDDSDDSDTESASSKKNAKSLGSY 174

Query: 160 LTTA----------------------------------------------VSWRPEGIKY 173
           + +A                                              VSWR +GI Y
Sbjct: 175 MPSANNLTNLWKGYSTKDETLNENVNNDNFENNDDETYINSHIARTTTMAVSWRTKGIYY 234

Query: 174 KKNEAFLDVIESINMMMTQQGQVLRSEIL-GKVKVRSRLSGMPDLKLGLNDKGIFTXXXX 232
            KNE FLDV+ES+  +M  + +V+R  ++ G++K +S LSGMP L++ LN          
Sbjct: 235 AKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRIALN---------- 284

Query: 233 XXXXXXXXXXXITRKKSNIELEDLKFHQCVRLS--------------------KFENEKI 272
                      I +      L   KFHQCV L+                     F N+K 
Sbjct: 285 ----------KILQDDKQF-LGHAKFHQCVSLNSINIKDLEKDLEGPNDISNKNFVNKKE 333

Query: 273 ITFIPPDGDFELMSYRL-----STPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTA 327
           I FIPPDG+F L  Y L       P+  +   D K     + RV++  + +   K +++ 
Sbjct: 334 IEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNF-KKFRVQISLKIETHFKRQNST 392

Query: 328 NNVEILIPVP---ND-----ADSPKFRYSHGSIKWVPEKNAILWKIKSFPGG-------- 371
           + + I IP+    ND     +  P+F+   G + +   ++ ++W+I +  GG        
Sbjct: 393 SLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEIDALKGGHGENEKGM 452

Query: 372 ---------KDYSMAAEMGLPSVN---------------------DIADYNFKRPVQ--- 398
                    ++Y    E    S+N                     D  D   K   Q   
Sbjct: 453 VAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHENEDAEDTALKMKTQYVF 512

Query: 399 IKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDY 441
           ++F+IPY T SG++V YLKI E  L+Y S+PWVRY T + ++Y
Sbjct: 513 MQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRYKTLNDDEY 555

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  137 bits (346), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 145/564 (25%), Positives = 242/564 (42%), Gaps = 150/564 (26%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           MSS ++  D   + L+S+  K    ++ I +F + L  KE      PP F+     Y+FI
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEF-FKLNYKENG----PPVFTVLEWHYVFI 55

Query: 61  QHNDLYILTL---TRSMYANVAQVFSFLHTLVDVLQEYMK--VVEEESIKDNFVIIYELL 115
           + + L+ +T    T     N+  +  +L  L  +L+ Y     ++   + DN ++I EL+
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELI 115

Query: 116 DEVMDSGIPQIT--------------------------DT----KMLRQYITQKS--FKL 143
           DE MD GI Q+T                          DT    K L  YI  K+   KL
Sbjct: 116 DESMDFGIVQLTDPSIIKDYIRVKVNSPITHLTSDDDSDTEEKHKGLSTYIPGKTDIVKL 175

Query: 144 IR-----SAKKKK-------------NVVRPPSSLTT--AVSWRPEGIKYKKNEAFLDVI 183
            +     +A + K             N +    + TT   VSWR +GI Y KNE FLDVI
Sbjct: 176 WKGQPAVTANEGKSNEQDNYDDDDDENFINSYIAKTTIMPVSWRTKGIYYAKNEFFLDVI 235

Query: 184 ESINMMMT-QQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXX 242
           E +  +M    G++ ++ I G++K +  LSGMP LK+ LN                    
Sbjct: 236 EKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALNK------------------- 276

Query: 243 XITRKKSNIELEDLKFHQCVRLSKFE------------NEKIITFIPPDGDFELMSYRLS 290
               K     + + KFHQCV ++  +            + K I FIPPDG+F L  Y L 
Sbjct: 277 --LIKNDEQFISNSKFHQCVSINSLKREINNEEEENTYHGKEIEFIPPDGEFVLCKYELK 334

Query: 291 TPIK--PLIWCDAKIQVH---SRSRVEVHCRAKAQIKAKSTANNVEILIPVP-------- 337
             ++  P+I   + I++     + ++++H   +   K +++ + + I IP+         
Sbjct: 335 RHVRDVPVIKL-SNIEIKPKLKKYKIQIHVTIETHFKKQNSTSVLTIKIPLRMVFSQYKI 393

Query: 338 NDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYS---MAAEMGL------------ 382
           +    P+F+   G + +    + ++W++ S  GG   S   M AE  +            
Sbjct: 394 DLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNNMVAEFFIFNQEEYDRLQEE 453

Query: 383 -------------PSVNDIADYNF------------KRPVQIKFQIPYFTTSGIQVRYLK 417
                        P + +I +               ++ + +KF++PY T SG++V YLK
Sbjct: 454 MKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLTMKFEVPYSTCSGLKVEYLK 513

Query: 418 INEPKLQYNSYPWVRYITQSGEDY 441
           I E ++ Y S+PWVRY T + ++Y
Sbjct: 514 IEENQVNYQSFPWVRYKTINDDEY 537

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  135 bits (340), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 102/338 (30%), Positives = 158/338 (46%), Gaps = 78/338 (23%)

Query: 159 SLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEIL-GKVKVRSRLSGMPDL 217
           + T  VSWR +GI Y KNE FLDV+E +  +   + +V+R  ++ GK+  +S LSGMP L
Sbjct: 231 TTTMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKL 290

Query: 218 KLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIP 277
           K+ LN                     + ++ +   +   KFHQCV L    NEK + FIP
Sbjct: 291 KIALN--------------------KLLQRDAQF-MSHSKFHQCVALETL-NEKELEFIP 328

Query: 278 PDGDFELMSYRL-----STPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEI 332
           PDG+F L  Y L      TPI  +   + K Q+  + ++ +    +   K +++ + + +
Sbjct: 329 PDGEFILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLRILLTIETHFKTRNSTSILNV 387

Query: 333 LIPVPN-------DADSP-KFRYSHGSIKWVPEKNAILWKIKSFPGGK---DYSMAAEMG 381
            IP+         D   P +F+ + G + +    + +LW+I    GG     +SM AE  
Sbjct: 388 KIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFS 447

Query: 382 L-------------------------PSVNDI--ADYNFKRP-----------VQIKFQI 403
           L                         P + ++    ++ K P           V + F+I
Sbjct: 448 LFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEI 507

Query: 404 PYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDY 441
           PY T SG++V YLKI E +LQY S+PWVRY T S E+Y
Sbjct: 508 PYTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEY 545

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  132 bits (333), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 109/457 (23%), Positives = 217/457 (47%), Gaps = 54/457 (11%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           M S I     +G+L++S+ Y+++I  S  E F   +I      NV  P  +     +  I
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVI---NNFNVRSPILTLGSTTFHHI 57

Query: 61  QH-------NDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYE 113
           +        ++L+++ + R+  AN A ++ FL  L  +LQ+Y  +  E  +KD F+ ++E
Sbjct: 58  RSTANDPTDDELWLVCVNRN-NANSAAIWEFLQKLNLILQQY-GITSESKLKDEFMTVHE 115

Query: 114 LLDE-VMDSGIPQITDTKMLRQYITQKSFKLIRSAK-------KKKNVV--RPPSSLTTA 163
           +LD  ++ +GI Q TD K +   ++ K                K++N +   P ++ +  
Sbjct: 116 ILDNMLLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFSLI 175

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLND 223
            + R +   +KKNE F  V ES+N+++++ G +L++ + GK++++S L+G P  +  L D
Sbjct: 176 PTNRHDA--HKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFELVD 233

Query: 224 KGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFE 283
                                       ++ D KF QC+   +    + +     DG+ E
Sbjct: 234 -------------------------DQTKITDFKFDQCIEKVQ---SRTVRVAATDGELE 265

Query: 284 LMSYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSP 343
           +++Y +      + +    I    +  V+     K+      +A +V + IPVP +    
Sbjct: 266 IVNYHVRDDKINIPFKITPIVSTVKDTVDYRISLKSLFPKNLSATDVVLTIPVPPNTIDC 325

Query: 344 KFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRP-VQIKFQ 402
           K   S+G  K+  E+NA++W    F G  + +++A         +   ++ RP +Q+ F+
Sbjct: 326 KINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITIADGRQIMNLESWTRPSIQLTFE 385

Query: 403 IPYFTTSGIQVRYLKI-NEPKLQYNSYPWVRYITQSG 438
           I  ++ SG+ +R L I ++ K +Y +  W++YI+++G
Sbjct: 386 ITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAG 422

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  133 bits (335), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 111/367 (30%), Positives = 162/367 (44%), Gaps = 110/367 (29%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMMMT-QQGQVLRSEILGKVKVRSRLSGMPDLKLGLN 222
           VSWR +GI Y KNE FLDVIE +  ++  + G V RS I G++  RS LSGMP LK+ LN
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 223 DKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFEN------------- 269
                                +   K  I    ++FHQCV L   E              
Sbjct: 309 -------------------KLLQNDKQFI--SQVQFHQCVSLDSIEKVIKYAEEHSDELK 347

Query: 270 ---------EKIITFIPPDGDFELMSYRLSTPIK--PLI-WCDAKIQVH-SRSRVEVHCR 316
                    E  I FIPPDGDF L SY L   I+  P++  C  +I     + ++++   
Sbjct: 348 TLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKKYKLKISAA 407

Query: 317 AKAQIKAKSTANNVEILIPVPN-------DADSP-KFRYSHGSIKWVPEKNAILWKIKSF 368
            +   K  ++ + +++ IP+         D   P KF+ S+G + +    + +LW+I   
Sbjct: 408 VETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLLWEIGVI 467

Query: 369 PGGKDY-------------SMAAEMGL-------------------------PSVNDI-- 388
            GGK +             +MAAE GL                         P + DI  
Sbjct: 468 KGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRTGPKLEDIYK 527

Query: 389 ------ADYNF--KRP------VQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYI 434
                   YN   ++P      + + F+IPY T SG++V YLKI+E +LQY S+PWVRY 
Sbjct: 528 ETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFPWVRYK 587

Query: 435 TQSGEDY 441
           T + ++Y
Sbjct: 588 TINDDEY 594

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 71/141 (50%), Gaps = 10/141 (7%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           MSS IY  D   + L+S+  K    ++ +       + + Q      P       ++++I
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKGLPNVNELGDLFRYHVRQSQN-----PIIDVYNWRFVYI 55

Query: 61  QHNDLYILTLTRSMY---ANVAQVFSFLHTLVDVLQEYM--KVVEEESIKDNFVIIYELL 115
           + + LY + +  +     AN   + ++L  L  + ++Y+  KV++   + DN +++ EL+
Sbjct: 56  KRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELI 115

Query: 116 DEVMDSGIPQITDTKMLRQYI 136
           DE +D GI Q+T+  +++ YI
Sbjct: 116 DETLDYGIVQLTEPSIMKDYI 136

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  130 bits (327), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 99/337 (29%), Positives = 152/337 (45%), Gaps = 80/337 (23%)

Query: 163 AVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEIL-GKVKVRSRLSGMPDLKLGL 221
           +VSWR +GI+Y KNE FLDVIE +   M     +++  ++ G++  +S LSGMP LK+ L
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 222 NDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGD 281
           N K I+                         L   KFHQCV     +  K++ F+PPDGD
Sbjct: 282 N-KIIYQDKQF--------------------LSSCKFHQCVMPDSVDEGKVLEFVPPDGD 320

Query: 282 FELMSYRL-----STPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPV 336
           F L  Y L       P+  LI  + K ++  + ++++    ++  K  ++   + I IP+
Sbjct: 321 FVLCKYELKRHVNDLPLLKLISYEVKPKL-DKYKLKLFVTIESTFKKTNSTTKLNIKIPL 379

Query: 337 P-----NDAD---SPKFRYSHGSIKWVPEKNAILWKIKSFPGGKD-YSMAAEMGL----- 382
                  D D   + K R   G I +    + +LW+I +  GG     M A+  L     
Sbjct: 380 KVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFALFNEEE 439

Query: 383 --------------------PSVNDIADY-------NFKRP-----------VQIKFQIP 404
                               P + ++          NF R            +++ F+IP
Sbjct: 440 YLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIKMDFEIP 499

Query: 405 YFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDY 441
           Y T+SG++V YLKI EP LQY ++PWVRY T S + Y
Sbjct: 500 YNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGY 536

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 71/142 (50%), Gaps = 14/142 (9%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKD----DIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQ 56
           MSS +Y  +   + LLS+  K     DIP+S       L  ++  +  V  P   +    
Sbjct: 1   MSSILYILNEDLESLLSKSIKALESPDIPLS-------LFKKQFHKHQVTTPVIIYEDYI 53

Query: 57  YLFIQHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKV--VEEESIKDNFVIIYEL 114
           +  IQ + LY ++ +     N+ +   +L+    +L+ Y  V  +++  I DN V I EL
Sbjct: 54  FTCIQRDTLYFVS-SIDCKTNILETLHYLNEFYILLKNYFNVKQLDKNIIMDNLVPILEL 112

Query: 115 LDEVMDSGIPQITDTKMLRQYI 136
           ++E +D GI QITD+ +++ YI
Sbjct: 113 IEESVDFGIIQITDSNLMKDYI 134

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  124 bits (311), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 101/357 (28%), Positives = 159/357 (44%), Gaps = 101/357 (28%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEIL-GKVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDVIE +   M  +  V+R  ++ G++  RS LSGMP LK+ +N
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRL---------------SKF 267
                                I ++     L ++KFHQCV L                K 
Sbjct: 310 --------------------KILKQDVQF-LSNVKFHQCVSLDSIRARSNPPAVEEDGKK 348

Query: 268 ENEKI--------ITFIPPDGDFELMSYRLSTPIK--PLIWC---DAKIQVHSRSRVEVH 314
           +NE+         I FIPPDG+F L  Y L   +K  P+I     +   ++H + ++++H
Sbjct: 349 KNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLH-KFKIKIH 407

Query: 315 CRAKAQIKAKSTANNVEILIPVPNDADS--------PKFRYSHGSIKWVPEKNAILWKIK 366
              +   K  ++ + + + IP+ N   S        PKF+   G++ +      +LW++ 
Sbjct: 408 VIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEVG 467

Query: 367 SFPGG---KDYSMAAEMGL-------------------------PSVNDI---------A 389
           +  GG      SM AE  L                         P + ++         +
Sbjct: 468 TMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGDS 527

Query: 390 DYNFKRP-----VQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDY 441
           D    R      + + F++PY T SG+++ YLKI E +LQY S+PWVRY T S ++Y
Sbjct: 528 DEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISDDEY 584

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQ--ESNVIPPCFSHNGV--Q 56
           MSS I+  D   + ++ +       I A+   P L+ + ++   SN + P    N +  Q
Sbjct: 1   MSSSIFILDETLEPIICKN------IRALPNLPSLVTKFQELYRSNGVSPLPILNDIDWQ 54

Query: 57  YLFIQHNDLYILTLTRS-MYANVAQVFSFLHTLVDVLQEYMKV--VEEESIKDNFVIIYE 113
           +L I+ + L  L++  +    N+  VF++L     +L++Y+ V  +    + DNF+++ E
Sbjct: 55  FLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIE 114

Query: 114 LLDEVMDSGIPQITDTKMLRQYITQK 139
           L+DE +D G+ Q TD+ +++ Y+  K
Sbjct: 115 LIDESLDFGVVQFTDSSLIKDYVRVK 140

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  120 bits (300), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 97/366 (26%), Positives = 162/366 (44%), Gaps = 104/366 (28%)

Query: 159 SLTTAVSWRPEGIKYKKNEAFLDVIESINMMMT-QQGQVLRSEILGKVKVRSRLSGMPDL 217
           ++   +SWR +GI Y KNE FLDVIE +  +M  ++G + ++ I G++  RS LSGMP L
Sbjct: 248 TIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKL 307

Query: 218 KLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFE--------- 268
           K+ +N                     I  +     + +  FHQCV L             
Sbjct: 308 KISIN--------------------KILNRDPQF-MSNSNFHQCVSLDSINTIEKGQEKE 346

Query: 269 ----------NEKIITFIPPDGDFELMSYRLSTPIK--PLIWC-DAKIQVH-SRSRVEVH 314
                     + + I F+PPDG+F L  Y L   +K  P+I   D +I+    +S++++ 
Sbjct: 347 QNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQIL 406

Query: 315 CRAKAQIKAKSTANNVEILIPVP--------NDADSPKFRYSHGSIKWVPEKNAILWKIK 366
            + +   K  ++ + + + IP+         + +   +F+ ++G + +    + +LW+I+
Sbjct: 407 TKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQ 466

Query: 367 SFPGGKD----------------YSMAAEMGL-------------------------PSV 385
           +  G ++                 SM AE  L                         P +
Sbjct: 467 TMKGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPKL 526

Query: 386 ----NDIADYNF------KRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYIT 435
               N + D +        R V I F+IPY T SG++V YLK+ EP+LQY S+PWVRY T
Sbjct: 527 EELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKT 586

Query: 436 QSGEDY 441
            + E+Y
Sbjct: 587 VNDEEY 592

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 57/98 (58%), Gaps = 5/98 (5%)

Query: 47  PPCFSHNGVQYLFIQHNDLYILTLTRSM---YANVAQVFSFLHTLVDVLQEY--MKVVEE 101
           PP    N   ++ ++ + L+++++  +      ++  + +FL     +LQ+Y  +KV+ +
Sbjct: 42  PPILFQNDWFFIHLKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSK 101

Query: 102 ESIKDNFVIIYELLDEVMDSGIPQITDTKMLRQYITQK 139
           + I DN +++ EL+DE +D GI Q+TD  +++ YI  K
Sbjct: 102 DLILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  116 bits (291), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 94/366 (25%), Positives = 161/366 (43%), Gaps = 104/366 (28%)

Query: 159 SLTTAVSWRPEGIKYKKNEAFLDVIESINMMMT-QQGQVLRSEILGKVKVRSRLSGMPDL 217
           ++   +SWR +GI Y KNE FLDVIE +  +M  ++G + ++ I G++  R  LSGMP L
Sbjct: 255 TIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKL 314

Query: 218 KLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFE--------- 268
           K+ +N                     I  + +   L +  FHQCV L   +         
Sbjct: 315 KISIN--------------------KILNRDAQF-LSNSSFHQCVSLDSIKTIEKREEKE 353

Query: 269 ----------NEKIITFIPPDGDFELMSYRLSTPIK--PLIWC-DAKIQVH-SRSRVEVH 314
                     + K + F+PPDG+F L  Y L   +K  P+I   D +I+    + ++++ 
Sbjct: 354 DDDTGLQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIE 413

Query: 315 CRAKAQIKAKSTANNVEILIPVP--------NDADSPKFRYSHGSIKWVPEKNAILWKIK 366
            + +   K  ++ + + + IP+         + +   +F+ + G + +    + +LW+I+
Sbjct: 414 TKIQTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQ 473

Query: 367 SFPGGKDY----------------SMAAEMGL--------------PSVN---------- 386
           +  G +++                SM AE  L               S+N          
Sbjct: 474 AMKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRL 533

Query: 387 -----DIADYNF------KRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYIT 435
                 + D          + V I F+IPY T SG+++ YLK+ EP+LQY S+PWVRY T
Sbjct: 534 EELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKT 593

Query: 436 QSGEDY 441
            S ++Y
Sbjct: 594 TSDDEY 599

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 75/144 (52%), Gaps = 10/144 (6%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           MSS ++  D   +LL+S+  +     +       L   K+   +  PP  S N   ++ +
Sbjct: 1   MSSSLFILDENLELLVSKNIR-----ALPSLSSVLSSFKQCYHDEAPPILSQNDWFFIHL 55

Query: 61  QHNDLYILTLTRSM---YANVAQVFSFLHTLVDVLQEY--MKVVEEESIKDNFVIIYELL 115
           + + L+ +++  +      ++  + +FL     +LQEY  +KV+ ++ I DN +++ EL+
Sbjct: 56  KRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTKDVILDNVLLVLELM 115

Query: 116 DEVMDSGIPQITDTKMLRQYITQK 139
           DE +D GI Q+TD  +++ YI  K
Sbjct: 116 DECIDFGIVQVTDPSIIKDYIRVK 139

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  116 bits (290), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 90/352 (25%), Positives = 153/352 (43%), Gaps = 101/352 (28%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEIL-GKVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FL+VIE +   M     V++  ++ G+++ +  LSGMP+LK+ +N
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 DKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFE--NEKIITFIPPDG 280
                                I  +     L + KFHQCV L+  E  + K + F+PPDG
Sbjct: 313 --------------------KIVNEDKQF-LANCKFHQCVSLASLESSDHKDVEFVPPDG 351

Query: 281 DFELMSYRL-----STPIKPLIWCDAK-----IQVHSRSRVEVHCRAKAQIKAKSTANNV 330
           +F L  Y L       P+  L+  + K      ++     +E H       K  +  + +
Sbjct: 352 EFTLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKLKLLLTIETH------FKTTNATSKL 405

Query: 331 EILIPVP--------NDADSPKFRYSHGSIKWVPEKNAILWKIKSFPGG----------- 371
            + +P+         + + + K +   G+I +    + +LW++ S  GG           
Sbjct: 406 ALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLSMGVE 465

Query: 372 ------KDYSMAAEMGLPSVND-----------------------------IADYNFK-- 394
                 ++Y    EM   S+N                              +A++  +  
Sbjct: 466 FALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRLQPR 525

Query: 395 -----RPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDY 441
                + + + F++PY T+SG++V YLKI EP+L+Y S+PWVRY T S  +Y
Sbjct: 526 TREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDAEY 577

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 74/141 (52%), Gaps = 6/141 (4%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
           MSS +Y  D   + L+S+  K    + ++E +P    +K   SN  P    H+   + +I
Sbjct: 1   MSSVLYILDENLETLISKNIK---AVPSLE-YPIAQFKKLYGSNAPPVIDYHDLFTFTYI 56

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYM--KVVEEESIKDNFVIIYELLDEV 118
           Q + L  +++   +   + +   +L    +VL+ Y+  KV+++  + DN V+I EL++E 
Sbjct: 57  QRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNIVTDNSVLISELIEET 116

Query: 119 MDSGIPQITDTKMLRQYITQK 139
           +D G  Q+TD+ +L  YI  K
Sbjct: 117 IDFGAIQVTDSGLLADYIKMK 137

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  111 bits (277), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 97/373 (26%), Positives = 159/373 (42%), Gaps = 117/373 (31%)

Query: 159 SLTTAVSWRPEGIKYKKNEAFLDVIESINMMMT-QQGQVLRSEILGKVKVRSRLSGMPDL 217
           ++   +SWR +GI Y KNE FLDVIE +  +M  ++G + ++ I G++  R  LSGMP L
Sbjct: 247 TIIMPISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKL 306

Query: 218 KLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFE--------- 268
           K+ +N                     + R      + + KFHQCV L             
Sbjct: 307 KISIN-------------------KLLNRDPQF--MSNSKFHQCVSLDSINIIEEEGRDT 345

Query: 269 ---------NEKIITFIPPDGDFELMSYRLSTPIK--PLIWCDAKIQVHS------RSRV 311
                    + K I FIPPDG+F L  Y L   +K  P+I    K+Q         + ++
Sbjct: 346 DDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMI----KLQGFEIKPKLKKFKI 401

Query: 312 EVHCRAKAQIKAKSTANNVEILIPVP--------NDADSPKFRYSHGSIKWVPEKNAILW 363
           ++  + +   K  ++ + + + IP+         + +   +F+ + G + +    + +LW
Sbjct: 402 QIITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLW 461

Query: 364 KIKSFPGGKD---------------YSMAAEMGL--------------PSVN-------- 386
           +I +  G ++                SM AE  L               S+N        
Sbjct: 462 EIGTMKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGP 521

Query: 387 ------------------DIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINEPKLQYNSY 428
                             D+A  +  + V + F+IPY T SG++V YLK+ EP+LQY S+
Sbjct: 522 KLEELYKQVHEERVLHTHDVAPRD--KLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSF 579

Query: 429 PWVRYITQSGEDY 441
           PWVRY T S ++Y
Sbjct: 580 PWVRYKTISDDEY 592

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 74/145 (51%), Gaps = 12/145 (8%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIE-KEQESNVIPPCFSHNGVQYLF 59
           MSS ++  D   + L+S+       I AI     +L   K+      PP  S NG  ++ 
Sbjct: 1   MSSSLFILDEDLEPLVSKN------IRAIPNLSSILSSFKQCYHRDSPPILSQNGWFFIH 54

Query: 60  IQHNDLYILTL---TRSMYANVAQVFSFLHTLVDVLQEY--MKVVEEESIKDNFVIIYEL 114
           ++ + L+ +++   T     ++  + +FL     +L++Y  + V+ +  I DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 115 LDEVMDSGIPQITDTKMLRQYITQK 139
           +DE +D GI Q+TD  +++ YI  K
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYIRVK 139

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score =  100 bits (248), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 136/281 (48%), Gaps = 40/281 (14%)

Query: 114 LLDEVMDSGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTT--AVSWRPEGI 171
           +L  + +  + +I + +     + ++  KL+  A+  +N +    + TT   +SWR +GI
Sbjct: 236 MLQTITNPDVSKILELRKHVNILNKEDMKLV-DAENDENYINSYIAKTTIMPISWRTKGI 294

Query: 172 KYKKNEAFLDVIESINMMMTQQGQVLRSEIL-GKVKVRSRLSGMPDLKLGLNDKGIFTXX 230
            Y KNE FLDV+E    +M  +  ++R  ++ GK+  R  LSGMP LK+ LN        
Sbjct: 295 YYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALNK------- 347

Query: 231 XXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLS 290
                           +K    L  L+FHQCV L   +N K I FIPPDG+F L  Y L 
Sbjct: 348 --------------LLQKDQQFLSQLRFHQCVSLETIQN-KEIEFIPPDGEFILCEYELK 392

Query: 291 TPIKP-----LIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVP---ND--- 339
             +K      LI  + K ++  + +++++       K +++ + + + IP+    ND   
Sbjct: 393 RHVKDPPNIKLISFEIKPKL-KKFKIQINLSITTFFKVQNSTSILNLKIPLEKLFNDYKI 451

Query: 340 --ADSPKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAA 378
               SP+F+ + G +K+    + +LW+I S  GG   ++ A
Sbjct: 452 DLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKA 492

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 34/46 (73%)

Query: 397 VQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYI 442
           + + F+IPY+  SG++V YLKI E +L Y S+PWVRY T + +DY+
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRYKTTNDKDYV 654

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 68/146 (46%), Gaps = 13/146 (8%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYL--LIEKEQESNVIP-PCFSHNGVQY 57
           M S I+  D   + L+S+       I AI  F  +  L  K + +N    P  S N   +
Sbjct: 1   MLSCIFILDENLEPLISKN------IRAIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 58  LFIQHNDLYILTLTR--SMYANVAQVFSFLHTLVDVLQEYMKV--VEEESIKDNFVIIYE 113
           + I+ + L  L         +++  +  +L     +L+ ++K   +    I DN ++I E
Sbjct: 55  IQIKRDSLIFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIME 114

Query: 114 LLDEVMDSGIPQITDTKMLRQYITQK 139
           L+DE +D GI Q+TD  +++ Y+  K
Sbjct: 115 LIDESIDFGIIQMTDPNIIKDYVRVK 140

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 111/259 (42%), Gaps = 64/259 (24%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMMMT-QQGQVLRSEILGKVKVRSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDVIE +   M  ++G + ++ I G++  +  LSGMP LK+ +N
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKF--------------- 267
                                I +  S   L +  FHQCV L                  
Sbjct: 355 --------------------KILQNDSQF-LSNAHFHQCVSLDSLHLQSAEDDDGDDNAN 393

Query: 268 --ENE--------KIITFIPPDGDFELMSYRL-----STPIKPLIWCDAKIQVHSRSRVE 312
             ENE        K I FIPPDGDF L  Y L       P+  L   D K ++ S+ +++
Sbjct: 394 VNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL-SKYKLK 452

Query: 313 VHCRAKAQIKAKSTANNVEILIPVP--------NDADSPKFRYSHGSIKWVPEKNAILWK 364
           +H   +   K  +  + + + IP+         + +   KF+   G + +    N ++W+
Sbjct: 453 IHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWE 512

Query: 365 IKSFPGGKD---YSMAAEM 380
           I S  GG      SM AE 
Sbjct: 513 IGSMKGGHGEVTMSMMAEF 531

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 37/45 (82%)

Query: 397 VQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDY 441
           ++I F+IPY+T SG+++ YLKI EP+LQY S+PWVRY T S E+Y
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEY 668

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 43  SNVIPPCFSHNGVQYLFIQHNDLYILTLTRSMYAN-VAQVFSFLHTLVDVLQEYMKV--V 99
           SN       + G Q+L I+ + L  +++  +   N +  +FS+L     +L+ Y+ V  +
Sbjct: 64  SNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLKSYLNVTKL 123

Query: 100 EEESIKDNFVIIYELLDEVMDSGIPQITDTKMLRQYITQK 139
           ++  + DNF+++ ELLDE +D GI Q TD+ +++ YI  K
Sbjct: 124 DKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYIRVK 163

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 113/250 (45%), Gaps = 54/250 (21%)

Query: 159 SLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEIL-GKVKVRSRLSGMPDL 217
           ++   +SWR +GI Y KNE FLDVIE +  +M  +  V+R  ++ G++  R  LSGMP L
Sbjct: 253 TIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKL 312

Query: 218 KLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFE--------- 268
           K+ +N                     I  +     + +  FHQCV L             
Sbjct: 313 KISIN--------------------KILNRDPQF-MSNSSFHQCVSLDSINTIEKDEEKN 351

Query: 269 -----------NEKIITFIPPDGDFELMSYRLSTPIK--PLIWC-DAKIQVH-SRSRVEV 313
                      + + I FIPPDG+F L  Y L   +K  P++   D +I+    + ++++
Sbjct: 352 SDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQI 411

Query: 314 HCRAKAQIKAKSTANNVEILIPVP--------NDADSPKFRYSHGSIKWVPEKNAILWKI 365
             + +   K  ++ + + + IP+         + +   +F+ + G + +    + +LW+I
Sbjct: 412 VTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEI 471

Query: 366 KSFPGGKDYS 375
           ++  G +++S
Sbjct: 472 QTMKGHREHS 481

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (77%)

Query: 397 VQIKFQIPYFTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDY 441
           V I F+IPY T SG++V YLK+ EP+LQY S+PWVRY T S E+Y
Sbjct: 557 VNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTVSDEEY 601

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 75/145 (51%), Gaps = 12/145 (8%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIE-KEQESNVIPPCFSHNGVQYLF 59
           MSS ++  D   + L+S+       I A+     +L   K+   +  PP  S N   ++ 
Sbjct: 1   MSSSLFILDENLEPLVSKN------IRALPNLSSVLSSFKQCYHDGSPPILSQNDWFFIH 54

Query: 60  IQHNDLYILTLTRSM---YANVAQVFSFLHTLVDVLQEY--MKVVEEESIKDNFVIIYEL 114
           ++ + L+ +++  +      ++  + +FL     +LQ+Y  ++V+ +  I DN +++ EL
Sbjct: 55  LKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLEL 114

Query: 115 LDEVMDSGIPQITDTKMLRQYITQK 139
           +DE +D GI Q+TD  +++ YI  K
Sbjct: 115 IDECIDFGIVQVTDPSIIKDYIRVK 139

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 116/269 (43%), Gaps = 62/269 (23%)

Query: 53  NGVQYLFIQHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYM--KVVEEESIKDNFVI 110
           +G++Y  +Q  ++           N  + F FL T+  +L +Y    V++   I  N+  
Sbjct: 72  DGLRYWCLQRTEI-----GEGSTPNPVEPFVFLQTVDTILNQYFGKDVLKASKITKNYDR 126

Query: 111 IYELLDEVMDSGIPQITDTKMLRQYITQKS-------------FKLIRSAK------KKK 151
           +  L + ++D+G P ITD   L++ +  K+              K I +A+      K  
Sbjct: 127 VTLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGNQMFSKHS 186

Query: 152 NVVRPPSSLTTA-----VSWRPEGIKYKKNEAFLDVIESINMMMTQQGQV-----LRSEI 201
           +  R  SS++ A     V WR  G+KY  NE ++D+ E++N+++ +         +   I
Sbjct: 187 SNSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSI 246

Query: 202 LGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQC 261
            G+V  +  LS  P ++L LN  G                          +L    FH+C
Sbjct: 247 DGEVGFKCYLSENPLVELDLNTNG-------------------------HDLGIPAFHRC 281

Query: 262 VRLSKFE-NEKIITFIPPDGDFELMSYRL 289
           VR    + +   + FIPPDGDF LM Y +
Sbjct: 282 VRTEGSDFHPGTLRFIPPDGDFCLMEYNI 310

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 94/228 (41%), Gaps = 48/228 (21%)

Query: 84  FLHTLVDVLQEYM--KVVEEESIKDNFVIIYELLDEVMDSGIPQITDTKMLRQYITQK-- 139
           FL     VL EY   + +  + + +N   +  LL  ++D+G   +TD+  LRQ +  +  
Sbjct: 41  FLAQYHQVLIEYFDKEALTVKKLVNNADRLALLLHAMLDAGEVAVTDSNRLRQLVPLRND 100

Query: 140 -SFKLIRSAKKKKNVVRPPSS--------------LTTAVSWRPEGIKYKKNEAFLDVIE 184
            S  L  + K   N V+   S                  V WR    +Y  NE ++D++E
Sbjct: 101 LSTILNSATKTLANTVKYADSKQLFGAPVATGKVEAGQTVPWRTADCRYVNNEIYVDLVE 160

Query: 185 SINMMMTQQGQVL---RSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXX 241
           ++N  + Q+G  L      + GK+ V+  LSG P ++L L                    
Sbjct: 161 TVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKL-------------------- 200

Query: 242 XXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRL 289
                + S   L++   H+CV L +      + F+PPDG F L  Y +
Sbjct: 201 -----RTSGHPLDNSALHRCVELGE-AGVATMNFVPPDGRFTLAEYAI 242

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 109/254 (42%), Gaps = 43/254 (16%)

Query: 41  QESNVIPPCFSHNGVQYLFIQHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVE 100
            +SN + P     G     +Q+ D   LT+++ M  N  ++   L+ +VD  +    V +
Sbjct: 76  HQSNPLEPAVFLEGFDNTLLQYFDKDQLTISK-MVNNQDRIALLLNCMVDANEP--AVTD 132

Query: 101 EESIKDNFVIIYELLDEVMDSGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSL 160
              ++D  V   E L +V++S    +++   + Q  T +   +   AK        P++ 
Sbjct: 133 FNHLRD-MVPSREDLSKVINSTASSLSNR--ISQRNTSQVLNIGDPAKG-------PAAK 182

Query: 161 TTAVSWRPEGIKYKKNEAFLDVIESINMMM-----TQQGQVLRSEILGKVKVRSRLSGMP 215
              V WR  G+KY  NE ++DV+E++++++     T +   +R  + G V  RS LSG P
Sbjct: 183 EKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSHLSGNP 242

Query: 216 DLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKIITF 275
            + L L  +G                          +L     HQC   S       + F
Sbjct: 243 VIALNLRLRGH-------------------------DLGMPALHQCCLDSYQGRPDQLRF 277

Query: 276 IPPDGDFELMSYRL 289
           +PPDG F+LM Y +
Sbjct: 278 VPPDGKFQLMHYSI 291

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 90/383 (23%), Positives = 148/383 (38%), Gaps = 61/383 (15%)

Query: 1   MSSGIYFCDAKGKLLLSRRYKDDIP-----ISAIEQFPYLLIEKEQESNVIPPCFSHNGV 55
           M    Y CD K +L+         P     ++ I      +++ E   NV         +
Sbjct: 1   MYIAFYICDTKNQLVFQYLCDSIAPHFSKLLTRIHSLCPEVLDVETRGNVSKDL----KI 56

Query: 56  QYLFIQHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIK--DNFVIIYE 113
              F   N+L    LT     +  +    L ++  +L EY       + K  +N+  +  
Sbjct: 57  YRYFSATNNLNYYALTIVSRHHDLEPHHVLESIDTLLVEYFNKTNLTTTKIMNNYDRMTI 116

Query: 114 LLDEVMDSGIPQITDTKM--LRQYITQKS--FKLIRSAKKKKNVVRPPSSL--TTAVSWR 167
           L D ++D GI    +  M  LR  I  K+     I  A K     + PS       V WR
Sbjct: 117 LFDLLIDGGIIDGNNFYMNKLRNQIPLKNDFSNFINDAAKSLQKGQAPSKTVDNEVVPWR 176

Query: 168 PEGIKYKKNEAFLDVIESINMMMTQQG------QVLRSEILGKVKVRSRLSGMPDLKLGL 221
            + IK  +NE ++DV E++ + + +        ++L   I G V V S + G+P L++  
Sbjct: 177 SKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPMLEVSF 236

Query: 222 NDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDL--KFHQCVRLSKF--ENEKIITFIP 277
                                         + +D+  KFH CV +++F   +  II FIP
Sbjct: 237 ---------------------------GGCDFKDIIPKFHDCVEVNEFLTNDGNIIKFIP 269

Query: 278 PDGDFELMSYR--LSTPIKPLIWCDAKIQV-HSRSRVEVHCRAKAQIKAKSTANNVEILI 334
           PDG F+LM Y   LS+    LI C+    + +S    E+        K     NN+++ +
Sbjct: 270 PDGKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDEFEITLNINKSNKVPK-INNLQVCL 328

Query: 335 PVPNDADSPK---FRYSHGSIKW 354
              N     K    R +HG  ++
Sbjct: 329 NFENREGQSKVKILRNTHGRFEY 351

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 69/146 (47%), Gaps = 41/146 (28%)

Query: 161 TTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQG----------QVLRSEILGKVKVRSR 210
             AV WR   + +  NE +LD++ESI++++  +           +++   I+GK  V+S 
Sbjct: 199 NVAVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSV 258

Query: 211 LSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRL------ 264
           L+G P +++ ++  G                          +LE +  H+CV+       
Sbjct: 259 LNGNPIVEMKIDMAGN-------------------------DLESIFLHECVKSKDVDKD 293

Query: 265 SKFENEKIITFIPPDGDFELMSYRLS 290
            +FEN K+I F+PPDG F+L  Y ++
Sbjct: 294 QEFENTKLIKFLPPDGSFKLFDYNIN 319

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 63/147 (42%), Gaps = 47/147 (31%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLR----------SEILGKVKVRSRLSG 213
           V WR  G+KY  NE ++D+ ESI+++  + G+  R            I G+  V+  LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 214 MP--DLKLGL--NDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFEN 269
            P  DL+L L  ND G+                               FH+CV L   +N
Sbjct: 271 NPTVDLQLDLAGNDLGV-----------------------------PAFHECVELDNHQN 301

Query: 270 EK--IITFIPPDGDFELMSYR--LSTP 292
                + FIPPDG F LM Y   L TP
Sbjct: 302 PSNCDLRFIPPDGRFNLMQYSIDLDTP 328

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 78/170 (45%), Gaps = 47/170 (27%)

Query: 152 NVVRPPSSLT------TAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKV 205
           +V  P SSL       + V WR  GI Y  NE F+D+ E IN ++ ++G++L   I G +
Sbjct: 192 HVGSPGSSLVDHSVDESGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCI 250

Query: 206 KVRSRLSGMP--DLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVR 263
            + + LSG P  ++KLGL D                       K S++   +  FH+C+ 
Sbjct: 251 DLNNHLSGQPLVEMKLGLLD----------------------HKLSHL---NTTFHRCIL 285

Query: 264 LSKFE--NEKI------ITFIPPDGDFELMSYRLSTPIKPLIWCDAKIQV 305
             K    N+ I      +TF+PPDG   L  Y L     PL+  D+ + +
Sbjct: 286 EDKANSINDLIAGKFTKLTFVPPDGRTRLCQYTL-----PLVKRDSNLGI 330

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 60/131 (45%), Gaps = 30/131 (22%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMMM---TQQGQVL--RSEILGKVKVRSRLSGMPDLK 218
           V WR  G+KY  NE ++DV+E+I++++    + GQ++  R  I G V  RS L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPP 278
           L LN  G                          +L     H C +     + + + F+PP
Sbjct: 246 LKLNLHGH-------------------------DLGVPALHPCCQAQYTGSPENLQFVPP 280

Query: 279 DGDFELMSYRL 289
           DG F LM Y +
Sbjct: 281 DGKFRLMQYTI 291

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 102/240 (42%), Gaps = 49/240 (20%)

Query: 79  AQVFSFLHTLVDVLQEYMKV--VEEESIKDNFVIIYELLDEVMDSGIPQIT--DTKMLRQ 134
              F+FL  L   L EY     +    I +N+  I  +    +DSG P +   ++  +R+
Sbjct: 89  TDTFTFLQLLDQTLLEYFDKDKLTVTKIVNNYDRITMIFYMSIDSGEPCVGSLNSNRIRR 148

Query: 135 YITQKS--FKLIR-SAKKKKNVVRPPSSLTTA-----------VSWRPEGIKYKKNEAFL 180
            I  KS   K+I  +A   +  VR P     A           V WR   +KY  +E ++
Sbjct: 149 VIPVKSDLSKMINNTAHTLQRAVRQPRQGILAATPEILESEEVVPWRSGHLKYTSDEIYV 208

Query: 181 DVIESINMMMTQQG-----QVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXX 235
           D+IE+++++          Q++   I G+V V+S LSG P +++ ++  G          
Sbjct: 209 DIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVEMDMDLAG---------- 258

Query: 236 XXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKP 295
                           E+     HQCV + +  +   + FIPPDG+  L++Y +   + P
Sbjct: 259 ---------------NEMYAPSMHQCVEMPQ-GSPSSLCFIPPDGNCNLLNYTIDLDMNP 302

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 68/149 (45%), Gaps = 31/149 (20%)

Query: 163 AVSWRPEGIKYKKNEAFLDVIESINMMMTQQG------------------QVLRSEILGK 204
            V WR   +KY  NE ++DVIE I+++  ++                   +++R++I+G+
Sbjct: 255 VVPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGE 314

Query: 205 VKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRL 264
           + VRS LS  P +++ L D+                      K+ N+ L    FH CV +
Sbjct: 315 LNVRSYLSDNPMVEVTLVDRNYSDQKTGWSENDLF-------KQLNLGLP--MFHDCVEI 365

Query: 265 S--KFENEKI--ITFIPPDGDFELMSYRL 289
              K  N+    I FIPPDG F LM Y +
Sbjct: 366 DYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 85/190 (44%), Gaps = 47/190 (24%)

Query: 123 IPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVS--WRPEGIKYKKNEAFL 180
           +P   D   +     Q   K I+S++ +K + +  S      +  WR + +K+  NE ++
Sbjct: 158 VPMKVDLSKVFTSTAQNIQKAIQSSQAQKPIFQDFSFQENKANAPWRSQNVKHNNNEIYI 217

Query: 181 DVIESINMM----------MTQQGQVLRSEILGKVK----VRSRLSGMPDLKLGLNDKGI 226
           D++ES++++          +T+  Q ++  + G +K    V+S L+G P ++L L     
Sbjct: 218 DLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFLNGNPLVELQL----- 272

Query: 227 FTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKF----ENEKI--ITFIPPDG 280
                               + S  ++    FH+CV + ++    +N  I  + FIPPDG
Sbjct: 273 --------------------ELSGNDIGHPSFHECVDIDEYLKNIDNSSISSLKFIPPDG 312

Query: 281 DFELMSYRLS 290
            F LM Y ++
Sbjct: 313 KFTLMDYTIT 322

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 99/483 (20%), Positives = 173/483 (35%), Gaps = 119/483 (24%)

Query: 33  PYLLIEKEQESNVIPPCFSHNGVQYLFIQHN-DLYILTLTRSMYANVAQVFSFLHTLVDV 91
           P LL+  E +S  +    +    +Y  + +N + Y LT   S+     +V  FL  L ++
Sbjct: 39  PELLLANEMKSRSLGGGSAIMVCKYRSVVNNMNYYCLTSDDSV-----EVDCFLEYLDEL 93

Query: 92  LQEYMKVVEEESIK---DNFVIIYELLDEVMDSG---------------IPQITDTKML- 132
           + EY    +E S+K   +NF  +  LL  V++ G               +P + D + + 
Sbjct: 94  ILEYFDK-DEVSVKKLVNNFDRLSLLLHSVVNGGEINVGFLYNNRIQNVVPPVHDLRKIL 152

Query: 133 ---RQYITQKSFKLIRSAKKKK--NVVRPPSSLTTAVSWRPEGIKYKKNEAFLDVIESIN 187
                 I  +S   +RSA      N           V WR  GIK  K E ++D+ E + 
Sbjct: 153 NETAHTIMNQSSGAMRSAGSGVAFNASSSSRGEDMVVPWRRNGIKDAKEELYVDLKEEVY 212

Query: 188 MMMTQQG---------------QVLRSEILGKVKVRSRLSGMPDLKLGL----NDKGIFT 228
           +   +                 +++   I G + VR  L+G P + L      ND GI +
Sbjct: 213 VTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVRCYLNGNPTVSLMFDTMGNDLGIPS 272

Query: 229 XXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLS-------------KFENEKIITF 275
                                        FH CV                 F+ ++++ F
Sbjct: 273 -----------------------------FHACVEQEDQVQEQKQEQEPESFQGKRLLRF 303

Query: 276 IPPDGDFELMSYRLS----TPIKPLIWCDAKIQVH-------SRSRVEVHCRAKAQIKAK 324
           +PPDG F L  Y +       +   +  D  IQV        ++   EV    +  I   
Sbjct: 304 LPPDGKFRLAQYVIDLDGQGGMSRRMDRDGLIQVSFEDGLGLNKDEFEVRLHVRESIAVV 363

Query: 325 STANNVEILIPVPNDADS--PKFRYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGL 382
               ++ + +   N  DS     R +HG+     E     W+  S     D   A  + +
Sbjct: 364 DPVEDLVVTLQFSNGNDSNVKMLRATHGTFVGQDEDRQCSWRFDS-----DEISAGTLPV 418

Query: 383 --PSVNDIADYNFKR-----PVQIKFQIPYFTTSGIQVRYLKIN--EPKLQYNSYPWVRY 433
               ++D      K+      V +++  P    SG +V  L ++   P+++   +  VR 
Sbjct: 419 LRGCIDDSKHVQQKKRSCLTSVAVRYGYPGELASGCRVTRLDVDVASPRVRGKVFKGVRC 478

Query: 434 ITQ 436
           +T+
Sbjct: 479 VTR 481

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 73/160 (45%), Gaps = 40/160 (25%)

Query: 164 VSWRPEGI-KYKKNEAFLDVIESINMMMTQQGQVLR---SEILGKVKVRSRLSGMPDLKL 219
           V WR     K++ NE ++D++E+ ++++ ++   LR    +I G V VRS L+  P + +
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSV 258

Query: 220 GLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENE---KIITFI 276
            LN  G                          E+     H+CV ++  + E     ITFI
Sbjct: 259 KLNTMGN-------------------------EIGIPSLHECVEIND-DGEFTPSNITFI 292

Query: 277 PPDGDFELMSY--RLSTPIKPLIWCDAKIQVHSRSRVEVH 314
           PPDG F L+ Y   L + +K      + I+++S   + VH
Sbjct: 293 PPDGKFRLLEYSINLDSQLKK-----SGIRMNSIGMISVH 327

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 107/244 (43%), Gaps = 62/244 (25%)

Query: 81  VFSFLHTLVDVLQEYMKVVEEESIK---DNFVIIYELLDEVMDSGIPQITDT-------- 129
            F+ L T+  +L EY    ++ SIK   +N+  I  + +  +++G P ++D         
Sbjct: 89  CFTLLETMDCILLEYFDK-DKLSIKKLVNNYDRISLIFNCCIEAGEPNVSDMLYVNKIKE 147

Query: 130 -----KMLRQYITQKSFKLIRSAKKKKN---------VVRPPSSLTT---AVSWR-PEGI 171
                  L ++I+  +  L ++ +  +          + R  +SL      V WR  +  
Sbjct: 148 AVPERSDLSKFISSTAHNLQQAVQIPQQRQQQLQQNQISRGSTSLVENEEVVPWRTSKAS 207

Query: 172 KYKKNEAFLDVIESINMMMTQQGQVLR---SEILGKVKVRSRLSGMPDLKLGLNDKGIFT 228
           K++ NE ++D++E+ +++   +   LR     I G V VRS L+  P + + LN  G   
Sbjct: 208 KHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSVKLNTMG--- 264

Query: 229 XXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKI---ITFIPPDGDFELM 285
                               ++I +  L  H+CV + K + E +   ITFIPPDG F L+
Sbjct: 265 --------------------NDIGVPTL--HECVEI-KDDGEFLPSNITFIPPDGKFRLL 301

Query: 286 SYRL 289
            Y +
Sbjct: 302 EYSV 305

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 110/252 (43%), Gaps = 69/252 (27%)

Query: 82  FSFLHTLVDVLQEYMKVVEEESIK---DNFVIIYELLDEVMDSGIPQITDT--------- 129
           F+FL T+  +L EY    ++ SIK   +N+  I  + +  +++G P ++D          
Sbjct: 90  FTFLETIDRILLEYFDK-DKLSIKKIVNNYDRISLIFNCCVEAGEPNVSDMLYVNKIKEA 148

Query: 130 ----KMLRQYITQKSFKLIRSAKKKKN---------VVRPPSSLTTA---VSWRPE-GIK 172
                 L ++I+  +  L ++ +  +          + R  +SL      V WR     K
Sbjct: 149 VPERSDLSKFISSTAHNLQQAVQLPQQRQQQLQQNQISRGSNSLIENEEIVPWRTSRASK 208

Query: 173 YKKNEAFLDVIESINMMMTQQGQVLR---SEILGKVKVRSRLSGMPDLKLGLNDKGIFTX 229
           ++ NE ++D++E+ +++  ++   LR     I G V VRS L+  P + + LN  G    
Sbjct: 209 HENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAVKLNTMG---- 264

Query: 230 XXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFENEKI-----ITFIPPDGDFEL 284
                              ++I +  L  H CV +    N+ +     ITFIPPDG F L
Sbjct: 265 -------------------NDIGIPSL--HDCVEI----NDGVFSPSNITFIPPDGKFRL 299

Query: 285 MSYR--LSTPIK 294
           + Y   LS+ +K
Sbjct: 300 LEYSVDLSSQVK 311

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 60/130 (46%), Gaps = 31/130 (23%)

Query: 164 VSWRPE-GIKYKKNEAFLDVIESINMMMTQQGQVLR---SEILGKVKVRSRLSGMPDLKL 219
           V WR     K++ NE +LD++E+ +++  ++   +R     I G + VRS L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKFE--NEKIITFIP 277
            LN  G                       ++I +  L  H+CV ++     +   ITFIP
Sbjct: 259 KLNTMG-----------------------NDIGIPSL--HECVEINDGGVFSPSNITFIP 293

Query: 278 PDGDFELMSY 287
           PDG F L+ Y
Sbjct: 294 PDGKFRLLEY 303

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 61/138 (44%), Gaps = 28/138 (20%)

Query: 166 WR-PEGIKYKKNEAFLDVIESINMMM----TQQGQVLRSEILGKVK-----VRSRLSGMP 215
           WR  + I   +NE + DV E I ++     + +    R +I G+       VR  +SG  
Sbjct: 227 WRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISGSV 286

Query: 216 DLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCV-RLSKFENEKI-- 272
           D++  L    +                 I  K+  +++    FH CV + S  + EKI  
Sbjct: 287 DMRCFLTGNPLV---------------EIALKQGGLDIGIPGFHDCVDKTSLLKQEKISK 331

Query: 273 ITFIPPDGDFELMSYRLS 290
           ++FIPPDG F LM Y ++
Sbjct: 332 LSFIPPDGRFTLMQYNIN 349

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/242 (20%), Positives = 93/242 (38%), Gaps = 61/242 (25%)

Query: 84  FLHTLVDVLQEYMK--VVEEESIKDNFVIIYELLDEVMDSGIPQITDTKMLRQYI----- 136
           FL     +L EY    V+    + +N   +  LL+ ++D+G   ++DT  LR  +     
Sbjct: 84  FLSRFDGLLMEYFDRDVLTATKLMNNQDRLALLLNSIIDAGEIVMSDTNKLRYLLPLHTD 143

Query: 137 -----TQKSFKLIRSAKKKK-----------NVVRPPSSLTTA--------VSWRPEGIK 172
                +  +  L R+ K ++           N+   P+   ++        V WR   + 
Sbjct: 144 LSTVFSSATKTLTRTIKNRESSNFLGSSNSSNINGGPTINRSSDSPLDAQVVPWRIPNLS 203

Query: 173 YKKNEAFLDVIESINMMMTQQG----QVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFT 228
              NE ++D++E++ + + Q       V    I GK+ ++  L G P +++ L+  G   
Sbjct: 204 NVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQINLHSAG--- 260

Query: 229 XXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVR-LSKFENEKIITFIPPDGDFELMSY 287
                                    +    H+C+   S   +   + FIPPDG F L+ Y
Sbjct: 261 ----------------------HAFKPSALHRCLDPSSSSFDSSSLRFIPPDGKFTLLEY 298

Query: 288 RL 289
            +
Sbjct: 299 TI 300

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 65/135 (48%), Gaps = 8/135 (5%)

Query: 11  KGKLLLSRRYKD---DIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFIQHNDLYI 67
           KGK LLSR+++D   D  +  +  F  L+    ++   +        V+Y++   +D YI
Sbjct: 12  KGKPLLSRQFRDITKDRVMELLSNFQTLVANSSKQHTFV----EDEHVRYVYKPFDDYYI 67

Query: 68  LTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMDSGIPQIT 127
           + +T ++++N+ Q    L+  V  +   +K + EE + D+   I    DE++  G  +  
Sbjct: 68  ILIT-NLHSNIIQDMDTLNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDEIITMGYKENL 126

Query: 128 DTKMLRQYITQKSFK 142
               ++ ++  +S +
Sbjct: 127 SLTQIKTFLAMESHE 141

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 151 KNVVRPPSSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSR 210
           KNV R   S+ TA    PE  K   N   + V E+IN  +++ G ++ SE+ G +++R  
Sbjct: 260 KNVERQSLSVQTAT--LPEEEKPINNGILISVKETINAEISRDGAIMGSELKGVLELRVN 317

Query: 211 LSGMPDLKLGL 221
              +   KL L
Sbjct: 318 NPDLAHAKLCL 328

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 37.4 bits (85), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 59/154 (38%), Gaps = 55/154 (35%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESI-----NMMMTQQG-------------------QVLRS 199
           V WR   IK  KNE ++D+ E I     N +  ++G                   +++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 200 EILGKVKVRSRLSGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFH 259
            I G + VRS L+G P +++ LN  G                          ++     H
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLNTCGN-------------------------DMGTPSLH 353

Query: 260 QCVRLS---KFENEKI---ITFIPPDGDFELMSY 287
            CV L      +++K+   + FIPPDG F L  Y
Sbjct: 354 PCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 61/134 (45%), Gaps = 8/134 (5%)

Query: 12  GKLLLSRRYKD---DIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFIQHNDLYIL 68
           GK LLSR++++   D  +  +  F  L+     E   +      N V+Y++   +D YI+
Sbjct: 13  GKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFV----EGNHVRYVYRPFDDYYII 68

Query: 69  TLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMDSGIPQITD 128
            +T    +N+ +  S L+ L   +   +   +E  I D+   I    DEV+  G  +   
Sbjct: 69  LITNRQ-SNIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVIMGYKENLS 127

Query: 129 TKMLRQYITQKSFK 142
           +  +  Y+T +S +
Sbjct: 128 STQVTTYLTMESHE 141

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 58/135 (42%), Gaps = 8/135 (5%)

Query: 11  KGKLLLSRRYKD---DIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFIQHNDLYI 67
            GK LLSR++ D   D  +  +  F  L+ +   E   +        V+YL+   +D Y+
Sbjct: 12  NGKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVEDEH----VRYLYKPFDDYYL 67

Query: 68  LTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMDSGIPQIT 127
           + +T    +N+ Q  S L      +  Y+   +E  I +N   I    DE++  G  +  
Sbjct: 68  IIITNRQ-SNIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDEIIVMGYKENL 126

Query: 128 DTKMLRQYITQKSFK 142
               +  Y+T +S +
Sbjct: 127 TMAQVETYLTMESHE 141

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 39/85 (45%)

Query: 139 KSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLR 198
           +  KL   +K+        S+ T A    PE  K   N   + + E++N  +T+ G +  
Sbjct: 243 RGMKLTGQSKRNIGTSARSSTATRASQQEPEEEKPANNGILISIKETVNAEITRDGAISS 302

Query: 199 SEILGKVKVRSRLSGMPDLKLGLND 223
           SE+ G +++R     +   KL L+D
Sbjct: 303 SELKGVLELRVNDRSLAHAKLTLDD 327

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 60/140 (42%), Gaps = 8/140 (5%)

Query: 4   GIYFCDAKGKLLLSRRYKD---DIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60
            +      GK LLSR+++D   D  +  +  F  L+    +E   +        V+Y++I
Sbjct: 5   AVSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHTFV----EEEHVRYIYI 60

Query: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120
             +D YI+ +T    +N+ Q    L+     +   +K   EE + ++   I    DE++ 
Sbjct: 61  PFDDYYIILITNRQ-SNIIQDMDTLNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDEIIS 119

Query: 121 SGIPQITDTKMLRQYITQKS 140
            G  +      +  +++ +S
Sbjct: 120 LGYKESLSLSQINTFLSMES 139

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 57/143 (39%), Gaps = 41/143 (28%)

Query: 164 VSWRPEGIKYKKNEAFLDVIESINMMM-------TQQG-----QVLRSEILGKVKVRSRL 211
           V WR   +  ++NE ++DV ES+ +++       T +G     Q++   I G V  R  L
Sbjct: 206 VPWRSAKVNSRRNEFYVDVRESVEVVVERAAHRSTSRGTPAPLQLVTGCITGVVDCRCYL 265

Query: 212 SGMPDLKLGLNDKGIFTXXXXXXXXXXXXXXXITRKKSNIELEDLKFHQCVRLSKF---- 267
           S  P +++  N+ G                          +L     H CV L       
Sbjct: 266 SRDPIVEVTFNNHGC-------------------------DLGTPALHDCVELDGVPEGP 300

Query: 268 ENEKIITFIPPDGDFELMSYRLS 290
            +   + FIPPDG F LM Y ++
Sbjct: 301 ADHTTLKFIPPDGKFRLMEYSVT 323

>Smik_4.748 Chr4 complement(1321088..1322590) [1503 bp, 500 aa] {ON}
           YDR470C (REAL)
          Length = 500

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 67/148 (45%), Gaps = 11/148 (7%)

Query: 44  NVIPPCFSHNGVQYLFIQHNDLYILTLTRSMYANVAQVFS-FLHTLVDVLQEY-MKVVEE 101
           +VI   F   G++ L+  +N  +I      +  ++   F+  L + + V   Y M+V+  
Sbjct: 231 DVINALFDQEGIRGLWKANNTTFIYNF---LSLSIDTWFTGLLSSFLGVPDPYFMEVINS 287

Query: 102 ESIKDNFVIIYELLDEVMDSGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPS--S 159
             I  +F++    L   + +GI  +    ++R  +   SFK  +++K K  +  P S   
Sbjct: 288 SDISKSFLLA---LSAGVFTGII-LLPVDLIRTRLIVTSFKRKKNSKAKSKITNPRSLRQ 343

Query: 160 LTTAVSWRPEGIKYKKNEAFLDVIESIN 187
           L    SWR  G+    +   L V++S+N
Sbjct: 344 LIRCWSWRRNGVSIPLDMWCLTVLQSVN 371

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 53/115 (46%), Gaps = 8/115 (6%)

Query: 11  KGKLLLSRRYKD---DIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFIQHNDLYI 67
           +GK LLSR++KD   D  +  +  F  L+ E   +   +        V+Y++   ++ YI
Sbjct: 65  QGKPLLSRQFKDLSKDRVLELLSNFQNLVTEISSDHTFV----EDKHVRYVYRPFDNYYI 120

Query: 68  LTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMDSG 122
           + +T    +N+ +  S L+     +  Y+   +++ I  N   I    DE++  G
Sbjct: 121 ILITNRQ-SNIIKDLSTLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 174

>KNAG0D03000 Chr4 complement(537905..539596) [1692 bp, 563 aa] {ON}
           Anc_3.575 YFR051C
          Length = 563

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 60/134 (44%), Gaps = 7/134 (5%)

Query: 12  GKLLLSRRYKD---DIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFIQHNDLYIL 68
           GK LLSR++KD   D  +  +  F  L +     S           V++++   +D YI+
Sbjct: 13  GKALLSRQFKDLSRDRVLELLSNFSNLALAS---SGTDHTYVEDEHVRFVYKPLDDYYIV 69

Query: 69  TLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMDSGIPQITD 128
            +T +  +N+ +  + L+   + +  Y+  V E+ + DN   I    DE++  G  +   
Sbjct: 70  LVT-NRQSNIIRDLATLNLFAETVGVYVSGVPEDGVFDNAFEILSAFDEIVVMGHKEQLS 128

Query: 129 TKMLRQYITQKSFK 142
              +  Y+  +S +
Sbjct: 129 QTQVNTYLAMESHE 142

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 7/74 (9%)

Query: 150 KKNVVRPPSSLTTAVSWRPEGIKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRS 209
           + NV RP  S        PE IK + N   + + E+IN  +++ G V  +E+ G +++R 
Sbjct: 258 RSNVERPSRS-------EPEEIKPENNGILISIKETINAEISRDGAVRSTELKGVMELRI 310

Query: 210 RLSGMPDLKLGLND 223
               +   K+ L+D
Sbjct: 311 NDESLAHSKVTLSD 324

>KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170C APS1 Small subunit of the clathrin- associated
           adaptor complex AP-1 which is involved in protein
           sorting at the trans-Golgi network homolog of the sigma
           subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 57/136 (41%), Gaps = 17/136 (12%)

Query: 9   DAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFIQHNDLYIL 68
           D+KGK  +SR           E    +L  K +  N++     +   + ++ ++  LY +
Sbjct: 26  DSKGKSKISR-----------ELATMVLARKAKMCNILE----YQDHKVVYKRYASLYFI 70

Query: 69  TLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVM--DSGIPQI 126
               S   N       +H  V+ +  Y   V E  I  NF   YE+L+EV+  D  + + 
Sbjct: 71  CGISSDSDNELLTLEVIHRYVEAMDSYFNNVCELDIIFNFTKAYEILNEVLVCDGSMTET 130

Query: 127 TDTKMLRQYITQKSFK 142
           +   +LR  +T  S +
Sbjct: 131 SKQAILRSVMTMDSLE 146

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 53/115 (46%), Gaps = 8/115 (6%)

Query: 11  KGKLLLSRRYKD---DIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFIQHNDLYI 67
           +GK LLSR++KD   D  +  +  F  L+ E   +   +        V+Y++   ++ YI
Sbjct: 12  QGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFV----EDKHVRYVYRPFDNYYI 67

Query: 68  LTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMDSG 122
           + +T    +N+ +  + L+     +  Y+   +++ I  N   I    DE++  G
Sbjct: 68  ILITNRQ-SNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 121

>TDEL0B06190 Chr2 complement(1094337..1094807) [471 bp, 156 aa] {ON}
           Anc_1.388 YLR170C
          Length = 156

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 6/112 (5%)

Query: 33  PYLLIEKEQESNVIPPCFSHNGVQYLFIQHNDLYILTLTRSMYANVAQVFSFLHTLVDVL 92
           P +L  K +  N++   +S + V Y   ++  LY +      Y N       +H  V+ +
Sbjct: 39  PLVLSRKAKMCNIVE--YSDHKVVYR--RYASLYFICGITPEYDNELLTLELIHRYVETM 94

Query: 93  QEYMKVVEEESIKDNFVIIYELLDEVM--DSGIPQITDTKMLRQYITQKSFK 142
             Y   V E  I  NF   YE+L+E++  D  I +    ++L+Q  T  + +
Sbjct: 95  DSYFGNVCELDIIFNFSRAYEILNEMIMCDGSIAESGKAEVLQQVKTMDTME 146

>KLLA0E06579g Chr5 (594361..596763) [2403 bp, 800 aa] {ON} similar
           to uniprot|Q12028 Saccharomyces cerevisiae YPR029C APL4
           Gamma-adaptin large subunit of the clathrin- associated
           protein (AP) complex
          Length = 800

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 14/102 (13%)

Query: 303 IQVHSRSRVEVHCRAKAQI----------KAKSTANNVEILIPVPNDADSPKFRYSHGSI 352
           I +HS   VEV+ + ++ I          KAK+  N ++ILI VP    S K  +   S 
Sbjct: 699 INIHSSDIVEVYGKVESSIPGCTEIDLFLKAKTNINTLQILIAVPK---SQKAEFGSLSS 755

Query: 353 KWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFK 394
             V         +K    GK   +  ++ + S  D  DY F+
Sbjct: 756 HKVATGEVAKQGLKILGSGK-IKLRVKLNINSTEDQFDYKFE 796

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 53/115 (46%), Gaps = 8/115 (6%)

Query: 11  KGKLLLSRRYKD---DIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFIQHNDLYI 67
           +GK LLSR++KD   D  +  +  F  L+ E   +   +        V+Y++   ++ YI
Sbjct: 12  QGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYRPFDNYYI 67

Query: 68  LTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMDSG 122
           + +T    +N+ +  + L+     +  Y+   +++ I  N   I    DE++  G
Sbjct: 68  ILITNRQ-SNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,913,496
Number of extensions: 1965268
Number of successful extensions: 5691
Number of sequences better than 10.0: 114
Number of HSP's gapped: 5667
Number of HSP's successfully gapped: 185
Length of query: 445
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 332
Effective length of database: 40,524,141
Effective search space: 13454014812
Effective search space used: 13454014812
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)