Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_82052.153ON1141146088e-83
KLLA0F24024g2.153ON122923953e-50
SAKL0E10934g2.153ON1131153832e-48
Suva_15.3132.153ON1321073642e-45
KLTH0B05148g2.153ON1111143535e-44
Skud_8.1772.153ON1301043547e-44
NDAI0B043302.153ON1271113538e-44
Smik_8.1942.153ON1291113531e-43
YHR116W (COX23)2.153ON151943506e-43
ABR130W2.153ON1111023389e-42
CAGL0I02728g2.153ON111953381e-41
KAFR0F007302.153ON1081073381e-41
Kwal_33.147762.153ON111953344e-41
Kpol_505.202.153ON1121143267e-40
TDEL0B051502.153ON1191073268e-40
ZYRO0G06534g2.153ON112953181e-38
KNAG0H035202.153ON109993014e-36
NCAS0B070002.153ON1081022921e-34
TPHA0F018702.153ON180922874e-33
TBLA0B012402.153ON1191152079e-22
NCAS0A092901.302ON90233720.17
Kwal_33.12977singletonOFF21676680.48
Kwal_YGOB_HMa2na 1ON21676680.48
Kpol_1043.715.703ON58546680.66
YIL150C (MCM10)5.703ON57147632.9
Smik_9.195.703ON57247633.4
TPHA0I002708.844ON103969623.6
TDEL0B021705.703ON56763607.3
NCAS0F011205.534ON40048599.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_8205
         (114 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON} ...   238   8e-83
KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} simil...   156   3e-50
SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly ...   152   2e-48
Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W...   144   2e-45
KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar...   140   5e-44
Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W (...   140   7e-44
NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2....   140   8e-44
Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W (...   140   1e-43
YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}  COX23Mitoch...   139   6e-43
ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic hom...   134   9e-42
CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {O...   134   1e-41
KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON...   134   1e-41
Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {O...   133   4e-41
Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON} (55992..56...   130   7e-40
TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON...   130   8e-40
ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {O...   127   1e-38
KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.15...   120   4e-36
NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2....   117   1e-34
TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.15...   115   4e-33
TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON...    84   9e-22
NCAS0A09290 Chr1 (1836064..1838772) [2709 bp, 902 aa] {ON} Anc_1...    32   0.17 
Kwal_33.12977 s33 (23470..24120) [651 bp, 216 aa] {OFF} [contig ...    31   0.48 
Kwal_YGOB_HMa2 s33 (23470..24120) [651 bp, 216 aa] {ON} ANNOTATE...    31   0.48 
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...    31   0.66 
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...    29   2.9  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...    29   3.4  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...    28   3.6  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...    28   7.3  
NCAS0F01120 Chr6 (221963..223165) [1203 bp, 400 aa] {ON} Anc_5.5...    27   9.8  

>Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ABR130W
          Length = 114

 Score =  238 bits (608), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 114/114 (100%), Positives = 114/114 (100%)

Query: 1   MSKEPPKDHIPSQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGA 60
           MSKEPPKDHIPSQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGA
Sbjct: 1   MSKEPPKDHIPSQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGA 60

Query: 61  SMYYDPCEESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           SMYYDPCEESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ
Sbjct: 61  SMYYDPCEESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114

>KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} similar
           to uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 122

 Score =  156 bits (395), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 80/92 (86%)

Query: 23  DKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSFKCLELNN 82
           +KTKVNFTP   D +T++FYPDDPE+TLNR++F  KGAS YYDPC+ESSKMSFKCLELNN
Sbjct: 31  NKTKVNFTPEKTDVNTYKFYPDDPESTLNRYRFAVKGASEYYDPCQESSKMSFKCLELNN 90

Query: 83  YDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           YDR LCHDYFDAYRECKKQWLKARRE    W+
Sbjct: 91  YDRDLCHDYFDAYRECKKQWLKARREKREFWE 122

>SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly
           similar to gnl|GLV|CAGL0I02728g Candida glabrata
           CAGL0I02728g and similar to YHR116W uniprot|P38824
           Saccharomyces cerevisiae YHR116W COX23 Mitochondrial
           intermembrane space protein that functions in
           mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 113

 Score =  152 bits (383), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 94/115 (81%), Gaps = 3/115 (2%)

Query: 1   MSKEPPK-DHIPSQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKG 59
           MS E  K +  P  S P+  + TDK KVNFTP +NDTS+F+FYPD+PE+TLN+F+F +K 
Sbjct: 1   MSNESQKVEPAPENSDPQ--LETDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKD 58

Query: 60  ASMYYDPCEESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
            S Y+DPC+ESSKMSFKCLE+NNYDR +C +YFDAYRECKKQWL++RRE+ S+W+
Sbjct: 59  PSRYFDPCQESSKMSFKCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113

>Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W
           (REAL)
          Length = 132

 Score =  144 bits (364), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 65/107 (60%), Positives = 82/107 (76%)

Query: 8   DHIPSQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPC 67
           +  P   P +   VTD++KVN+ P SND S+FQ+YPDDPE  +N++KF  KG S YYDPC
Sbjct: 26  NSAPPTQPARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYDPC 85

Query: 68  EESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           EESSK+SF+CLE N+YDR+ C DYFDAYRECKKQWL ARR +  +W+
Sbjct: 86  EESSKLSFQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132

>KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar to
           uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 111

 Score =  140 bits (353), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 87/114 (76%), Gaps = 3/114 (2%)

Query: 1   MSKEPPKDHIPSQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGA 60
           M KEP      +  P    +  DKTKV++ P + ++ +F+FYPD+PE++ N+++F +K A
Sbjct: 1   MEKEPKTAPAENADP---QLQVDKTKVDYAPKNTESGSFKFYPDNPESSFNKYRFAAKDA 57

Query: 61  SMYYDPCEESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           S +YDPC+ESSKMS KCLELNNYDRS+C +YFDAYRECKKQWL+ARR + S+W+
Sbjct: 58  SQFYDPCQESSKMSMKCLELNNYDRSMCQEYFDAYRECKKQWLQARRRNRSQWE 111

>Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W
           (REAL)
          Length = 130

 Score =  140 bits (354), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 80/104 (76%)

Query: 11  PSQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEES 70
           P   P     +TD+TKVN+ P +ND S+FQ+YPDDPE  +N++KF  K  S YYDPCEES
Sbjct: 27  PLAEPAPRGPITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEES 86

Query: 71  SKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           SK+SF+CLE N+YDRS C +YFDAYRECKKQWL ARR++  +W+
Sbjct: 87  SKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130

>NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2.153
           YHR116W
          Length = 127

 Score =  140 bits (353), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 81/111 (72%), Gaps = 1/111 (0%)

Query: 5   PPKDHIPSQSPP-KGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMY 63
           P      S++PP K    T K  VNFTP   DTSTF++YPDDPE  +N++KF  K  S Y
Sbjct: 16  PITSQTESRTPPRKEQQNTTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEY 75

Query: 64  YDPCEESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           YDPC+ESS+MSFKCL+ NN+DR  CH+YFDAYRECKKQWL ARR + S+WQ
Sbjct: 76  YDPCQESSQMSFKCLDRNNFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126

>Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W
           (REAL)
          Length = 129

 Score =  140 bits (353), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (76%), Gaps = 3/111 (2%)

Query: 4   EPPKDHIPSQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMY 63
           +P    +P+ S  KG  VTD+TKVN+ P S+D S+FQ+YPDDPE  +N++KF  K  S Y
Sbjct: 22  QPSSSSVPATS--KG-PVTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQY 78

Query: 64  YDPCEESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           YDPCEESSK+SF+CLE N+YDRS C +YFDAYRECKKQWL ARR +  +W+
Sbjct: 79  YDPCEESSKLSFQCLERNDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129

>YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}
           COX23Mitochondrial intermembrane space protein that
           functions in mitochondrial copper homeostasis, essential
           for functional cytochrome oxidase expression; homologous
           to Cox17p; contains twin cysteine-x9-cysteine motifs
          Length = 151

 Score =  139 bits (350), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 62/94 (65%), Positives = 78/94 (82%)

Query: 21  VTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSFKCLEL 80
           VTD+TKVN+ P S+D S+FQ+YPDDPE  +N++KF  K  S YYDPCEESSK+SF+CLE 
Sbjct: 58  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 117

Query: 81  NNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           N+YDRS C +YFDAYRECKKQWL ARR++  +W+
Sbjct: 118 NDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151

>ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR116W
          Length = 111

 Score =  134 bits (338), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 78/102 (76%), Gaps = 1/102 (0%)

Query: 12  SQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESS 71
           S + P  +V TD+  VNFTP S D S+FQFYPD+ E+ L R++  +KG S Y DPC+ES+
Sbjct: 10  STANPDPSVQTDRAAVNFTP-STDASSFQFYPDNLESPLARYRXAAKGPSQYXDPCQESA 68

Query: 72  KMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKW 113
            MS KCLE NNYDR LC +YFDAYRECKKQWL ARR+DNS+W
Sbjct: 69  NMSMKCLERNNYDRDLCREYFDAYRECKKQWLSARRKDNSQW 110

>CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116w
          Length = 111

 Score =  134 bits (338), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 78/95 (82%)

Query: 19  NVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSFKCL 78
           +V TDK KV++ P   DT+ +++YPD+PE+TLN+++F  K  S YYDPC+ES+KMSFKCL
Sbjct: 16  HVQTDKDKVDYAPKGVDTTEYRYYPDNPESTLNKYRFAMKDHSQYYDPCQESAKMSFKCL 75

Query: 79  ELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKW 113
           ELN+YDR  C +YFDAYRECKKQWL+ARR+D + W
Sbjct: 76  ELNDYDRDQCKEYFDAYRECKKQWLEARRKDRTNW 110

>KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON}
           Anc_2.153 YHR116W
          Length = 108

 Score =  134 bits (338), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 67/107 (62%), Positives = 83/107 (77%), Gaps = 7/107 (6%)

Query: 11  PSQSPPKGNVVTDKTKVNFT---PTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPC 67
           P Q P    +VTDKTKVNF    P +N T+ F++YPDDPE+  +R +F +K  + YYDPC
Sbjct: 6   PEQDP---KLVTDKTKVNFVQEDPGTN-TTKFKYYPDDPESAYHRDQFRTKQPTKYYDPC 61

Query: 68  EESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           +ES+++SFKCLELNNYDRSLC DYFDAYRECKKQWL AR+ D SKW+
Sbjct: 62  QESAQLSFKCLELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108

>Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {ON}
           YHR116W - Hypothetical ORF [contig 101] FULL
          Length = 111

 Score =  133 bits (334), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 54/95 (56%), Positives = 78/95 (82%)

Query: 20  VVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSFKCLE 79
           +  DK+K+++ P      +++FYPD+PE++ N+F+F +K  S +YDPC+ESSKMS KCLE
Sbjct: 17  LQVDKSKIDYAPQDAKAGSYKFYPDNPESSFNKFRFAAKDVSQFYDPCQESSKMSMKCLE 76

Query: 80  LNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           LN+YDRS+C +YFDAYRECKKQWL+ARR++ S+W+
Sbjct: 77  LNDYDRSMCQEYFDAYRECKKQWLQARRKNRSQWE 111

>Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON}
           (55992..56330) [339 nt, 113 aa]
          Length = 112

 Score =  130 bits (326), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 84/114 (73%), Gaps = 2/114 (1%)

Query: 1   MSKEPPKDHIPSQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGA 60
           MSKE  KD + S S     + TDK+KV+F    +D    +FYPD+PE+TL +++F +K  
Sbjct: 1   MSKES-KDKLDSPSALDSTLETDKSKVDFA-NKDDKKDLKFYPDNPESTLAKYRFITKET 58

Query: 61  SMYYDPCEESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           S YYDPC+ES++MSF CL+ NNYD+S C  YFDAYRECKKQWL+ARR+D S+W+
Sbjct: 59  SQYYDPCQESAQMSFNCLDRNNYDKSKCRAYFDAYRECKKQWLRARRQDRSQWE 112

>TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score =  130 bits (326), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 77/107 (71%)

Query: 8   DHIPSQSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPC 67
           + I S  P     V D +KV++ P   D S FQ+YP++PE+ +NR  F  KG S YYDPC
Sbjct: 13  EKILSSEPNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPC 72

Query: 68  EESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           +ES++MS  CL+ N+Y++ LC +YFDAYRECKKQWLK+RR+D S+W+
Sbjct: 73  QESAQMSLNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119

>ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116W COX23 Mitochondrial intermembrane space protein
           that functions in mitochondrial
          Length = 112

 Score =  127 bits (318), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 54/95 (56%), Positives = 74/95 (77%)

Query: 20  VVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSFKCLE 79
           +V +  KV++ P  +    FQ+YPD PE++L+R++F  K AS Y+DPC+ESS+MSF CL+
Sbjct: 18  LVVEPKKVDYAPQGDSPDKFQYYPDKPESSLSRYRFAVKDASQYFDPCQESSRMSFNCLD 77

Query: 80  LNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
            NNYDR +C +YFDAYRECKKQWL+ARRE+ S W+
Sbjct: 78  RNNYDREMCKEYFDAYRECKKQWLRARRENRSLWE 112

>KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.153
           YHR116W
          Length = 109

 Score =  120 bits (301), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 72/99 (72%)

Query: 16  PKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSF 75
           P    V+ K  V+F P   +   F+++PD P++  +++KF +KG S +YDPC+ESSKMSF
Sbjct: 11  PAVEGVSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSF 70

Query: 76  KCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
            CLE N+YDRS C  YFDAYRECKKQWLKARR + S+W+
Sbjct: 71  TCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109

>NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2.153
           YHR116W
          Length = 108

 Score =  117 bits (292), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 53/102 (51%), Positives = 71/102 (69%)

Query: 13  QSPPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSK 72
           Q   KGN    K  VNFTP   +  +++++PDDP   LN++KF  KG S YYDPC+E S+
Sbjct: 6   QPEEKGNNSNRKQDVNFTPDEKNPGSYKYFPDDPVQGLNKYKFIMKGDSEYYDPCQECSE 65

Query: 73  MSFKCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114
           MS KCLE N +D+S C +YFDAYR+CKK W+K RRE+  +W+
Sbjct: 66  MSRKCLERNPFDKSQCQEYFDAYRDCKKMWMKTRRENRKQWE 107

>TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.153
           YHR116W
          Length = 180

 Score =  115 bits (287), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 73/92 (79%), Gaps = 2/92 (2%)

Query: 20  VVTDKTKVNFTP--TSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSFKC 77
           +VT+K  V+FT    + + + F+FYPD+PE++  +++F SK +S YYDPC+ES+KMSFKC
Sbjct: 82  LVTNKESVDFTKPDITLNENRFKFYPDNPESSFAKYRFMSKDSSQYYDPCDESAKMSFKC 141

Query: 78  LELNNYDRSLCHDYFDAYRECKKQWLKARRED 109
           L++N+YDR  C  YFDAYRECKKQWL+ARR +
Sbjct: 142 LDMNDYDRDKCRAYFDAYRECKKQWLRARRNN 173

>TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score = 84.3 bits (207), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 71/115 (61%), Gaps = 8/115 (6%)

Query: 1   MSKEPPKDHIPSQSPPK----GNVV-TDKTKVNFTPTS--NDTSTFQFYPDDPEATLNRF 53
           M+ + P    P  +P K    G+VV  D T V+F      N  +TFQ++PD P +T+ RF
Sbjct: 1   MTAKAPTQSSPESNPAKQLENGSVVQNDPTNVSFVHHDPDNHVTTFQYFPDKPTSTMTRF 60

Query: 54  KFYSKGASMYYDPCEESSKMSFKCLELNNYD-RSLCHDYFDAYRECKKQWLKARR 107
            F  K +S +YDPC ES++MS +C+  +  D +++C ++F AYR+CKK W+ A++
Sbjct: 61  NFADKESSKFYDPCHESAQMSVRCMTDHPDDHKTVCAEFFAAYRDCKKAWIDAKK 115

>NCAS0A09290 Chr1 (1836064..1838772) [2709 bp, 902 aa] {ON}
           Anc_1.302 YBR284W
          Length = 902

 Score = 32.3 bits (72), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 59  GASMYYDPCEESSKMSFKCLELNNYDRSLCHDY 91
           G+ MY DP EE+++++   L L N D+   H Y
Sbjct: 87  GSPMYLDPLEETNRINPVILRLQNEDKKAIHHY 119

>Kwal_33.12977 s33 (23470..24120) [651 bp, 216 aa] {OFF} [contig
           123] FULL
          Length = 216

 Score = 30.8 bits (68), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 3/76 (3%)

Query: 24  KTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSFKCLELNNY 83
           KTK N +P+S   + F          + R +F+S+  S+     E  SK++ K   +N  
Sbjct: 56  KTKQNRSPSSKPKNKFILMRSSLHGVIQRLQFFSEAESLKESKVELVSKIASKLWRINKG 115

Query: 84  DRSLCHDY---FDAYR 96
                H+    FD Y+
Sbjct: 116 AFQTYHELLAQFDEYK 131

>Kwal_YGOB_HMa2 s33 (23470..24120) [651 bp, 216 aa] {ON} ANNOTATED
           BY YGOB - This is Kwal_33.12977
          Length = 216

 Score = 30.8 bits (68), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 3/76 (3%)

Query: 24  KTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSFKCLELNNY 83
           KTK N +P+S   + F          + R +F+S+  S+     E  SK++ K   +N  
Sbjct: 56  KTKQNRSPSSKPKNKFILMRSSLHGVIQRLQFFSEAESLKESKVELVSKIASKLWRINKG 115

Query: 84  DRSLCHDY---FDAYR 96
                H+    FD Y+
Sbjct: 116 AFQTYHELLAQFDEYK 131

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score = 30.8 bits (68), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%)

Query: 20  VVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYD 65
           ++T K  + +T +S  T  F+F   D +  L+ F F  KG   YY+
Sbjct: 211 IITSKDDIKYTSSSKPTKYFKFTISDFQHNLDVFIFGVKGVEKYYN 256

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%)

Query: 19  NVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYD 65
            +++ K+ + FT +      F F   D + TL+ + F  KG   YY+
Sbjct: 211 GLISHKSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYN 257

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score = 28.9 bits (63), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 23/47 (48%)

Query: 19  NVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYD 65
            +++ K+ + FT +      F F   D + TL+ + F  KG   YY+
Sbjct: 211 GLISHKSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYN 257

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
           Anc_8.844 YML117W
          Length = 1039

 Score = 28.5 bits (62), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 32/69 (46%)

Query: 45  DPEATLNRFKFYSKGASMYYDPCEESSKMSFKCLELNNYDRSLCHDYFDAYRECKKQWLK 104
           D    + +F  Y    S+Y  P  E+ + S K + L+   RS+C D++++  +   ++  
Sbjct: 239 DLHTFIEKFVNYGLIESVYVVPSYETHQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKT 298

Query: 105 ARREDNSKW 113
               +N K 
Sbjct: 299 QLNSENLKL 307

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score = 27.7 bits (60), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 3/63 (4%)

Query: 5   PPKDHIPSQS--PPKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASM 62
           PPK   P  S   P G +++ K +V F+ +      F+F   D +  L+ + F  KG   
Sbjct: 194 PPKFAEPQYSNWAPIG-IISAKGQVKFSSSGKPMKYFKFTLTDFQYNLDVYVFGKKGVER 252

Query: 63  YYD 65
           YY+
Sbjct: 253 YYN 255

>NCAS0F01120 Chr6 (221963..223165) [1203 bp, 400 aa] {ON}
          Anc_5.534 YDR427W
          Length = 400

 Score = 27.3 bits (59), Expect = 9.8,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 22/48 (45%)

Query: 36 TSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSFKCLELNNY 83
          T T + +  +P + L R + Y    + +YD   +   + F  L L NY
Sbjct: 41 TQTLRKFYHEPASQLLRLRLYDTFIAKFYDKINQLDLVEFLLLSLKNY 88

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,445,546
Number of extensions: 663148
Number of successful extensions: 1644
Number of sequences better than 10.0: 55
Number of HSP's gapped: 1638
Number of HSP's successfully gapped: 55
Length of query: 114
Length of database: 53,481,399
Length adjustment: 84
Effective length of query: 30
Effective length of database: 43,849,455
Effective search space: 1315483650
Effective search space used: 1315483650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)