Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_82042.152ON59759728720.0
ABR131W2.152ON59459622240.0
SAKL0E10956g2.152ON60060519860.0
Kwal_33.147672.152ON59452418960.0
KLTH0B05170g2.152ON59352418810.0
ZYRO0G06512g2.152ON60460618580.0
TDEL0B051402.152ON59959918370.0
Kpol_1048.212.152ON59752417680.0
KLLA0F24046g2.152ON60452517680.0
Smik_14.2072.152ON61756617250.0
YNL121C (TOM70)2.152ON61754417080.0
Skud_14.2112.152ON61754417030.0
TPHA0I015102.152ON60352416980.0
Suva_14.2192.152ON61757316970.0
TBLA0C055302.152ON61052316740.0
NCAS0G024802.152ON59652016410.0
NDAI0F028102.152ON60952415940.0
CAGL0L12936g2.152ON60052615800.0
KAFR0F007202.152ON60852615770.0
KNAG0H035302.152ON61453415650.0
NCAS0B070102.152ON62552915290.0
Skud_8.1782.152ON63853914150.0
YHR117W (TOM71)2.152ON63953814020.0
CAGL0L04048g2.152ON58751813940.0
Suva_15.3142.152ON64453913970.0
Smik_8.1952.152ON63553313900.0
NDAI0B043402.152ON66453513750.0
Ecym_30256.21ON3181131179e-06
Kwal_55.199355.617ON593851171e-05
NCAS0G008105.617ON584861144e-05
Suva_8.805.617ON586851135e-05
AEL224W5.617ON580851119e-05
CAGL0H08195g5.617ON583851101e-04
CAGL0L09823g2.665ON7431441092e-04
NCAS0A112003.367ON9071291092e-04
YBL084C (CDC27)7.412ON7582001082e-04
Smik_15.2055.617ON589851082e-04
ZYRO0A03036g3.265ON8672501082e-04
ACR005W6.21ON3271081053e-04
TPHA0D028805.617ON585851055e-04
YOR027W (STI1)5.617ON589851045e-04
KLLA0B09262g3.367ON9411551046e-04
TBLA0E033005.617ON582851037e-04
Smik_2.367.412ON7512551038e-04
Ecym_55825.617ON584851029e-04
SAKL0G07084g5.617ON585851020.001
KNAG0H006103.367ON9731291020.001
TDEL0A048405.617ON576851010.001
NDAI0I022406.21ON350711000.001
Skud_15.1925.617ON589881010.001
KNAG0F040107.546ON14181241020.001
CAGL0C01903g7.412ON7692301010.001
Kpol_1018.695.617ON590851000.002
AAR083C3.481ON5381821000.002
Suva_2.347.412ON763200990.002
Kpol_1032.86.21ON34395980.002
TPHA0J003406.21ON338100960.004
SAKL0E01210g6.21ON32359960.004
Skud_2.247.412ON769200970.004
TDEL0B076002.665ON752139970.005
Kpol_1037.266.21ON34259950.005
NCAS0A084201.456ON39469950.006
NDAI0F009105.617ON58385940.009
KNAG0B032005.617ON57985940.009
KAFR0B066103.481ON51171930.010
NCAS0E024907.412ON809210940.010
KLTH0E02178g5.617ON59385930.011
KAFR0B002507.546ON142058940.011
SAKL0F16236g7.546ON1408113940.012
NDAI0D008106.21ON34959920.012
KLLA0D01155g6.21ON33547920.013
Kpol_1018.1067.412ON753170930.014
TBLA0A072706.21ON37356920.014
CAGL0D01364g3.367ON1148129930.016
AGL294W7.412ON656147920.016
KNAG0B022407.412ON739204920.016
NDAI0B057903.481ON52360920.017
AGR398W3.5ON105789920.018
KLLA0A07062g5.617ON58185910.019
Ecym_44133.481ON51095910.020
KAFR0H008703.367ON887129910.021
Kwal_56.224336.21ON32259890.024
Smik_2.2958.506ON38589900.025
Kpol_1050.1127.546ON136058910.026
ZYRO0A05676g5.617ON57285900.030
ZYRO0B03828g7.412ON727210900.031
TPHA0M016303.367ON1043129900.033
Skud_15.93.5ON1083126900.034
NDAI0F004005.689ON76449890.040
Ecym_71427.412ON675147890.044
KLTH0C06204g7.412ON627199880.046
TBLA0H015203.367ON689173880.050
Suva_4.3613.367ON963129880.050
KAFR0L004106.21ON33154870.056
Kwal_34.160921.456ON39570870.056
Smik_2.2543.367ON1020121880.058
TDEL0G044806.21ON34359860.066
KAFR0C058905.617ON57585870.067
YBR112C (CYC8)3.367ON96699870.074
Suva_16.5217.546ON142495870.080
Skud_2.2403.367ON98499860.098
ACR168W2.665ON707101860.100
CAGL0B01375g3.5ON111045850.12
YPR189W (SKI3)7.546ON143273850.12
KLTH0F14542g3.481ON513105840.13
Ecym_56372.665ON717101850.13
Kpol_513.28.506ON37452840.13
KAFR0E012603.265ON86996840.14
Kpol_1006.43.367ON732121840.17
TBLA0C015901.456ON40869830.17
NCAS0A153007.546ON1398105840.17
KNAG0A039508.506ON38652830.18
Suva_15.153.5ON110497840.18
TPHA0E007407.412ON746148830.18
NDAI0G048701.456ON39469820.21
Ecym_28207.546ON139897830.22
TBLA0C010102.665ON864157830.23
YBR155W (CNS1)8.506ON38552820.24
Smik_16.4537.546ON141773820.26
CAGL0H07425g8.506ON38053800.36
Kwal_27.118908.506ON334143800.37
Kpol_505.413.481ON51360800.37
KLTH0A00638g7.546ON141197810.43
SAKL0C13772g3.5ON109045800.45
TBLA0G010506.21ON35072790.45
Ecym_13661.456ON39269790.46
Kpol_1020.183.64ON61170800.47
KLTH0H14234g1.456ON39570790.55
TBLA0C039503.481ON51295790.58
Kpol_172.23.367ON41877780.60
Skud_2.2828.506ON38552780.63
YOL145C (CTR9)3.5ON1077173790.64
NCAS0H008306.21ON33859780.66
KAFR0D023405.689ON69744790.68
Kpol_1014.323.5ON1084245790.71
NCAS0F034903.481ON51297780.77
KAFR0E029808.506ON38088770.79
SAKL0D11110g1.456ON432111770.81
NCAS0C043503.5ON1087124780.88
TBLA0D004607.412ON835117780.89
KNAG0M011706.21ON33987770.92
Smik_15.93.5ON107745771.0
NDAI0E040407.412ON783339771.1
TDEL0D036003.265ON879281771.2
CAGL0G10087g7.546ON141147771.2
TDEL0C027207.412ON700189761.2
Skud_16.4937.546ON142573771.2
KLTH0C11220g6.21ON32787751.3
CAGL0D05060g3.481ON51066761.3
KLLA0E01915g3.5ON107345761.5
KNAG0A079003.481ON51298751.5
KLTH0E16258g8.867ON70862751.6
CAGL0E02739g6.21ON34372741.7
Kwal_23.54087.546ON141069751.8
TBLA0H033808.506ON37588741.8
SAKL0F03102g3.481ON51391751.8
Ecym_20073.5ON111369751.9
NCAS0B024008.506ON38052742.1
Suva_4.4058.506ON38538742.1
NDAI0G037103.5ON112145752.2
Kwal_27.107407.412ON628278742.3
YJR032W (CPR7)1.456ON39369732.7
AEL062C1.456ON38368732.8
KLTH0C07458g3.265ON911186732.8
ZYRO0E01254g2.627ON65270733.2
KLTH0C04950g3.296ON624134733.3
NDAI0C052908.506ON37952723.4
KLLA0E20857g7.412ON71052723.7
Suva_12.1141.456ON37069714.1
NDAI0A057603.265ON822212715.4
KLLA0A05258g5.72ON632160715.5
TBLA0B079705.72ON687125715.6
SAKL0E14542g5.689ON69035715.6
AEL281C7.546ON1390107715.6
Suva_7.4083.481ON51360715.6
Skud_15.1686.21ON34844706.2
TPHA0P015903.5ON1077178716.3
KAFR0J02990singletonON47140706.4
CAGL0A03630g1.88ON1062161706.6
TPHA0D032203.481ON51374707.5
KLTH0F18150g5.689ON68943708.0
ACR068W5.267ON1805120708.2
YOR007C (SGT2)6.21ON34644689.0
CAGL0I02288g5.72ON639179699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_8204
         (597 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...  1110   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   861   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   769   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   734   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   729   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   720   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   712   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   685   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   685   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   669   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   662   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   660   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   658   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   658   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   649   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   636   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   618   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   613   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   612   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   607   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   593   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   549   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   544   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   541   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   542   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   540   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   534   0.0  
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    50   9e-06
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    50   1e-05
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    49   4e-05
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    48   5e-05
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    47   9e-05
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    47   1e-04
CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} som...    47   2e-04
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    47   2e-04
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    46   2e-04
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    46   2e-04
ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} simila...    46   2e-04
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    45   3e-04
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    45   5e-04
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    45   5e-04
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    45   6e-04
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    44   7e-04
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    44   8e-04
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    44   9e-04
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    44   0.001
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    44   0.001
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    44   0.001
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    43   0.001
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    44   0.001
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    44   0.001
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    44   0.001
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    43   0.002
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    43   0.002
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    43   0.002
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    42   0.002
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    42   0.004
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    42   0.004
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    42   0.004
TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON} Anc_2...    42   0.005
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    41   0.005
NCAS0A08420 Chr1 complement(1667102..1668286) [1185 bp, 394 aa] ...    41   0.006
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     41   0.009
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    41   0.009
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    40   0.010
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    41   0.010
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    40   0.011
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    41   0.011
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    41   0.012
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    40   0.012
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    40   0.013
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    40   0.014
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    40   0.014
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    40   0.016
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    40   0.016
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    40   0.016
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    40   0.017
AGR398W Chr7 (1459591..1462764) [3174 bp, 1057 aa] {ON} Syntenic...    40   0.018
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    40   0.019
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    40   0.020
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    40   0.021
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    39   0.024
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    39   0.025
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    40   0.026
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    39   0.030
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    39   0.031
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    39   0.033
Skud_15.9 Chr15 complement(14799..18050) [3252 bp, 1083 aa] {ON}...    39   0.034
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    39   0.040
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    39   0.044
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    39   0.046
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    39   0.050
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    39   0.050
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    38   0.056
Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {...    38   0.056
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    39   0.058
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    38   0.066
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    38   0.067
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    38   0.074
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    38   0.080
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    38   0.098
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    38   0.100
CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa] ...    37   0.12 
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    37   0.12 
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    37   0.13 
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    37   0.13 
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    37   0.13 
KAFR0E01260 Chr5 complement(252045..254654) [2610 bp, 869 aa] {O...    37   0.14 
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    37   0.17 
TBLA0C01590 Chr3 complement(370571..371797) [1227 bp, 408 aa] {O...    37   0.17 
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            37   0.17 
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    37   0.18 
Suva_15.15 Chr15 complement(27309..30623) [3315 bp, 1104 aa] {ON...    37   0.18 
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    37   0.18 
NDAI0G04870 Chr7 complement(1173964..1175148) [1185 bp, 394 aa] ...    36   0.21 
Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} simila...    37   0.22 
TBLA0C01010 Chr3 (198773..201367) [2595 bp, 864 aa] {ON} Anc_2.6...    37   0.23 
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    36   0.24 
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    36   0.26 
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    35   0.36 
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    35   0.37 
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    35   0.37 
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    36   0.43 
SAKL0C13772g Chr3 (1211712..1214984) [3273 bp, 1090 aa] {ON} sim...    35   0.45 
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    35   0.45 
Ecym_1366 Chr1 (753035..754213) [1179 bp, 392 aa] {ON} similar t...    35   0.46 
Kpol_1020.18 s1020 complement(38564..40399) [1836 bp, 611 aa] {O...    35   0.47 
KLTH0H14234g Chr8 (1236691..1237878) [1188 bp, 395 aa] {ON} simi...    35   0.55 
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    35   0.58 
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    35   0.60 
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.63 
YOL145C Chr15 complement(49555..52788) [3234 bp, 1077 aa] {ON}  ...    35   0.64 
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    35   0.66 
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    35   0.68 
Kpol_1014.32 s1014 (58546..61800) [3255 bp, 1084 aa] {ON} (58546...    35   0.71 
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    35   0.77 
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    34   0.79 
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    34   0.81 
NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3....    35   0.88 
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    35   0.89 
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    34   0.92 
Smik_15.9 Chr15 complement(17702..20935) [3234 bp, 1077 aa] {ON}...    34   1.0  
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    34   1.1  
TDEL0D03600 Chr4 (661898..664537) [2640 bp, 879 aa] {ON} Anc_3.2...    34   1.2  
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    34   1.2  
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    34   1.2  
Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR18...    34   1.2  
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    33   1.3  
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    34   1.3  
KLLA0E01915g Chr5 complement(180022..183243) [3222 bp, 1073 aa] ...    34   1.5  
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    33   1.5  
KLTH0E16258g Chr5 (1444885..1447011) [2127 bp, 708 aa] {ON} simi...    33   1.6  
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    33   1.7  
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    33   1.8  
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    33   1.8  
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    33   1.8  
Ecym_2007 Chr2 complement(6770..10111) [3342 bp, 1113 aa] {ON} s...    33   1.9  
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    33   2.1  
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    33   2.1  
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    33   2.2  
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    33   2.3  
YJR032W Chr10 (491081..492262) [1182 bp, 393 aa] {ON}  CPR7Pepti...    33   2.7  
AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON} S...    33   2.8  
KLTH0C07458g Chr3 (642381..645116) [2736 bp, 911 aa] {ON} simila...    33   2.8  
ZYRO0E01254g Chr5 complement(90540..92498) [1959 bp, 652 aa] {ON...    33   3.2  
KLTH0C04950g Chr3 (431617..433491) [1875 bp, 624 aa] {ON} conser...    33   3.3  
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    32   3.4  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    32   3.7  
Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032...    32   4.1  
NDAI0A05760 Chr1 complement(1305203..1307671) [2469 bp, 822 aa] ...    32   5.4  
KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} simila...    32   5.5  
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    32   5.6  
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    32   5.6  
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    32   5.6  
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    32   5.6  
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    32   6.2  
TPHA0P01590 Chr16 (328049..331282) [3234 bp, 1077 aa] {ON} Anc_3...    32   6.3  
KAFR0J02990 Chr10 (571614..573029) [1416 bp, 471 aa] {ON}              32   6.4  
CAGL0A03630g Chr1 complement(369404..372592) [3189 bp, 1062 aa] ...    32   6.6  
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    32   7.5  
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    32   8.0  
ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic h...    32   8.2  
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    31   9.0  
CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {...    31   9.6  

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 1110 bits (2872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/597 (91%), Positives = 548/597 (91%)

Query: 1   MSSDNSFAGFISRNKXXXXXXXXXXXXXXXXXXXXXXXXXXVESQGKVGGVNSPSGETRY 60
           MSSDNSFAGFISRNK                          VESQGKVGGVNSPSGETRY
Sbjct: 1   MSSDNSFAGFISRNKTAIIATAAAGASAVGAYYYYQQLQQQVESQGKVGGVNSPSGETRY 60

Query: 61  GXXXXXXXXXXXYPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXX 120
           G           YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECF           
Sbjct: 61  GKKKKKRANKKKYPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKY 120

Query: 121 XSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGN 180
            SCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGN
Sbjct: 121 YSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGN 180

Query: 181 FADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFF 240
           FADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFF
Sbjct: 181 FADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFF 240

Query: 241 GIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSE 300
           GIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSE
Sbjct: 241 GIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSE 300

Query: 301 DPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDE 360
           DPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDE
Sbjct: 301 DPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDE 360

Query: 361 YLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLA 420
           YLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLA
Sbjct: 361 YLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLA 420

Query: 421 YRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGI 480
           YRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGI
Sbjct: 421 YRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGI 480

Query: 481 HVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEA 540
           HVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEA
Sbjct: 481 HVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEA 540

Query: 541 IQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVVS 597
           IQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVVS
Sbjct: 541 IQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVVS 597

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/596 (71%), Positives = 484/596 (81%), Gaps = 3/596 (0%)

Query: 1   MSSDNSFAGFISRNKXXXXXXXXXXXXXXXXXXXXXXXXXXVESQGKVGGVNSPSGETRY 60
           MSS+NSFAGF+SRN+                           +S G+V    + S + + 
Sbjct: 1   MSSENSFAGFVSRNRTAIIATAAAGASAVGAYYYYQQLQ--RQSSGEVSKDATGSTDVK- 57

Query: 61  GXXXXXXXXXXXYPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXX 120
                       YPVD NGEPDLSG+ +FTEEQKE+Y+MA+KDKGNECF           
Sbjct: 58  SKKKKKRNNKKKYPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKF 117

Query: 121 XSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGN 180
             CAL+LK+DPVFYSNRSAC+VPLNKLEKVVEDTTAAL+LKPDYSKCLLRRATANESLGN
Sbjct: 118 YDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGN 177

Query: 181 FADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFF 240
           +ADAMLDLSAVSLYGGY+SQ+IEPVLERNMNKQAMQVLK+KL+ G KH+LPSNTSLASFF
Sbjct: 178 YADAMLDLSAVSLYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHELPSNTSLASFF 237

Query: 241 GIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSE 300
            IFPSETS  NYDE SEAD  LLKGL  L  R+ GSYE++DE F  A +  + +H+A+ +
Sbjct: 238 RIFPSETSLENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPD 297

Query: 301 DPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDE 360
           + AL+ KLAIALEHVGI KFLKNEPLEA+ LLQKA+DL PRPNSYIYM LIMADKGQ DE
Sbjct: 298 NAALKQKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADE 357

Query: 361 YLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLA 420
           Y Q F+KALEL P SSA YYHR QM FV QQF+++GKDFDKAKEC+P  ++PYIQLACLA
Sbjct: 358 YAQNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLA 417

Query: 421 YRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGI 480
           YRE KF+DCETLFSEARR+FPTAPEVPNFYAEILSDKGD E+ALKEY+FARKLEDAQEGI
Sbjct: 418 YREKKFDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGI 477

Query: 481 HVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEA 540
           HVGVAPLVGKA +LARQ  + +FAEAT LFE AC+KDPRSEQAKIGLAQLKLQQE+VDEA
Sbjct: 478 HVGVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEA 537

Query: 541 IQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
           I+LFE A DL+RAFEEKLQATTFAEAAKIQKRIRADP+MSAKIQETL+AYR QG+V
Sbjct: 538 IKLFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/605 (64%), Positives = 451/605 (74%), Gaps = 14/605 (2%)

Query: 1   MSSDNSFAGFISRNKXXXXXXXXXXXXXXXXXXXXXXXXXXVESQGKVGGVNSPSGETR- 59
           MSSDNS A F+SRNK                             Q ++   ++  GE + 
Sbjct: 1   MSSDNSLANFVSRNKTAIIATAAAGVSAAGAYYYYK-----QLQQQRLSSDDASDGEAKP 55

Query: 60  --------YGXXXXXXXXXXXYPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXX 111
                                YPVD NGEP L  +D  T+EQKE+Y+M +KDKGNE F  
Sbjct: 56  LKKKKKSKKKKPTSGSPTASAYPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKE 115

Query: 112 XXXXXXXXXXSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRR 171
                     + AL LKKDPVFYSNRSAC+V + +LEKVVEDTTAAL+LK DYSKCLLRR
Sbjct: 116 KKFDDAIKYYNLALELKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRR 175

Query: 172 ATANESLGNFADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLP 231
           A+ANESLGN+ADAM DLSA+SLYG +N  SIEP+LERNMNKQAM VLK KL +   H+LP
Sbjct: 176 ASANESLGNYADAMFDLSALSLYGDFNGASIEPMLERNMNKQAMLVLKEKLEEKKDHRLP 235

Query: 232 SNTSLASFFGIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLL 291
           SNTSLASFFGIF  ETSF NYDE  EAD  LL+GL  L +R +  Y+ +DE F KAA   
Sbjct: 236 SNTSLASFFGIFEPETSFENYDESVEADRLLLQGLTNLYKRTSEGYDTADESFTKAAAAY 295

Query: 292 SLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALI 351
               +   E+  L+ K AIALEHVGIFKFLKN+PL A+  L++A++ HPR NSYIY+ALI
Sbjct: 296 KTLLEESPENEILKQKAAIALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALI 355

Query: 352 MADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIF 411
           MADKGQ  EY + FDKALEL PN +AVYYHRGQMYF+TQQ+E +GKDFDKAKECN +NIF
Sbjct: 356 MADKGQATEYFENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIF 415

Query: 412 PYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFAR 471
           PYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDL +A K+YE AR
Sbjct: 416 PYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIAR 475

Query: 472 KLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLK 531
           KLEDA +GIHVG+APLVGKAT+LAR+    +F EAT  FEEAC+KDPRSEQAKIGLAQLK
Sbjct: 476 KLEDALDGIHVGIAPLVGKATLLAREPTVENFVEATQNFEEACEKDPRSEQAKIGLAQLK 535

Query: 532 LQQEQVDEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYR 591
           LQQE+VDEAI LFEEA DLAR+F+EKLQATTFAEA KIQK+IRADPI+SAKI+ETL AYR
Sbjct: 536 LQQEEVDEAITLFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYR 595

Query: 592 VQGVV 596
            QG++
Sbjct: 596 AQGMI 600

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/524 (68%), Positives = 422/524 (80%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           +PVD  GEPDL  VD  + E+K++++M +KDKGNE F            S A+ +K+DPV
Sbjct: 71  FPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEVKEDPV 130

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           FYSNRSAC+V L + EKVVEDTTAAL+LKPDYSKCLLRRA+ANESLG FADAM DLSAVS
Sbjct: 131 FYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSAVS 190

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFFGIFPSETSFANY 252
           LYG +N  SIEP+LERNMNKQAM VLK KL    +++LPSNTSLASFFGIF  ETSF NY
Sbjct: 191 LYGDFNGSSIEPLLERNMNKQAMLVLKEKLEKQQEYKLPSNTSLASFFGIFQPETSFENY 250

Query: 253 DEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIAL 312
           DE SEAD  LL GL  L +R +G YE +D  F+KA D      + +SED +L+ K AIAL
Sbjct: 251 DENSEADKALLDGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSEDASLKQKAAIAL 310

Query: 313 EHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELA 372
           EHVGIFKFLKN+P+ A++ L+KAV+  PRPN+YIYMALIMADKGQ  EY   F+KALEL 
Sbjct: 311 EHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALELD 370

Query: 373 PNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETL 432
           PN +AVYYHRGQM+F+TQQFE++GKDF+KAKE N  NIFPYIQLACL YRE KF D ETL
Sbjct: 371 PNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSETL 430

Query: 433 FSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKAT 492
           FSEARRKFPT+PEVPNFYAE LSDKGD+  A KEY+ A KLE A +GIHVGV+PL+GKAT
Sbjct: 431 FSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESALDGIHVGVSPLIGKAT 490

Query: 493 VLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLAR 552
           +L+R+    +F EAT LFE+AC+ DPRSEQAKIGLAQLKLQQE +DEAI LFEEA DLAR
Sbjct: 491 LLSREPSVENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADLAR 550

Query: 553 AFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
           +F+EKLQATTFAEA KIQK+IRADPI+SAKI+ETL AYR QG++
Sbjct: 551 SFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQGMI 594

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/524 (67%), Positives = 424/524 (80%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           YPV+  GEPDLS +   ++EQK++Y+M +KDKGNE F            S A+ +K+DPV
Sbjct: 70  YPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKEDPV 129

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           FYSNRSAC+V L + EKVVEDTTAAL+LKPDYSKCLLRRA+ANESLGNFADAM DLSAVS
Sbjct: 130 FYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSAVS 189

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFFGIFPSETSFANY 252
           LYG ++  SIEP+LERNMNKQ+M VLK KL    +++LPSNTSLASFFGIF  ET+F NY
Sbjct: 190 LYGDFSGASIEPLLERNMNKQSMLVLKEKLEKQQEYKLPSNTSLASFFGIFQPETTFENY 249

Query: 253 DEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIAL 312
           D+ SEAD +LL+GL  L +R    YE +D  F KA D   +  + + ED  L+ K AIAL
Sbjct: 250 DDNSEADKYLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDADLKRKAAIAL 309

Query: 313 EHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELA 372
           EHVGIFKFLKN+P+ A++ L+KAV+  PRPN+YIYMALIMADKGQ  EY   F+KAL+L 
Sbjct: 310 EHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALKLD 369

Query: 373 PNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETL 432
           P+ +AVYYHRGQMYF+TQQFE++GKDF+KAKE +  NIFPYIQLACL YRE KF+D ETL
Sbjct: 370 PSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREGKFDDSETL 429

Query: 433 FSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKAT 492
           FSEARRKFPTAPEVPNFYAE LSDKGDL  A K+Y+ A KLEDA +GIHVGV+PL+GKAT
Sbjct: 430 FSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHVGVSPLIGKAT 489

Query: 493 VLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLAR 552
           +L+R+    +F EAT LFE+AC+ DPRSEQAKIGLAQLKLQQE +DEAI LFEEA DLAR
Sbjct: 490 LLSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADLAR 549

Query: 553 AFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
           +F+EKLQATTFAEA KIQK+IRADP++SAKI+ETL AYR QG++
Sbjct: 550 SFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGMI 593

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/606 (60%), Positives = 441/606 (72%), Gaps = 12/606 (1%)

Query: 1   MSSDNSFAGFISRNKXXXXXXXXXXXXXXXXXXXXXXXXXXVESQGKVGGVNSPSGET-- 58
           MSSDNS AGFISRNK                            S  K G   SP G    
Sbjct: 1   MSSDNSVAGFISRNKTAIITTAAAGTAAVGAYLYYRQLQDAAGSDDKKG--ESPDGTAAS 58

Query: 59  --------RYGXXXXXXXXXXXYPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFX 110
                   +             YPVD  GEP L  V   +EEQKE +S A+KDKGNE F 
Sbjct: 59  KKKRKNKKKKQGSSPSPSAAVSYPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFK 118

Query: 111 XXXXXXXXXXXSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLR 170
                        AL LKKDPVFYSN SAC+V +N+L+KVVE++T ALELKPDYSK LLR
Sbjct: 119 QKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLR 178

Query: 171 RATANESLGNFADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQL 230
           RA+ANESL N+ DAM DLS +SL G +   SIEP+LERN+NKQAM VLK KL       L
Sbjct: 179 RASANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKNQLL 238

Query: 231 PSNTSLASFFGIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADL 290
           PS+T+LASFFGIF  ET FANYDE SEAD  L  GL  L +R +  Y+ +DE+F++A D 
Sbjct: 239 PSDTALASFFGIFTPETEFANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDA 298

Query: 291 LSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMAL 350
            +   + +S+D AL+ K AIALEH GIF+FLKN+PL A++ +QKA+DLHPR NSYIYMAL
Sbjct: 299 YAKLREGNSDDAALKEKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMAL 358

Query: 351 IMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNI 410
           IMADKG+ +EY ++FDKA++L P ++AVYYHRGQMYF+T Q+EK+G+DFDKAK+ N +NI
Sbjct: 359 IMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENI 418

Query: 411 FPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFA 470
           FPYIQLACLAYRENKF+DCETLFSEA+RKF TAPEVPNF+AEIL+DKGDLE ALK+Y+ A
Sbjct: 419 FPYIQLACLAYRENKFDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIA 478

Query: 471 RKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQL 530
           ++LE+A +GIHVG++PLVGKAT+LARQ    +F EAT L EEAC KDPRSEQ K+GLAQL
Sbjct: 479 KRLEEAVDGIHVGISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQL 538

Query: 531 KLQQEQVDEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAY 590
           KLQQE +D+AI+LFEEA  LAR  +EKLQATTFAEAAK+QKRIRADP++SAKI+ETL AY
Sbjct: 539 KLQQEDIDDAIKLFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAY 598

Query: 591 RVQGVV 596
           + QGV+
Sbjct: 599 KAQGVI 604

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/599 (60%), Positives = 439/599 (73%), Gaps = 3/599 (0%)

Query: 1   MSSDNSFAGFISRNKXXXXXXXXXXXXXXXXXXXXXXXXXXV---ESQGKVGGVNSPSGE 57
           MSSDNS + F+SRNK                              + +G  G  +S   +
Sbjct: 1   MSSDNSVSSFVSRNKTAIIATAAAGSAAIGAYYYYRQAQRAALDEDEKGAEGSESSKKKK 60

Query: 58  TRYGXXXXXXXXXXXYPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXX 117
                          YPV  NGEP L  ++  ++E +E Y+ A+KD+GNE F        
Sbjct: 61  KNKKKKSGENGGTPVYPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNA 120

Query: 118 XXXXSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANES 177
               + AL +KKDPVFYSN SAC+V L +L+KVVE++T ALELKPDYSK LLRRA+ANES
Sbjct: 121 LKYYNYALVVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANES 180

Query: 178 LGNFADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLA 237
           L N+ADAM DLS +SL G +N  SIEP+LERN+NKQAM VLK KL +    QLPSNT+LA
Sbjct: 181 LENYADAMFDLSVLSLNGDFNGSSIEPMLERNLNKQAMFVLKDKLGNNVSQQLPSNTALA 240

Query: 238 SFFGIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQA 297
           SFFGIFP ET+FANY+E  EAD  L  GL  L +R +  Y+++DE F K+A   +     
Sbjct: 241 SFFGIFPPETTFANYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASFFTNKLSE 300

Query: 298 DSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQ 357
             +D  L+ K AIALEH GIFKFLKN+PLEA+  ++KA+ LHPR NSYIYMALIMADKGQ
Sbjct: 301 FPDDAVLKEKTAIALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQ 360

Query: 358 TDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLA 417
            +EY QYFDKA+ L PN    YYHRGQMY++T Q+EK+GKDFDKAKEC+ +NIFPYIQLA
Sbjct: 361 AEEYYQYFDKAIALDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLA 420

Query: 418 CLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQ 477
           CLAYRE+KF+DCETLFSEA+RKFPTAPEVPNFYAEIL DKGDLE+ALK+YE A++LE+A 
Sbjct: 421 CLAYREDKFDDCETLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLEEAL 480

Query: 478 EGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQV 537
           +GIHVGVAPLVGKAT+LARQ    +F EAT L EEAC++DP SEQAK+GLAQLKLQQE+V
Sbjct: 481 DGIHVGVAPLVGKATLLARQPSVENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEV 540

Query: 538 DEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
           DEAI LFEEA +LAR  +EKLQATTFAEAAK+QKRI+ADP++SAKI+ETL AYR QG++
Sbjct: 541 DEAINLFEEAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGMM 599

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/524 (63%), Positives = 418/524 (79%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           YP+DSNGEPDL    +FTEEQKE YS+A+KDKGN+ F            + AL LK+DPV
Sbjct: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPV 133

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           FYSN SAC+V L  LEKVVE +T ALELKPDYSK LLRRA+ANE+L NFA+AM DLS +S
Sbjct: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFFGIFPSETSFANY 252
           L G +N  SIEP+LERN+NKQAM+VLK K++  +K QLPSNT LASFFGIF  ET+  N+
Sbjct: 194 LNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQLPSNTFLASFFGIFTPETTLKNF 253

Query: 253 DEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIAL 312
           DE +EAD  LL  L  L +RK+ SY ++DE F+KAA+      +A+ +D  L+ K A AL
Sbjct: 254 DESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTATAL 313

Query: 313 EHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELA 372
           E+ GIFKFLKN+PL +++ +Q++++LHPR N+YIY ALIMADKG++  Y  +FDKAL++ 
Sbjct: 314 EYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALDVD 373

Query: 373 PNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETL 432
           PNS+ VYYHRGQM+F++QQ+EK+  DF+KAKE +  NIFPYIQLACL Y E KF+DCETL
Sbjct: 374 PNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGKFDDCETL 433

Query: 433 FSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKAT 492
           FSEA+RKFPTAPEVPNFYAE+L+DKGD ++A K+Y+ A++LE++ + IHVGV+PLVGKAT
Sbjct: 434 FSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGKAT 493

Query: 493 VLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLAR 552
           +LARQ    +  E+T L EEACK D RSEQAKIGLAQLKLQQE++DEAI LFEEA+DLAR
Sbjct: 494 LLARQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDLAR 553

Query: 553 AFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
             EEKLQATTFAEA+K+QK+IRADP+++AKIQ TL AYR QG++
Sbjct: 554 NMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/525 (63%), Positives = 418/525 (79%), Gaps = 2/525 (0%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           YPVD+NG+PDLS  D FT EQ ++Y++A+KDKGNE F            + A+ LK+DPV
Sbjct: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           FYSNRSA +V +N  EKVVEDTTAAL+LKPDYSKC LRRA+A E+LG F+DAM DLSAVS
Sbjct: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLAD--GSKHQLPSNTSLASFFGIFPSETSFA 250
           L G Y+ QS+E +LERNMNKQA +VL  KL +  G +  LPSNTSLASFFGIF  ETSF 
Sbjct: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFD 258

Query: 251 NYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAI 310
           +YD ++EAD  L KGL  L + +TG YE++DE F KAA+L     ++  ++ +L+ K AI
Sbjct: 259 DYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318

Query: 311 ALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALE 370
           A EHVGIFKF KN+P+ A+  L++++ L+PRP++YIYMALIMADKG+ ++Y +YFDKALE
Sbjct: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378

Query: 371 LAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCE 430
           L PN SAVYYHRGQM+FV + F+++G DFDKAKE NP+NIF YIQ ACLA+R+++F+DCE
Sbjct: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438

Query: 431 TLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGK 490
           TLFSEARRKFPTAPEVPNFYAEIL+ K  L++A+K+Y+ A KLEDA  GIHVG+AP++GK
Sbjct: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498

Query: 491 ATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
           AT L R     +F EA+ LFEEACK DPRSEQAKIGLAQLKLQQE++D+AIQLFE+A DL
Sbjct: 499 ATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558

Query: 551 ARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGV 595
           +R+F+EKLQATTFAEA K+QK+IRADP +  KI E + AYR QG+
Sbjct: 559 SRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/566 (59%), Positives = 408/566 (72%), Gaps = 20/566 (3%)

Query: 51  VNSPSGETRYGXXXXXXXXXXXYPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFX 110
           V     +T+ G           YPV SNG+PD S   +FT E+K+RY++A+KDKGN+ F 
Sbjct: 52  VKGSQKKTKDGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFR 111

Query: 111 XXXXXXXXXXXSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLR 170
                      + AL LK DPVFYSN SAC+V +  L+KVVE +T ALELKPDYSK LLR
Sbjct: 112 NKKYDDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLR 171

Query: 171 RATANESLGNFADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLAD------ 224
           RA+ANE LGNFADAM DLS +SL G +N  SIEP+LERN+NKQAM  LK K  D      
Sbjct: 172 RASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATA 231

Query: 225 --------------GSKHQLPSNTSLASFFGIFPSETSFANYDEQSEADNFLLKGLRCLS 270
                              LPS TS+ASFFGIF  E +FANYDE +EAD  L+ GL  L 
Sbjct: 232 TPTELSTQAPKELKDKTENLPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLY 291

Query: 271 ERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYK 330
           +R   SY+ +DE F KA  L       ++ED   + KLAI+LEH GIFKFLKN+PL A++
Sbjct: 292 KRSPESYDKADESFTKAVKLFDEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHE 351

Query: 331 LLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQ 390
            ++KA++L PR NSYIYMALIMAD+  + EY  YFDKAL+L  N+S+VYYHRGQM F+ Q
Sbjct: 352 DIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQ 411

Query: 391 QFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFY 450
            ++++GKDFDKAKE +P+NIFPYIQLACLAYRENKF+DCETLFSEA+RKFP APEVPNF+
Sbjct: 412 NYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFF 471

Query: 451 AEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALF 510
           AEIL+DK D E ALK+Y+ A +LE+  +GI+VG+APLVGKAT+L R     +F EAT L 
Sbjct: 472 AEILTDKNDFEKALKQYDLAIELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLL 531

Query: 511 EEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLARAFEEKLQATTFAEAAKIQ 570
           EEA K DPRSEQAKIGLAQ+KLQQE +DEAI LFEE+ DLAR  EEKLQA TFAEAAK+Q
Sbjct: 532 EEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQ 591

Query: 571 KRIRADPIMSAKIQETLEAYRVQGVV 596
           KRIR+DPI++AKIQETL   R QG++
Sbjct: 592 KRIRSDPILAAKIQETLAKLREQGLM 617

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/544 (60%), Positives = 405/544 (74%), Gaps = 20/544 (3%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           YPV SNGEPD S   +FT E+K++Y++A+KDKGN+ F            + AL LK+DPV
Sbjct: 74  YPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPV 133

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           FYSN SAC+V +  L+KVVE +T ALELKPDYSK LLRRA+ANE LG FADAM DLS +S
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLS 193

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLAD--------------------GSKHQLPS 232
           L G +N  SIEP+LERN+NKQAM  LK K  D                      +  LPS
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLPS 253

Query: 233 NTSLASFFGIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLS 292
            TS+ASFFGIF  E +FANYDE +EAD  L+ GL  L +R   SY+ +DE F KAA L  
Sbjct: 254 VTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLFE 313

Query: 293 LSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIM 352
                ++ED  L+ KLAI+LEH GIFKFLKN+PL A++ ++KA++L PR NSYIYMALIM
Sbjct: 314 EQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373

Query: 353 ADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFP 412
           AD+  + EY  YFDKAL+L  N+S+VYYHRGQM F+ Q ++++GKDFDKAKE +P+NIFP
Sbjct: 374 ADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433

Query: 413 YIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARK 472
           YIQLACLAYRENKF+DCETLFSEA+RKFP APEVPNF+AEIL+DK D + ALK+Y+ A +
Sbjct: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493

Query: 473 LEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKL 532
           LE+  +GI+VG+APLVGKAT+L R     +F EAT L E+A K DPRSEQAKIGLAQ+KL
Sbjct: 494 LENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKL 553

Query: 533 QQEQVDEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRV 592
           QQE +DEAI LFEE+ DLAR  EEKLQA TFAEAAK+Q+RIR+DP+++ KIQETL   R 
Sbjct: 554 QQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKLRE 613

Query: 593 QGVV 596
           QG++
Sbjct: 614 QGLM 617

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/544 (60%), Positives = 406/544 (74%), Gaps = 20/544 (3%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           YPV SNGEPD S   +FT E+K++Y++A+KDKGN+ F            + AL LK+DPV
Sbjct: 74  YPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDPV 133

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           FYSN SAC+V +  L+KVVE +T ALE+KPDYSK LLRRA+ANE LGNFADAM DLS +S
Sbjct: 134 FYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVLS 193

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLAD--------------------GSKHQLPS 232
           L G +N  SIEP+LERN+NKQAM  LK K  D                      +  LPS
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLPS 253

Query: 233 NTSLASFFGIFPSETSFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLS 292
            TS+ASFFGIF  E +FANYDE ++AD  L+ GL  L +R   SY+ +DE F KAA L  
Sbjct: 254 ITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLFE 313

Query: 293 LSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIM 352
                 +ED  L+ KLAI+LEH GIFKFLKN+PL A++ ++KA++L PR NSYIYMALIM
Sbjct: 314 EQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIM 373

Query: 353 ADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFP 412
           AD+  + EY  YFDKAL+L PN+S+VYYHRGQM F+ Q ++++GKDFDKAKE +P+NIFP
Sbjct: 374 ADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFP 433

Query: 413 YIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARK 472
           YIQLACLAYRENKF+DCETLFSEA+RKFP APEVPNF+AEIL+DK D + ALK+Y+ A +
Sbjct: 434 YIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIE 493

Query: 473 LEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKL 532
           LE+  + I+VG+APLVGKAT+L R     +F EAT L E+A K DPRSEQAKIGLAQ+KL
Sbjct: 494 LENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMKL 553

Query: 533 QQEQVDEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRV 592
           QQE +DEAI LFEE+ DLAR  EEKLQA TFAEAAK+Q++IR+DPI++AKIQETL   R 
Sbjct: 554 QQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLRE 613

Query: 593 QGVV 596
           QG++
Sbjct: 614 QGLM 617

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/524 (61%), Positives = 409/524 (78%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           YPV SNGEPDLSG DSF++E KE+Y+MA+KDKGN+ F            + AL LK+DPV
Sbjct: 80  YPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTLKQDPV 139

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           FYSN SAC+V L +LEKVVE +T AL+LK DYSK LLRRA+A ESL N+ DAM+DLS +S
Sbjct: 140 FYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAMVDLSVLS 199

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFFGIFPSETSFANY 252
           L G +N  SIEP+LERN+NKQAMQVLK K+A+     LPSNTSLASFFG+F  E S  N+
Sbjct: 200 LNGDFNGASIEPMLERNLNKQAMQVLKEKIAENKPQLLPSNTSLASFFGVFKPEVSLNNF 259

Query: 253 DEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIAL 312
           +E SE++  LL GL  L  R    Y ++DE F KA  LL   ++ + E+  ++ K AIAL
Sbjct: 260 NENSESEKELLNGLTNLYSRTNDGYLVADESFQKAVKLLEKEYEENKENNDIKEKYAIAL 319

Query: 313 EHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELA 372
           E+ GI KFLKN+PL+A+  +QKA+ + PR NSYIY +LI+ADKG+T+E ++ FD A+ L 
Sbjct: 320 EYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILADKGETEESIKNFDAAINLD 379

Query: 373 PNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETL 432
             ++A YYHRGQ+YF+TQQ+EK+G DFDKAKE +  NI PYIQLACLAY+ENKF DCETL
Sbjct: 380 ATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLAYKENKFNDCETL 439

Query: 433 FSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKAT 492
           FSEARRKFPTAPEVPNFYA++L ++ + + ALK+Y+ ++KLE+A EGIHVG+AP++GKAT
Sbjct: 440 FSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKLEEAVEGIHVGIAPMIGKAT 499

Query: 493 VLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLAR 552
           +LAR     +  E+T LFEEACK DPRSEQAKIGLAQLKLQQE+VDEAI LFEEA  LAR
Sbjct: 500 LLARNPIVENLLESTELFEEACKLDPRSEQAKIGLAQLKLQQEEVDEAIALFEEAAFLAR 559

Query: 553 AFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
             +EKLQATTFAEA+K+QK++R+DP+++ KIQETL AY+ QG++
Sbjct: 560 NMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQGLM 603

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/573 (58%), Positives = 411/573 (71%), Gaps = 30/573 (5%)

Query: 44  SQGKVGGVNSPSGETRYGXXXXXXXXXXXYPVDSNGEPDLSGVDSFTEEQKERYSMAMKD 103
           SQ K  G    +GE++             YPV +NGEPD S    FT E+K++Y++A+KD
Sbjct: 55  SQKKSEGSKKSAGESK----------PPIYPVAANGEPDFSKKADFTAEEKDKYALALKD 104

Query: 104 KGNECFXXXXXXXXXXXXSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPD 163
           KGN+ F            + AL LK+DPVFYSN SAC+V +  L+KVVE +T ALELKPD
Sbjct: 105 KGNQYFRNKKYDDAIKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 164 YSKCLLRRATANESLGNFADAMLDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLA 223
           YSK LLRRA+ANE LGNFADAM DLS +SL G +N  SIEP+LERN+NKQAM  LK K  
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFG 224

Query: 224 D--------------------GSKHQLPSNTSLASFFGIFPSETSFANYDEQSEADNFLL 263
           D                      +  LPS TS+ASFFGIF  E +FAN DE +EAD  L+
Sbjct: 225 DIDAATATPTELSTQPPKERKDKQESLPSVTSMASFFGIFKPELTFANCDESNEADKELM 284

Query: 264 KGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKN 323
            GL  L +R   SY+ +DE F KA  L       D+ED  ++ KLAI+LEH GIFKFLKN
Sbjct: 285 NGLANLYKRSPDSYDRADESFTKAVKLFEDQLDKDNEDEKVKEKLAISLEHTGIFKFLKN 344

Query: 324 EPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRG 383
           +PL A++ + KA+DL PR NSYIYMALIMAD+  + EY  YFDKAL+L  N+S+VYYHRG
Sbjct: 345 DPLGAHEDITKAIDLFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRG 404

Query: 384 QMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTA 443
           QM F+ Q ++++GKDFDKAKE +P+NIFPYIQLACLAYRENKF+DCETLFSEA+RKFP A
Sbjct: 405 QMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEA 464

Query: 444 PEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDF 503
           PEVPNF+AEIL+DK D + ALK+Y+ A +LE+  EGI+VG+APLVGKAT+L R     +F
Sbjct: 465 PEVPNFFAEILTDKNDFDKALKQYDLAIELENKLEGIYVGIAPLVGKATLLTRNPTVENF 524

Query: 504 AEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLARAFEEKLQATTF 563
            EAT L E+A K DPRSEQAKIGLAQ+KLQQE +DEAI LFEE+ DLAR  EEKLQA TF
Sbjct: 525 IEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITF 584

Query: 564 AEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
           AEAAK+Q+RIR+DP+++ KIQETL   R QG++
Sbjct: 585 AEAAKVQQRIRSDPVLATKIQETLAKLREQGLM 617

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/523 (61%), Positives = 400/523 (76%), Gaps = 1/523 (0%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           YPV  NGEP+L   D FTEE+KE+YS+A+KDKGN  F            + A+ LK++P+
Sbjct: 86  YPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKENPI 145

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           FYSN SAC+V LNKLE++++    ALELKPDYSK LLRRA ANE L N+ADAM DLS +S
Sbjct: 146 FYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSVLS 205

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFFGIFPSETSFANY 252
           L G YN  SIEP+LERN+NKQAM VLK KL +    QLPS+TSL++FFGIF  E SF NY
Sbjct: 206 LNGDYNGASIEPILERNLNKQAMSVLKDKLKNSKDDQLPSDTSLSAFFGIFKPELSFENY 265

Query: 253 DEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIAL 312
           DE ++AD  LL GL  L +R++ SY ++D+ F  A +L     +   +D  L++K +IA 
Sbjct: 266 DETNDADKELLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEETPDDTDLKVKASIAY 325

Query: 313 EHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELA 372
           E+ GIF FLKN+   A + + K++ L+PR NSYIY ALI+ADKG++ +YL YFDKAL+L 
Sbjct: 326 EYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLDYFDKALKLD 385

Query: 373 PNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETL 432
             S AVYYHR Q+ FVTQ F K+  DF+KAKEC+P NIFPYIQLACL YRENKF+DCETL
Sbjct: 386 DKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRENKFDDCETL 445

Query: 433 FSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDA-QEGIHVGVAPLVGKA 491
           FSEA+RKFPT PEVPNFYAE+L+DKGD ++A+K YE AR+LE+A ++GIHVGVAPL+GKA
Sbjct: 446 FSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEASKDGIHVGVAPLIGKA 505

Query: 492 TVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLA 551
           T+LAR+    + A A  L EEA + DPRSEQAKIGLAQLKLQ+E++DE+I+LFEE+ DLA
Sbjct: 506 TLLAREPTLENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEEIDESIRLFEESADLA 565

Query: 552 RAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQG 594
           R  EEKLQATTFAEAAK+QK IRADPI+S KI+ETL AYR Q 
Sbjct: 566 RTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQN 608

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/520 (61%), Positives = 385/520 (74%), Gaps = 1/520 (0%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           YP+D+NGEP L  VD   ++ KE ++ A+K+KGN  F            + AL LK+DPV
Sbjct: 70  YPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKEDPV 129

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           +YSN SAC+  L   EKV+E  T AL L+PDYSK L+RRA A E LGNF DAM DLS  S
Sbjct: 130 YYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSVCS 189

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLA-DGSKHQLPSNTSLASFFGIFPSETSFAN 251
           L    +  SIEP+LERN+N+QAM VL  KL     K QLPSNT+L SFFGIF  E SFAN
Sbjct: 190 LNTDMSDASIEPILERNLNQQAMFVLNTKLGVTDKKSQLPSNTALTSFFGIFKPELSFAN 249

Query: 252 YDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIA 311
           YD+  E D  LL GL+ L       YE +D  F KA +          +D  ++ K AIA
Sbjct: 250 YDDTCEGDKELLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETVKEKTAIA 309

Query: 312 LEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALEL 371
           LEH GIFKFLKN PLEA++ ++KA++LHPR NSYIYMALI+ADKG TD Y   ++KA++L
Sbjct: 310 LEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFANYEKAMKL 369

Query: 372 APNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCET 431
              ++A+YYHRGQMYF+TQQ+EK+G+DFDKAKE +P+NIFPYIQLACL+YRENKF+DCET
Sbjct: 370 DDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDCET 429

Query: 432 LFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKA 491
           LFSEARRKFP + EVPNFYAEIL+DKGD ++ALKEYE A +LE  Q+ +HVG+APLVGKA
Sbjct: 430 LFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQDAVHVGIAPLVGKA 489

Query: 492 TVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLA 551
           T+L R     +F EAT+L EEA K+DPRSEQAKI L QLKLQQE +DEAI+LFE A  LA
Sbjct: 490 TLLVRTPTVENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEAIELFESAATLA 549

Query: 552 RAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYR 591
           R FEEKLQATTFAEAAKIQKRIRADP MSAKIQET+ A R
Sbjct: 550 RTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALR 589

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/524 (59%), Positives = 393/524 (75%), Gaps = 5/524 (0%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           Y VDSNGEP+LS +DS TEE K  ++MA+KDKGNE F              AL+LK DP+
Sbjct: 85  YLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDPI 144

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           +YSN SAC+  L + EKV+E  T AL+L+P +SK L+RRA A E++GNF DAM D+SA S
Sbjct: 145 YYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISACS 204

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFFGIFPSETSFANY 252
           L G  N  SIEP+LER +NKQA  VLK K++   +  LPS+T LASFF +F  ETSFANY
Sbjct: 205 LNGDMNDASIEPILERILNKQAEFVLKEKISANKEQNLPSSTPLASFFRVFKPETSFANY 264

Query: 253 DEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLL--SLSHQADSEDPALRMKLAI 310
           +E +EAD  L+ GL  L +     ++++D+ F KAA+L    LS   D+E  A++ K AI
Sbjct: 265 EESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNE--AIKEKTAI 322

Query: 311 ALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALE 370
           ALE+ GI  ++KNE L+A+  ++ A++LHPR NSYIY +LI +D   T EYLQ FDKALE
Sbjct: 323 ALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKALE 382

Query: 371 LAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCE 430
           L PN+ A+YYHRGQ YF+ QQ+EK+GKDFDK KE + +NIF YIQLACLAYRE+KF+DCE
Sbjct: 383 LEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDCE 442

Query: 431 TLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLE-DAQEGIHVGVAPLVG 489
           TLFSEARRKFPTAPEVPNF+AE+L+D+G+ E A+KE++ A +LE    E IHVG+APL+G
Sbjct: 443 TLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLIG 502

Query: 490 KATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATD 549
           KAT+L  +    +F E   L +EAC KDPRSEQA++GLAQLKLQQE +DEAIQLFEEA +
Sbjct: 503 KATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAAE 562

Query: 550 LARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQ 593
           LA+++EEKLQATTFAEAAKIQKRIRADP M AKI++T+E  R Q
Sbjct: 563 LAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/526 (57%), Positives = 395/526 (75%), Gaps = 11/526 (2%)

Query: 80  EPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPVFYSNRSA 139
           +PD++ + + +E+QK+ Y+ A+KDKGN  F            + A++L +DPVF+SN SA
Sbjct: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISA 134

Query: 140 CWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVSLYGGYNS 199
           C+V L  L+KVVE +T ALELKPDYSK LLRRA+A E++G + DAM D+S +SL G +N 
Sbjct: 135 CYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNG 194

Query: 200 QSIEPVLERNMNKQAMQVLKRKLA-DGS---------KHQLPSNTSLASFFGIFPSETSF 249
            SIEP+LERN+NKQA++VLK  +  D S         + +LPSNTSL+SFFGIF  ET  
Sbjct: 195 SSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEI 254

Query: 250 ANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLA 309
             YDE +EAD  L++GL+ L    +  Y+++DE F KAA L      A++ D A + K A
Sbjct: 255 PAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYR-EQLANNNDAAFKEKAA 313

Query: 310 IALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKAL 369
            ALE++GIF FLKN+   + K L++A+ LHPR N+YIY+AL MAD+GQ+++Y  YF+KA+
Sbjct: 314 TALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKAI 373

Query: 370 ELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDC 429
            L PN++AVYYHRGQMYF+TQ +EK+G+DF K+KE +P NIFPYIQLACLAYRENK  +C
Sbjct: 374 ALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAEC 433

Query: 430 ETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVG 489
           E LF EAR+ FPTAPEVPNFYAEIL+DKGD++ A+K+Y  A +LE  Q+ IHVG+APLVG
Sbjct: 434 EKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVG 493

Query: 490 KATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATD 549
           KAT+LARQ    +FA  + L E+ACK DPRSEQAK+GLAQL+LQQE+VDEAI+LFEEA  
Sbjct: 494 KATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAK 553

Query: 550 LARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGV 595
           +AR  +EKLQA TFAEA K+QKRIRADP++S K++ETL AY+ Q +
Sbjct: 554 MARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/526 (56%), Positives = 392/526 (74%), Gaps = 2/526 (0%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           +P   NGEPD +GVD+ T +QK+++++ +KDKGNE F              AL LKKDPV
Sbjct: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           FYSN SAC+V LN+L+KV+E +T ALELKPDYSK LLRRATANE L N++DAM DLS +S
Sbjct: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQ--LPSNTSLASFFGIFPSETSFA 250
           L   +N  +IEP+LERN+NKQA++VL +K  + SK++  LPSNTS+ASFF IF  E SF 
Sbjct: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262

Query: 251 NYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAI 310
           +YDE+S+AD  LL GL+ L   KTG YE+++  FNK+ +L  +  ++  +   +  K AI
Sbjct: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322

Query: 311 ALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALE 370
           ALE+VGIF FL+N+ + A  L  +++   PR NSYIY+ALI ADK + DE  +YFD+AL+
Sbjct: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382

Query: 371 LAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCE 430
           L PN S +YYHRGQ+ FVTQ +  +  DF KAKE + +NIFPYIQLACL+YRE  FEDC+
Sbjct: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442

Query: 431 TLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGK 490
             F  AR+KFP APE+P F  EIL+DKGDL+ A K+YEF  +LE+ Q+ IHVG+APL+GK
Sbjct: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502

Query: 491 ATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
           AT LARQ    +F+EA+ L ++A +KDPRSEQA +GLAQLKLQ+E VD AI+LFE+A+D 
Sbjct: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562

Query: 551 ARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
           +R+ +EKLQATTFAEAAK+QKRIRADP++ AK++ETL  Y  QG +
Sbjct: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/534 (58%), Positives = 383/534 (71%), Gaps = 10/534 (1%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           YP+ ++GEPDLS +DS+T EQ+E Y++A+KDKGNE F              AL  KKDPV
Sbjct: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPV 140

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           FY+N SAC+V LN  EKV+E+   ALELKPDYSK LLRRA   E++ NFADAM DLS +S
Sbjct: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLS 200

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKL---ADGSKHQLPSNTSLASFFGIFPSETSF 249
           L   ++  SIEP+LERN+NKQAM++LK +L    D  +  LPS+TS+ASFFGIF  ET F
Sbjct: 201 LNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEF 260

Query: 250 ANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLS--LSHQADSEDPA--LR 305
             YDE  EAD  L  GL  L       +  +D  FN+A +      S  +D E  A  L 
Sbjct: 261 KGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLN 320

Query: 306 MKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYF 365
            K AIALE+ GIFKFLKN+ + A   + +A+ L PR NSYIY+AL  AD G++ EY+  F
Sbjct: 321 EKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNF 380

Query: 366 DKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENK 425
           DKALEL PNSSA YYHRGQ+YF+TQ ++K+  DF KAKE + DNIF YIQLACL YRE  
Sbjct: 381 DKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGD 440

Query: 426 FEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLED---AQEGIHV 482
            ++C+ LF EAR KFP APEVP FYAEIL+DKGD   A K+Y+ A++LE+   A+ GI V
Sbjct: 441 MDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRV 500

Query: 483 GVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQ 542
           GVAPLVGKATVLARQ    +FAEAT LFEEACK+DPRSEQAK+GLAQL LQQE VD AI+
Sbjct: 501 GVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIK 560

Query: 543 LFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
           +FEEA DLAR  +EKLQA TFAEAAK+QK+IRADPI+ AK++E L  YR QG++
Sbjct: 561 MFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/529 (56%), Positives = 384/529 (72%), Gaps = 5/529 (0%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPV 132
           YP + + +PD+  + S   E++++ SM +KDKGN+ F            + AL L KDP+
Sbjct: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
           FYSN SAC+V L +L+KV+E +T ALEL P+YSK LLRRA+ANESL N++DA+ DLS +S
Sbjct: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLK---RKLADGSKHQ--LPSNTSLASFFGIFPSET 247
           L G Y+  SIEP+LERN+NKQA++VL     K+   +K Q  LPS TSL SFFGIF  E 
Sbjct: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276

Query: 248 SFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMK 307
           +F NY+E  +AD  LL GL  L +R    Y  +D+ F KA+ L       + +D  L  K
Sbjct: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEK 336

Query: 308 LAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDK 367
            AIALE+ GIF+FLKN+ L A   ++KA+   PR NSY+Y+ALI ADK  + EY +YFDK
Sbjct: 337 TAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDK 396

Query: 368 ALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFE 427
           ALEL P+S +VYYHRGQ+YF+TQ + K+  +F+KAKE +  NIFPYIQLACLAYREN F+
Sbjct: 397 ALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFD 456

Query: 428 DCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPL 487
            C+ LF E R+KFPT PEVP FYAEIL+DKGD   A+K+Y+ A +LE AQ+ IHVG+APL
Sbjct: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPL 516

Query: 488 VGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEA 547
           VGKATVLARQ +  +  EAT L E+AC+ DPRSEQA +GLAQLKLQ E+VD AI+LFE+A
Sbjct: 517 VGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKA 576

Query: 548 TDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
            DL+R  +EK+QA TFAEAAKIQKRIRADP++SAK+ E L +YR QGV+
Sbjct: 577 ADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/539 (51%), Positives = 367/539 (68%), Gaps = 15/539 (2%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLK-KDP 131
           YP+ S+GEPD++ +      Q++ Y++ +KDKGN  F              A+ L   DP
Sbjct: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159

Query: 132 VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191
           VFYSN SAC++    L KVVE TT ALE+KPD+SK LLRRA+ANESLGNF DAM DLS +
Sbjct: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219

Query: 192 SLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQ----LPSNTSLASFFGIFPSET 247
           SL G ++  SIEP+LERN+NKQAM+VL   L+  S  +    LPSNTSLASFFGIF  + 
Sbjct: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279

Query: 248 SFANYDEQSEAD---NFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPAL 304
             +     S  D   + LL+ L+ L    +  Y +++  F KA D       A   D A+
Sbjct: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339

Query: 305 RMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQY 364
           R   A+A  + GIF+FLKN+ L+A  LLQ++++LHP PNSYI+MAL +ADK  + E+  +
Sbjct: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399

Query: 365 FDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYREN 424
           F KA++L P  S  YYHRGQMYF+ Q +  +  DF KA+  NP NI+PYIQLACL Y++ 
Sbjct: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459

Query: 425 KFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGV 484
           KF + E LF+E + KFPT PEVP F+AEIL+DKGD  +A+K+Y+ A++L++ Q  IHVG+
Sbjct: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519

Query: 485 APLVGKATVLARQSHSG-------DFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQV 537
            PL+GKAT+LARQS           F  A  L  EAC  DPRSEQAKIGLAQLKLQ E++
Sbjct: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579

Query: 538 DEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
           D+AI+LF+++  LAR  +EKLQATTFAEAAKIQKR+RADPI+SAK+++TL +YR  G++
Sbjct: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGMI 638

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/538 (50%), Positives = 371/538 (68%), Gaps = 14/538 (2%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLK-KDP 131
           YP   NGEPD++ +   +  Q++ Y++ +K++GN  F              A+ L   +P
Sbjct: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161

Query: 132 VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191
           VFYSN SAC++    LEKV+E TT ALE+KPD+SK LLRRA+ANESLGNF DAM DLS +
Sbjct: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221

Query: 192 SLYGGYNSQSIEPVLERNMNKQAMQVLKRKLA--DGSKHQ-LPSNTSLASFFGIFPSETS 248
           SL G ++  SIEP+LERN+NKQAM+VL   L+  +G   Q LPSNTSLASFFGIF S   
Sbjct: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281

Query: 249 FANYDEQSEADN---FLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALR 305
            ++ +  S  D     L   L+ L       Y ++++   K+ D+      A++ D  LR
Sbjct: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341

Query: 306 MKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYF 365
              A+AL + GIF FLKN  L+A  LLQ++++LHP PNSYI++AL +ADK  + E+ ++F
Sbjct: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401

Query: 366 DKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENK 425
            KA++L P     YYHRGQMYF+ Q ++ + +DF KA+  NP+N++PYIQLACL Y++ K
Sbjct: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461

Query: 426 FEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVA 485
           F + E  F+E + KFPT PEVP F+AEIL+D+GD ++A+K+Y+ A++LE+ QE IHVG+ 
Sbjct: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521

Query: 486 PLVGKATVLARQSHSG-------DFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVD 538
           PL+GKAT+LARQS           F  A  L  +AC+ DPRSEQAKIGLAQLKLQ E++D
Sbjct: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581

Query: 539 EAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
           EAI+LFE++  LAR  +EKLQATTFAEAAKIQKR+RADPI+SAK++ TL  YR +G++
Sbjct: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML 639

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/518 (52%), Positives = 351/518 (67%), Gaps = 1/518 (0%)

Query: 78  NGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDPVFYSNR 137
           N EPD+  +      +K  Y+  +K +GN  F              AL+LK DPVFYSN 
Sbjct: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125

Query: 138 SACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVSLYGGY 197
           +AC++ L   ++ +E  + ALEL PDYSK LL+RA   E++G FADA+LDL+AVSL G Y
Sbjct: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185

Query: 198 NSQSIEPVLERNMNKQAMQVLKRKLADGSKHQ-LPSNTSLASFFGIFPSETSFANYDEQS 256
           N  +I+P++ER +NKQAM  LK  L    K++ LPS TS+A+FFG+F +ET    +D   
Sbjct: 186 NDATIQPIVERVLNKQAMMALKDHLEASEKNKVLPSYTSMAAFFGVFDAETDIPGHDATE 245

Query: 257 EADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVG 316
           E+D  L   L  L  +    Y+  D  F KA +L     + D  +     K AIA EH  
Sbjct: 246 ESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHTA 305

Query: 317 IFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSS 376
           I  FLKN+PL A +L+ +A+ LHPRP SYIY+ L+MADKG  +EY   F KA++L PN +
Sbjct: 306 ILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNMA 365

Query: 377 AVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEA 436
           A+YYHRGQM F+ Q++EK+G+DFDKAKEC+P NIFPYIQLAC++YRE  F+DCETLFSEA
Sbjct: 366 AIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSEA 425

Query: 437 RRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLAR 496
           RRKFP APEVPNF+AEILSDKG++E A  EY+ A +LE   E IHVG+APLVGKAT L +
Sbjct: 426 RRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLLK 485

Query: 497 QSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLARAFEE 556
                +F EA  LFE+A  +DPRSE+AK+GLAQ KLQQE +D+AI+LFEEA  L R  +E
Sbjct: 486 YPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDE 545

Query: 557 KLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQG 594
           KLQATTFAEA K+Q R+RAD  + AK  + L+  R  G
Sbjct: 546 KLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/539 (50%), Positives = 369/539 (68%), Gaps = 15/539 (2%)

Query: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLK-KDP 131
           YP+  +GEPD+  +   +  Q++ +++ +KDKGN  F              A+ L   DP
Sbjct: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165

Query: 132 VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191
           VFYSN SAC++    L+KVVE TT ALE+KPD+SK LLRRA+ANESLGNF DAM DLS +
Sbjct: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225

Query: 192 SLYGGYNSQSIEPVLERNMNKQAMQVLKRKLA----DGSKHQLPSNTSLASFFGIFPSET 247
           SL G ++  SIEP+LERN+NKQAM+VL   L     D S   LPSNTSLASFFGIF  + 
Sbjct: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285

Query: 248 SFANYDEQSEADN---FLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPAL 304
             +  +  S  D+    L + L+ L    +  Y ++D+   KA D      +A+ ED  +
Sbjct: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKEDRVI 345

Query: 305 RMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQY 364
           R   A+A  + GIF+FLKN+ L+A  LLQ++++LHP PNSY++MAL +ADK  + E+ ++
Sbjct: 346 RENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEFFKF 405

Query: 365 FDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYREN 424
           F  A++L P     YYHRGQMYF+ Q +  +  DF KA+  NP N++PYIQLACL Y+++
Sbjct: 406 FQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLYKQD 465

Query: 425 KFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGV 484
           KF + E+LF+EA+ KFP  PEVP FYAEIL+DKGD   A+K+Y+ A++LE+ Q+ IHVG+
Sbjct: 466 KFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIHVGI 525

Query: 485 APLVGKATVLARQSHSG-------DFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQV 537
            PL+GKAT+LARQS           F  A  L  +AC+ DPRSEQAKIGLAQL+LQ E++
Sbjct: 526 GPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQMEKI 585

Query: 538 DEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
           D AI+LF+E+  LAR  +EKLQATTFAEAAKIQKR+RADPI+SAK+++TL  YR QG++
Sbjct: 586 DVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQGMI 644

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/533 (51%), Positives = 360/533 (67%), Gaps = 15/533 (2%)

Query: 78  NGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLK-KDPVFYSN 136
           NGEPD+S +   T  QK+ Y++ +K+KGN  F             CA+ L   DPVFYSN
Sbjct: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163

Query: 137 RSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVSLYGG 196
            SAC++    L KV+E TT ALE+KPD+SK LLRRA+ANESLGNF DAM DLS +SL G 
Sbjct: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223

Query: 197 YNSQSIEPVLERNMNKQAMQVLKRKLA--DGSKHQL-PSNTSLASFFGIFPSETSFANYD 253
           ++  SIEP+LERN+NKQAM+VL   L+  DG   QL PSNTSL SFFGIF  +   +  +
Sbjct: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283

Query: 254 EQSEADN---FLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAI 310
             S  D     L   L+ L       Y  +D+ F  A D    S  A   D  L+   A+
Sbjct: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYH-SLLASQVDGPLKENAAL 342

Query: 311 ALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALE 370
           A  + GIF FLKN  L A  LLQ++++LHP PNSYI++AL +ADK  + E+ +YF KA++
Sbjct: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402

Query: 371 LAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCE 430
           L       YYHRGQMYF+ Q +  +  DF KA+   P+NI+PYIQLACL Y++ KF + E
Sbjct: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462

Query: 431 TLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGK 490
            LF+E + KFPT PEVP F+AEIL+DKGD  +A+K+Y+ A++LE+ QE IHVG+ PL+GK
Sbjct: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522

Query: 491 ATVLARQSHSG-------DFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQL 543
           AT+LARQS           F  A AL  +AC+ DPRSEQAKIGLAQLKLQ E++D+AI+L
Sbjct: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582

Query: 544 FEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
           F+++  LAR  +EKLQATTFAEAAKIQKR+RADPI+SAK++ TL +YR +G++
Sbjct: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/535 (50%), Positives = 370/535 (69%), Gaps = 11/535 (2%)

Query: 73  YPVDSNGEPDLSGVDSF---TEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLKK 129
           YP+DS  +PD + ++      E  K +++  +K+KGN+ F              ALRL +
Sbjct: 130 YPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLDQ 189

Query: 130 DPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLS 189
           DPVFYSN SAC+  +N+L+KV+E +  ALELKPDYSK LLRRA A E+LGN  +A+ D S
Sbjct: 190 DPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDFS 249

Query: 190 AVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQ--LPSNTSLASFFGIFPSET 247
            +SL+G Y+ Q +EP+L R ++K +  VL+ KL +       L S+++L SFFGIFP ET
Sbjct: 250 ILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDNKKTDNFILLSDSALVSFFGIFPPET 309

Query: 248 SFANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLS---LSHQADSEDPAL 304
           +  NY+   EAD  L++GL  L+++ +  +  +D++F KA +L     LS + + E+  L
Sbjct: 310 TITNYNPDDEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDENSGL 369

Query: 305 RMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTD---EY 361
             K+AIALE+ G+FKFLK + L +   LQKA+DL+PRPNSYIYMA+++ADK       +Y
Sbjct: 370 LEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKNDLDY 429

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
            +YFDKA  L PN +  YYHRGQ+  V Q+F+++   F KAKE +  N++PYIQLAC+AY
Sbjct: 430 FKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLACVAY 489

Query: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIH 481
             + F+ C+ LF EAR KFPT PEVP FYAEIL+DKG+LE+A+K+Y+ A +LE A + IH
Sbjct: 490 YNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETAYKYIH 549

Query: 482 VGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAI 541
           VG+APL+GKA  LAR     +F   T L E+AC+ DPRSEQAKI LAQLKLQ E +D AI
Sbjct: 550 VGIAPLIGKAAALARIPTQENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDIDTAI 609

Query: 542 QLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596
            LFEE  DLAR +++KLQATTFAEAAKIQKRI+ +PI +AKI+ETL  YR  G++
Sbjct: 610 ALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADGII 664

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 53/113 (46%), Gaps = 2/113 (1%)

Query: 74  PVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRL-KKDPV 132
           P  S+ EP  +  D+   E  ER +  +K +GN+ F            + A+ L   + V
Sbjct: 73  PTLSSSEPTGNNTDAHAPEVAER-AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           FY NR+A +    K E+ V D  +A+ + P YS+   R   A  +LG   +AM
Sbjct: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAM 184

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 68/150 (45%), Gaps = 22/150 (14%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
           ++ + +A+EL PN++  Y +R   Y   ++FE++ +D + A   NP     Y +L    Y
Sbjct: 116 VKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKY 175

Query: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGD--LESALKEYEFARKLEDAQEG 479
              K E                 E    Y ++L  +GD   E+  ++YE A+K    +E 
Sbjct: 176 ALGKPE-----------------EAMEAYKKVLDIEGDNATEAMKRDYESAKK--KVEES 216

Query: 480 IHVGVAPLVGKATVLARQSHSGDFAEATAL 509
           +++   P  G+    +  S +G F + +++
Sbjct: 217 LNLEALP-KGEEQQTSEGSSAGGFPDLSSM 245

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            S A+   + P  V YSNRSAC+  L K ++ +ED    ++
Sbjct: 7   KKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECVK 66

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A   LGN  DA
Sbjct: 67  INPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L      ++D   A+   P++ +  +R+A+A  ++  FA AM
Sbjct: 430 RAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRKASAQIAVREFAPAM 489

Query: 186 LDLSA-----VSLYGGYNSQSIE 203
             L A     + +  G N++ IE
Sbjct: 490 ETLDAARAKDLEINKGANAREIE 512

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 2/86 (2%)

Query: 101 MKDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAAL 158
           +K KGN  F            + A+     P  V YSNRSAC+  L + ++ + D    +
Sbjct: 7   LKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCV 66

Query: 159 ELKPDYSKCLLRRATANESLGNFADA 184
           ++ PD+SK   R   A+  LG+  DA
Sbjct: 67  KINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L    + ++D   A+E  P++ +  LR+ATA  ++ +F  A+
Sbjct: 419 RAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPNFVRAYLRKATAQIAIKDFVKAL 478

Query: 186 LDL 188
             L
Sbjct: 479 ETL 481

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            + A+ + + P  V YSNRSAC+  L K    + D T  ++
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A+  LG+  DA
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L    + + D   A+E  P++ +  +R+ATA  ++  FA A+
Sbjct: 422 RSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVQEFAGAL 481

Query: 186 LDLSAV 191
             L A 
Sbjct: 482 ETLDAA 487

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F              A+ + + P  V YSNRSAC+  + K  + + D    + 
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           +KPD+SK   R   A+  LG+  +A
Sbjct: 68  IKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 59/136 (43%), Gaps = 15/136 (11%)

Query: 83  LSGVDSFTEEQKERYSMAMKD---------KGNECFXXXXXXXXXXXXSCAL-RLKKDPV 132
           L+ + S  +EQK+R + A  D         +G E F            +  + R  +D  
Sbjct: 364 LNKLRSLEKEQKKREAEAYIDPEKAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDAR 423

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSA-- 190
            YSNR+A    L      ++D   A++  P++ +  +R+ATA  ++  +A A+  L    
Sbjct: 424 GYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRKATAQIAVQEYAAAIETLDTAR 483

Query: 191 ---VSLYGGYNSQSIE 203
                +  G N++ I+
Sbjct: 484 EKDAEVNNGSNTREID 499

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            S A+ + + P  VFYSNRSAC+  L K  + + D    ++
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A+  LG+  +A
Sbjct: 68  INPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L    + +ED   A+E  P++ +  +R+ATA  ++  FA A+
Sbjct: 419 RAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPNFIRAYIRKATAQIAVKEFAAAI 478

Query: 186 LDLSAV 191
             L A 
Sbjct: 479 ETLDAA 484

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 56/125 (44%), Gaps = 12/125 (9%)

Query: 413 YIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPN--FYAEILSDKGDLESALKEYEFA 470
           Y Q    A+    +E    LFS+A        E PN  FY    S++    ++LK+  F 
Sbjct: 7   YKQQGNAAFVAKDYEKAIDLFSKAIE----VSETPNHVFY----SNRSACYASLKK--FP 56

Query: 471 RKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQL 530
             L DA+E + +      G   + A     GD  EA   +++A + D  ++ AK GL Q+
Sbjct: 57  EALNDAEECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSNQAAKDGLDQV 116

Query: 531 KLQQE 535
           K  QE
Sbjct: 117 KRTQE 121

>CAGL0L09823g Chr12 (1052444..1054675) [2232 bp, 743 aa] {ON} some
           similarities with uniprot|P09798 Saccharomyces
           cerevisiae YKL022c CDC16
          Length = 743

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 67/144 (46%), Gaps = 22/144 (15%)

Query: 274 TGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQ 333
           + +  +++EYF       SL++++  +DP       + L  +G+ KF K E  +A + L+
Sbjct: 536 SNTLTLAEEYF-------SLAYESSPQDP-------VILNEIGVLKFKKGELHKAKRYLK 581

Query: 334 KAV----DLHPRPNSYIYMALIMADK----GQTDEYLQYFDKALELAPNSSAVYYHRGQM 385
           KA     D+     + + + + ++      G+ ++ ++Y    LE   NSS +Y   G +
Sbjct: 582 KAAECCKDMERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNILEDTENSSEIYCSLGFL 641

Query: 386 YFVTQQFEKSGKDFDKAKECNPDN 409
           Y  T Q +K+     +    NP N
Sbjct: 642 YLKTNQLQKAIDALHRVLAINPGN 665

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 58/129 (44%), Gaps = 17/129 (13%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
           L Y  K+LE+ PN S  +YH G+++ +   +  +   F +A   +  N   +  +  L Y
Sbjct: 292 LNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 351

Query: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKG--------DLESALKEYEFARKL 473
           + +++ D    ++ A R  P       + +E+  D G         L  AL  Y+ A +L
Sbjct: 352 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLNDALDAYKQAARL 404

Query: 474 EDAQEGIHV 482
           +   E +H+
Sbjct: 405 DP--ENVHI 411

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 88/200 (44%), Gaps = 15/200 (7%)

Query: 276 SYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKA 335
           +Y+MS +YFN+  DL           PA R+K    +E      +  ++ +++  L    
Sbjct: 487 NYDMSLKYFNRLKDL----------QPA-RVK---DMEIFSTLLWHLHDKVKSSNLANGL 532

Query: 336 VDLHP-RPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEK 394
           +D  P +P ++  +  +++ +   D  ++ F+KA +L PN +  Y  +G  +      + 
Sbjct: 533 MDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDS 592

Query: 395 SGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEIL 454
           +   + KA  C+P +   Y  L   A +  ++E+    F +AR   P    +       L
Sbjct: 593 AKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSL 652

Query: 455 SDKGDLESALKEYEFARKLE 474
              G  E AL+ YE A  L+
Sbjct: 653 EKLGYKEKALQYYELACHLQ 672

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 29/54 (53%)

Query: 356 GQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDN 409
           G  ++ LQY++ A  L P SS   Y  GQ+ +   ++  + + F++  +  PD+
Sbjct: 656 GYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDD 709

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            + A+ + K P  V YSNRSAC+  L K    + D    + 
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A+  LG+  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L    + + D   A+E  P++ +  +R+ATA  ++  +A A+
Sbjct: 425 RAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVQEYAAAL 484

Query: 186 LDLSAV 191
             L A 
Sbjct: 485 ETLDAA 490

>ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} similar
           to uniprot|P19735 Saccharomyces cerevisiae YBR055C PRP6
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 867

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 107/250 (42%), Gaps = 25/250 (10%)

Query: 344 SYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAK 403
           S +Y   I  +     + L+  D+A  + PNS  V+  + +   +T Q E + K F  A 
Sbjct: 528 SLMYSKEIWKNGHDIPKSLEILDRAQNILPNSLEVWLAKLKFLCLTDQVELAQKSFAMAM 587

Query: 404 ECNPDNIFPYIQ------LACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDK 457
           E   D+  P+++      ++ L +R       + L      KFP  P+      +I  D 
Sbjct: 588 ERLRDSQVPHLEKLYYKYISFLRFRRQNTAAIKMLNETCIPKFPNCPKFYLQLGQIHYDL 647

Query: 458 GDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKD 517
           G  E +   +E   K+    +GI + ++    +   L R       A+A ++F+ A  K+
Sbjct: 648 GQTEESQMAFERGTKM--LPQGIPLWISLARIEEIDLKRP------AKARSIFDLALLKN 699

Query: 518 PRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADP 577
           P +E   +  AQ++ +    D+A  + +++       +    AT +AE       IR  P
Sbjct: 700 PANETLSLARAQMEARLGNYDQARFIIQQSLQ-----KHSKSATLWAE------NIRILP 748

Query: 578 IMSAKIQETL 587
           +  A +++T+
Sbjct: 749 LKRANVKKTV 758

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 51/108 (47%), Gaps = 7/108 (6%)

Query: 79  GEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALR-LKKDPVFYSNR 137
           GEP ++       E+ ++ + A+K +GN               + A+  L  D V+Y+NR
Sbjct: 77  GEPKVAA------EELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANR 130

Query: 138 SACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           +A +  L + EK VED   A ++   YSK   R   A  +LG   +A+
Sbjct: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEAL 178

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECN 406
           +Q +  A+E+ P  +  Y +R   Y   QQ+EK+ +D +KA + +
Sbjct: 110 IQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVD 154

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            S A+ +  +P  V YSNRSAC+  L K    + D     +
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A+  LG+  +A
Sbjct: 69  INPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 7/111 (6%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R   D   YSNR+A    L    + + D   ALE  P++ K  +R+ATA  ++  ++ A+
Sbjct: 421 RAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKATAQIAIKEYSSAL 480

Query: 186 --LDLSAVSLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNT 234
             LD++        N  +I     R +N+   +  +++    S ++ P  T
Sbjct: 481 ETLDIARSKDTELNNGSNI-----REINQLYAKATQQRFEPASSNETPEQT 526

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 56/123 (45%), Gaps = 8/123 (6%)

Query: 413 YIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARK 472
           Y Q    A+   ++E    LFS+A      +PE PN    + S++    ++LK+  F   
Sbjct: 8   YKQQGNTAFSAKEYEKAVDLFSKA---IEVSPE-PNHV--LYSNRSACYTSLKK--FTDA 59

Query: 473 LEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKL 532
           L DA E   +      G   V A     GD  EA   +++A + D  ++ A+ GL Q+K 
Sbjct: 60  LNDANECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASNKVAQEGLEQVKR 119

Query: 533 QQE 535
            QE
Sbjct: 120 TQE 122

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            + A+ + + P  V YSNRSAC+  L K    + D    ++
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A+  LG+  +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L    + + D   A+E  P++ +  +R+ATA  ++  +A A+
Sbjct: 425 RAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASAL 484

Query: 186 LDLSAV 191
             L A 
Sbjct: 485 ETLDAA 490

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 69/155 (44%), Gaps = 19/155 (12%)

Query: 262 LLKGLRCLSERKTGSYEMSDEYF---NKAADLLSLSHQADSEDPALRMKLAIALEHVGIF 318
           +L+ L CL       Y M++  F    KA +LL  S + DS D       A +  H+G  
Sbjct: 322 VLQQLGCL-------YGMNNVSFYDPQKALNLLLKSLEIDSTD-------ATSWYHLGRI 367

Query: 319 KFLKNEPLEAYKLLQKAVDLHPR-PNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSA 377
             ++N+   AY   Q+AV+   R P  +  + ++     Q  + L  + +A+ L P  S 
Sbjct: 368 HMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQYRDALDAYTRAIRLNPYISE 427

Query: 378 VYYHRGQMY-FVTQQFEKSGKDFDKAKECNPDNIF 411
           V+Y  G +Y     Q   +   + +A   +P+N+ 
Sbjct: 428 VWYDLGTLYETCNNQVNDALDAYKQAARLDPNNVH 462

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 25/124 (20%), Positives = 52/124 (41%), Gaps = 17/124 (13%)

Query: 367 KALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKF 426
           K+LE+    +  +YH G+++ +   +  +   F +A   +  N   +  +  L Y+  ++
Sbjct: 349 KSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQY 408

Query: 427 EDCETLFSEARRKFPTAPEVPNFYAEILSDKGDL--------ESALKEYEFARKLEDAQE 478
            D    ++ A R  P       + +E+  D G L          AL  Y+ A +L+    
Sbjct: 409 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQVNDALDAYKQAARLDP--N 459

Query: 479 GIHV 482
            +H+
Sbjct: 460 NVHI 463

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           KD+GN  F            + A+ + + P  V YSNRSAC+    +  K +ED    ++
Sbjct: 9   KDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVK 68

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A+  +G+  +A
Sbjct: 69  INPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 134 YSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSA--- 190
           YSNR+A    L    + + D   A+E  P++ +  +R+ATA  ++ +F  A+  L A   
Sbjct: 426 YSNRAAALSKLMSFPEAITDCNTAIEKDPNFIRAYIRKATAQIAIKDFVPAIETLDAART 485

Query: 191 --VSLYGGYNSQSIE 203
               L  G NS+ I+
Sbjct: 486 KDAELNNGANSREID 500

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 3/104 (2%)

Query: 433 FSEARRKFPTAPEVPNFYAEIL-SDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKA 491
           + EA  KF  A EV      +L S++    ++ K+  F + LEDA E + +      G  
Sbjct: 21  YDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQ--FVKGLEDANECVKINPTWSKGYN 78

Query: 492 TVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQE 535
            V A     GD  EA   +++A + D  ++ A  GL+Q+   QE
Sbjct: 79  RVGAAHFGMGDLDEAEKAYKKALELDSSNKAAHDGLSQVTRAQE 122

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 103/255 (40%), Gaps = 24/255 (9%)

Query: 276 SYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKA 335
           +Y+MS +YFN+  DL           PA R+K    +E      +  ++ +++  L    
Sbjct: 480 NYDMSLKYFNRLKDL----------QPA-RVK---DMEIFSTLLWHLHDKVKSSNLANGL 525

Query: 336 VDLHP-RPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEK 394
           +D  P +P ++  +  +++ +   D  ++ F+KA +L PN +  Y  +G  +      + 
Sbjct: 526 MDTMPNKPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDS 585

Query: 395 SGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEIL 454
           +   + KA  C+P +   Y  L   + +  ++E+    F +AR   P    +       L
Sbjct: 586 AKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSL 645

Query: 455 SDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEAC 514
              G  E AL+ YE A  L+         +  L+   T          ++ A   FEE  
Sbjct: 646 EKLGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMT---------RYSVALQTFEELV 696

Query: 515 KKDPRSEQAKIGLAQ 529
           K  P    A   L Q
Sbjct: 697 KLVPDDATAHYLLGQ 711

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            + A++  ++P  V YSNRS  +  L K ++ + D T  ++
Sbjct: 8   KKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVK 67

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           +K D+SK   R   A+  LGN  +A
Sbjct: 68  IKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 125 LRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADA 184
           +R   D   YSNR+A    L      ++D   A+E+ P + +  +R+ATA  ++  ++ A
Sbjct: 420 MRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRKATAQIAVQEYSAA 479

Query: 185 M--LDLSAVSLYGGYNSQSIEPV 205
           +  LD++        N  SI  +
Sbjct: 480 IETLDVARTKDAEVNNGSSIREI 502

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            + A+ + + P  V YSNRSAC+    +  K +ED    + 
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A+  LG+  +A
Sbjct: 67  INPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L    + ++D   A+   P++ +  +R+ATA  ++  F   +
Sbjct: 422 RAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDPNFIRAYIRKATAQIAVREFVSVI 481

Query: 186 LDLSAV-----SLYGGYNSQSIE 203
             L         +  G N++ I+
Sbjct: 482 ETLDEARTKDSQINNGANAREID 504

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 58/129 (44%), Gaps = 17/129 (13%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
           L Y  K+LE+ P+ +  +YH G+++ V   +  +   F +A   +  N   +  +  L Y
Sbjct: 301 LNYLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 360

Query: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKG--------DLESALKEYEFARKL 473
           + +++ D    ++ A R  P       + +E+  D G         L  AL  Y+ A +L
Sbjct: 361 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARL 413

Query: 474 EDAQEGIHV 482
           +   E IH+
Sbjct: 414 DP--ENIHI 420

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F              A+ + + P  V YSNRSAC+  L K  + ++D    ++
Sbjct: 8   KQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVK 67

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A   L N  DA
Sbjct: 68  INPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L    + + D   A+E  P++ +  +R+A+A  ++  FA A+
Sbjct: 411 RSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPNFIRAYIRKASAQIAVKEFAAAV 470

Query: 186 LDLSAV-----SLYGGYNSQSIE 203
             L  V      L  G N++ I+
Sbjct: 471 ETLDTVRTKDSELNNGANAREID 493

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%)

Query: 100 AMKDKGNECFXXXXXXXXXXXXSCALRLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALE 159
           A+K +GNE              + A++  K+  +YSNRS  +  L + E  V D T A+ 
Sbjct: 84  ALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLAIN 143

Query: 160 LKPDYSKCLLR 170
           + P +SK   R
Sbjct: 144 IDPSFSKAYSR 154

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 2/88 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            + A+ + + P  V +SNRSAC+  L K    + D    ++
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 160 LKPDYSKCLLRRATANESLGNFADAMLD 187
           + P +SK   R   A+  LG+  +A  D
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESD 96

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L    + + D   A+E  P++ +  +R A A  ++  FA A+
Sbjct: 425 RAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRMAAAQIAVKEFAAAL 484

Query: 186 LDL 188
             L
Sbjct: 485 ETL 487

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 4/124 (3%)

Query: 334 KAVDLHPRPNSYIYMALIMA--DKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQ 391
           +A+ +  R  ++ Y  + +A  ++ Q  E +++F  AL + PN    +   GQ YF   +
Sbjct: 675 EAIKMELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGR 734

Query: 392 FEKSGKDFDKAKECNPDNIFP-YIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFY 450
            E S K F+KA E +P +++  Y     LA     FE+C  +     +  P        Y
Sbjct: 735 VEASTKVFEKAIEIDPLHLYAQYFNSLSLA-EMGCFEECIEILKNITQLNPEELAFQVSY 793

Query: 451 AEIL 454
           + IL
Sbjct: 794 SSIL 797

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 92/230 (40%), Gaps = 14/230 (6%)

Query: 326 LEAYKLLQKAVDL----HP-RPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYY 380
           L+ YK L   VD     +P +P ++  +   ++ K   ++ ++ F+KA ++ P  +  Y 
Sbjct: 530 LQDYKRLASLVDYLLTYYPNKPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYT 589

Query: 381 HRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKF 440
            +G        F+ + K F KA  C+P +   Y  +   + +   +++    F +AR+ +
Sbjct: 590 LQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIY 649

Query: 441 PTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHS 500
           P    +       L      + AL+ YE A  L+          A L+            
Sbjct: 650 PINAVLICCCGVALEKLEYQDKALEYYELACTLQPNSNLARFKRANLLYAM--------- 700

Query: 501 GDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
           G +  A   FEE  K  P        L QL     + +EAI+ F  A +L
Sbjct: 701 GRYNLALQSFEELSKLTPEEPTVHFVLGQLYQIMGRKNEAIREFTVAMNL 750

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 67/170 (39%), Gaps = 13/170 (7%)

Query: 383 GQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPT 442
           G++++    +E +   F +  E  P  I      + L +    ++   +L       +P 
Sbjct: 490 GKLHYEIVNYEMASIYFMQLFELQPYRISDTEIFSTLLWHLQDYKRLASLVDYLLTYYPN 549

Query: 443 APEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKA-TVLARQSHSG 501
            PE        LS K D E A++ +E A K++           P    A T+   +  S 
Sbjct: 550 KPETWCCVGNYLSLKKDHEDAIEAFEKATKID-----------PKFAYAYTLQGHECSSN 598

Query: 502 D-FAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
           D F  A   F +A   DPR   A  G+    ++    DEA+  FE+A  +
Sbjct: 599 DSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQI 648

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 67/163 (41%), Gaps = 9/163 (5%)

Query: 328 AYKLLQKAVDLHPRP-NSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMY 386
           A K  +KA+   PR  N+Y  M +     G  DE L YF+KA ++ P ++ +    G   
Sbjct: 604 AKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCGVAL 663

Query: 387 FVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEV 446
              +  +K+ + ++ A    P++     + A L Y   ++      F E  +  P  P V
Sbjct: 664 EKLEYQDKALEYYELACTLQPNSNLARFKRANLLYAMGRYNLALQSFEELSKLTPEEPTV 723

Query: 447 PNFYAEILSDKGDLESALKEYEFARKLE--------DAQEGIH 481
                ++    G    A++E+  A  L+        DA E  H
Sbjct: 724 HFVLGQLYQIMGRKNEAIREFTVAMNLDPKGNQLILDALEKCH 766

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            S A+ + + P  V YSNRSAC+  L K    ++D    ++
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A+  +G+  +A
Sbjct: 69  INPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L    + ++D   A+E  P++ +  +R+ATA  ++  F+ A+
Sbjct: 426 RAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRKATAQIAVREFSSAL 485

Query: 186 LDLSA 190
             L A
Sbjct: 486 ETLDA 490

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 8/123 (6%)

Query: 413 YIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARK 472
           Y Q    A+    ++    LFS+A        E PN    + S++    ++LK+  F   
Sbjct: 8   YKQQGNAAFVAKDYDKAIDLFSKA----IDVSEQPNHV--LYSNRSACYTSLKK--FVNA 59

Query: 473 LEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKL 532
           L+DA+E + +  +   G   V A     GD  EA A +++A + D  ++ A+ GL Q+  
Sbjct: 60  LKDAEECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASNKAAQEGLEQVHR 119

Query: 533 QQE 535
            QE
Sbjct: 120 TQE 122

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 73/182 (40%), Gaps = 11/182 (6%)

Query: 75  VDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRL-KKDPVF 133
           V  +G P     DS T      Y    K++GNE              + A+       +F
Sbjct: 19  VAGSGHPSPPRRDSMTAATALDY----KNEGNEWVKAKDYARAVEAYTRAIEADGTQSIF 74

Query: 134 YSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV-- 191
           +SNR+   + L++ +  +ED+  A+EL     K   RR  A+  L  +  A  DL  V  
Sbjct: 75  FSNRALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVVVR 134

Query: 192 SLYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFFGIFPSETSFAN 251
           +  G    +    V ER + ++  +   R   D  + +L    SLASF G        A+
Sbjct: 135 AKPGDEAVRRALEVCERMLRRERFERAIRADGDEEQRRLCKTLSLASFAG----NADLAS 190

Query: 252 YD 253
           YD
Sbjct: 191 YD 192

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 88/200 (44%), Gaps = 15/200 (7%)

Query: 276 SYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKA 335
           +Y+MS +YFN+  DL           PA R+K    +E      +  ++ +++  L    
Sbjct: 492 NYDMSLKYFNRLKDL----------QPA-RVK---DMEIYSTLLWHLHDKVKSSNLANGL 537

Query: 336 VDLHP-RPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEK 394
           +D  P +P ++  +  +++ +   D  ++ F+KA +L PN +  Y  +G  +      + 
Sbjct: 538 MDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDS 597

Query: 395 SGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEIL 454
           +   + KA  C+P +   Y  L   + +  ++E+    F +AR   P    +       L
Sbjct: 598 AKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSL 657

Query: 455 SDKGDLESALKEYEFARKLE 474
              G  E  L+ YE A +L+
Sbjct: 658 EKLGYKEKVLQYYELACQLQ 677

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 30/54 (55%)

Query: 356 GQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDN 409
           G  ++ LQY++ A +L P SS   Y  GQ+ +   ++  + + F++  +  PD+
Sbjct: 661 GYKEKVLQYYELACQLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDD 714

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 1/95 (1%)

Query: 92  EQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRL-KKDPVFYSNRSACWVPLNKLEKV 150
           E K++ + A+K +GN+              S A+ +   +P +YSNR+A +  +      
Sbjct: 92  EDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNA 151

Query: 151 VEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           V D   A++L P YSK   R   A  + GN  DA+
Sbjct: 152 VLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAV 186

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 48/100 (48%), Gaps = 1/100 (1%)

Query: 87  DSFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALR-LKKDPVFYSNRSACWVPLN 145
           D   +E+++  +  +K +GN+              S A+  L  + V+Y+NR+A +  L 
Sbjct: 82  DDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLK 141

Query: 146 KLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           K +  V D  +A+++ P YSK   R   A  + G   DA+
Sbjct: 142 KYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 35/59 (59%)

Query: 127 LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           L  + V+Y+NR+A +  L K E+ V+D  +A+++ P YSK   R   A  +LG   +A+
Sbjct: 127 LPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEAL 185

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 36/68 (52%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
           ++ + +A+E+ P+++  Y +R   Y   +++E+S +D + A + NP     Y +L    Y
Sbjct: 117 IKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKY 176

Query: 422 RENKFEDC 429
              K E+ 
Sbjct: 177 ALGKPEEA 184

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 88/200 (44%), Gaps = 15/200 (7%)

Query: 276 SYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKA 335
           +Y+MS +YFN+  DL           PA R+K    +E      +  ++ +++  L    
Sbjct: 498 NYDMSLKYFNRLKDL----------QPA-RVK---DMEIFSTLLWHLHDKVKSSNLANGL 543

Query: 336 VDLHP-RPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEK 394
           +D+ P +P ++  +  +++ +   D  ++ F+KA +L PN +  Y  +G  +      + 
Sbjct: 544 MDIMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDS 603

Query: 395 SGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEIL 454
           +   + KA  C+  +   Y  L   + +  ++E+    F +AR   P    +       L
Sbjct: 604 AKTCYRKALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSL 663

Query: 455 SDKGDLESALKEYEFARKLE 474
              G  E AL+ YE A  L+
Sbjct: 664 EKLGYKEKALQYYELACHLQ 683

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 29/54 (53%)

Query: 356 GQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDN 409
           G  ++ LQY++ A  L P SS   Y  GQ+ +   ++  + + F++  +  PD+
Sbjct: 667 GYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDD 720

>TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON}
           Anc_2.665 YKL022C
          Length = 752

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 65/139 (46%), Gaps = 22/139 (15%)

Query: 279 MSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVD- 337
           +++EYF       +LS+    +DP L       L  +G+  F +N+  +A K L++A++ 
Sbjct: 550 LAEEYF-------TLSYDICPQDPLL-------LNEMGVMYFKRNDLQKAKKFLKRALEA 595

Query: 338 ---LHPRPNSYIYMALIMADK----GQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQ 390
              L P   + + + + +A      G+ +  ++ F   L+++  SS  Y   G +Y  T+
Sbjct: 596 VEELDPTSKTSVSIQMNLAHAYRRLGENERAIKCFKSVLKVSNKSSDTYCSLGFLYLKTK 655

Query: 391 QFEKSGKDFDKAKECNPDN 409
           Q +K+   F  A    P N
Sbjct: 656 QLQKAIDHFHTALALRPSN 674

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%)

Query: 127 LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           L  + V+++NR+A +  L K ++ VED  +A+++ P YSK   R   A  + G   DA+
Sbjct: 130 LPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDAL 188

>NCAS0A08420 Chr1 complement(1667102..1668286) [1185 bp, 394 aa]
           {ON} Anc_1.456
          Length = 394

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALEL--APN--SSAVYYHRGQMYFVTQQFEKSGKDFD 400
           Y+ M+L+M    Q D+ + Y    L++   PN   +  YY RG  Y++ +  E + KD+ 
Sbjct: 296 YLNMSLMMYYLKQYDDSILYATYLLDMDNVPNLDKAKAYYRRGNSYYMKKLLEDAKKDYK 355

Query: 401 KAKECNPDN 409
           K KE NPD+
Sbjct: 356 KCKENNPDD 364

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            + A+ +   P  V YSNRSA +    + ++ + D T  ++
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A   LGN  +A
Sbjct: 69  INPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L    + ++D   A++  P++ +  +R+ATA  ++  +A+A+
Sbjct: 418 RAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPNFVRAYIRKATAQIAIKEYANAL 477

Query: 186 LDLSAV-----SLYGGYNSQSI 202
             L        S+  G NS  I
Sbjct: 478 DTLEEAKSKDSSVNNGANSNEI 499

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 362 LQYFDKALELAPNSSAVYY-HRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLA 420
           ++ F KA+E++P  + V Y +R   Y   +QF+++  D  +  + NP     Y +L    
Sbjct: 25  IELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVKINPTWSKGYNRLGAAE 84

Query: 421 YRENKFEDCETLFSEA 436
           +     E+ E  + EA
Sbjct: 85  FGLGNLEEAEKNYKEA 100

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            + A+ + + P  V YSNRSA +    K  + ++D     +
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P ++K   R   A+  +GN  DA
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L      + D   A+E  P++ +  +R+ATA  ++ +F+ A+
Sbjct: 414 RAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPNFVRAYIRKATAQIAVKDFSYAI 473

Query: 186 LDLSA-----VSLYGGYNSQSIE 203
             L A       + GG N++ I+
Sbjct: 474 ETLDAARTKDAEVNGGANAREID 496

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 127 LKKDP---VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFAD 183
           ++ DP   +FYSNR+   + L+     + D T A+EL     K   RR  AN  L NF  
Sbjct: 36  IETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNSSNLKAYHRRGLANIGLLNFKS 95

Query: 184 AMLDLSAVSLY 194
           A  D + V  Y
Sbjct: 96  ARNDFNIVLKY 106

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 82/210 (39%), Gaps = 9/210 (4%)

Query: 341 RPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFD 400
           +P ++  +  + + +   DE ++ FDKA +L PN    Y  +G  Y     ++ +   + 
Sbjct: 589 KPETWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYR 648

Query: 401 KAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDL 460
           KA   +  +   Y  +   + +  ++E     F +AR   P+   +       +   G+ 
Sbjct: 649 KAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQ 708

Query: 461 ESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRS 520
           E AL  YE A +++          A L+              + +A   FEE  K  P  
Sbjct: 709 EKALNYYELACQIQPTSSLAKFKRAHLLYSM---------AKYTQALDAFEELIKIAPEE 759

Query: 521 EQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
              +  L QL     +  +AI+ +  A +L
Sbjct: 760 ATVQFILGQLYQIMGRKKDAIKRYTIAMNL 789

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            + A+   + P  V YSNRSAC+  L K  + + D    ++
Sbjct: 7   KKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECVK 66

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A   LG   +A
Sbjct: 67  INPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   YSNR+A    L    + ++D   A+   P++ +  +R+ATA  ++  FA A+
Sbjct: 430 RAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRKATAQIAVREFASAI 489

Query: 186 LDLSA-----VSLYGGYNSQSIE 203
             L A       L  G N + I+
Sbjct: 490 ETLDAARAKDTELNNGANVREID 512

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 352 MADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDN 409
           + D+ +TD  +++F  AL + PN    +   GQ YF   + E S K F+KA E +PD+
Sbjct: 695 LEDQNETDS-IEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPDH 751

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 2/113 (1%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKE 404
           Y  + +   +K +  E +++F  AL +  N    +   GQ Y+   + E S K F+KA E
Sbjct: 681 YRVLGVSYLEKQKEPESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATE 740

Query: 405 CNPDNIFP-YIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSD 456
             PD++F  Y +   LA    ++E C  + +    K P           IL D
Sbjct: 741 LAPDHLFAGYFKAISLA-GIGEYEQCIEIIAALLEKLPNEESFQVSMVNILID 792

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%)

Query: 127 LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           L  + ++Y+NR+A    L + E+ ++D  +A+++ P YSK   R A A   LG   +A+
Sbjct: 131 LPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEAL 189

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 132 VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESL 178
           V+YSNR+A +  L + E+ V+D   A+E+ P YSK   R   A  +L
Sbjct: 130 VYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYAL 176

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 12/118 (10%)

Query: 359 DEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLAC 418
           DE ++ +  A+E++P+++  Y +R   Y   +Q+E++ KD ++A E +P     + +L  
Sbjct: 112 DEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGF 171

Query: 419 LAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSD--KGDLESALKEYEFARKLE 474
             Y  NK E+    +           +V +   E  +D  K D E+A K+ E +  LE
Sbjct: 172 AKYALNKPEEALDAYK----------KVLDIEGEKATDVMKRDYETAKKKVETSMNLE 219

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 66/170 (38%), Gaps = 13/170 (7%)

Query: 383 GQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPT 442
           G+++F    ++ S   F   ++  P  +      + L +  +       L +E     P 
Sbjct: 474 GKLHFELVNYDVSLHYFTNLRKLQPTRVSDLEIYSTLLWHLHDKVKLSILANELVMNIPN 533

Query: 443 APEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGD 502
           AP+        LS + D E A+K +E A +           V P    A  L    HS +
Sbjct: 534 APQTWCCMGNFLSLQKDHEDAIKAFEKATQ-----------VDPNFAYAYTLQGHEHSSN 582

Query: 503 --FAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
             F  A   + +A   DP+   A  GL    ++  Q DEA+  FE+A  +
Sbjct: 583 DSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSI 632

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 83/209 (39%), Gaps = 9/209 (4%)

Query: 342 PNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDK 401
           P ++  M   ++ +   ++ ++ F+KA ++ PN +  Y  +G  +     F+ +   + K
Sbjct: 535 PQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRK 594

Query: 402 AKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLE 461
           A  C+P +   Y  L     +  ++++    F +AR   P    +       L      E
Sbjct: 595 ALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQE 654

Query: 462 SALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSE 521
            AL  YE A +L+ +    +   A L+            G ++ A   FEE  K  P   
Sbjct: 655 KALSYYELACELQPSSSLANFKRAHLLYSM---------GRYSVALQYFEELTKLAPDEA 705

Query: 522 QAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
                L QL     +  +A++ F  A +L
Sbjct: 706 TVHFLLGQLYQILGRKKDAVKEFTIAMNL 734

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%)

Query: 349 ALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNP 407
           A ++   G+    LQYF++  +LAP+ + V++  GQ+Y +  + + + K+F  A   +P
Sbjct: 678 AHLLYSMGRYSVALQYFEELTKLAPDEATVHFLLGQLYQILGRKKDAVKEFTIAMNLDP 736

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 59/143 (41%), Gaps = 1/143 (0%)

Query: 333 QKAVDLHPRP-NSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQ 391
           +KA+   P+  N+Y  + +     GQ DE L +F+KA  + P +  +    G      Q 
Sbjct: 593 RKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQY 652

Query: 392 FEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYA 451
            EK+   ++ A E  P +     + A L Y   ++      F E  +  P    V     
Sbjct: 653 QEKALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEATVHFLLG 712

Query: 452 EILSDKGDLESALKEYEFARKLE 474
           ++    G  + A+KE+  A  L+
Sbjct: 713 QLYQILGRKKDAVKEFTIAMNLD 735

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%)

Query: 130 DPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           DP++YSNRS  ++ +N  E  + D    + +  ++SK  +R A        + DA+
Sbjct: 170 DPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 58/129 (44%), Gaps = 17/129 (13%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
           L Y  K+LE+ P+ +  +YH G+++ +   +  +   F +A   +  N   +  +  L Y
Sbjct: 284 LSYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 343

Query: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKG--------DLESALKEYEFARKL 473
           + +++ D    ++ A R  P       + +E+  D G         L  AL  Y+ A +L
Sbjct: 344 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARL 396

Query: 474 EDAQEGIHV 482
           +   E IH+
Sbjct: 397 D--PENIHI 403

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 70/147 (47%), Gaps = 18/147 (12%)

Query: 265 GLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNE 324
           G+ C+   K G Y+ +  +F KA  +       +  +  L     +ALE +G     + +
Sbjct: 513 GMSCI---KLGQYDEALLHFEKARSI-------NPVNVILNCCCGVALERLG----RREK 558

Query: 325 PLEAYKLLQKAVDLHPRPNSYIYM-ALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRG 383
            L+ Y+L   A +L P  +  ++  + ++ + GQ    LQ F+K  +L PN + V++  G
Sbjct: 559 ALDFYQL---ACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPVHFLLG 615

Query: 384 QMYFVTQQFEKSGKDFDKAKECNPDNI 410
           Q+Y +  + + +   F  A   +P+ I
Sbjct: 616 QLYQIVGRKKDAITQFTIAMNLDPNGI 642

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 69/168 (41%), Gaps = 4/168 (2%)

Query: 327 EAYKLLQKAVDLHPR-PNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQM 385
           EA K L+KA  L+P+   +Y       ++    D     + KAL + PN    +Y  G  
Sbjct: 456 EAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMS 515

Query: 386 YFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPE 445
                Q++++   F+KA+  NP N+           R  + E     +  A    P +  
Sbjct: 516 CIKLGQYDEALLHFEKARSINPVNVILNCCCGVALERLGRREKALDFYQLACELQPNSSL 575

Query: 446 VPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPL---VGK 490
                +++L + G   +AL+ +E   +L   +  +H  +  L   VG+
Sbjct: 576 ALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPVHFLLGQLYQIVGR 623

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 79/204 (38%), Gaps = 13/204 (6%)

Query: 347 YMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECN 406
           Y +LI  D G   E ++ F+KA  L    +  Y  +G  +   + ++ +   + KA  C+
Sbjct: 530 YFSLI-KDHG---EAIKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKAIACD 585

Query: 407 PDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKE 466
           P +   Y  L   A R  K++     F +AR   P    +       L      + AL  
Sbjct: 586 PQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNAILICCCGHSLEKLNLPDQALTY 645

Query: 467 YEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIG 526
           YE A KL+           P   KA +L      G F+ A  +FE   K  P        
Sbjct: 646 YELAEKLQPEM------TIPKYKKAQLLFSL---GKFSSAMYIFESLTKLSPEEVTVHFM 696

Query: 527 LAQLKLQQEQVDEAIQLFEEATDL 550
           L Q+     +  +AI+ +  A +L
Sbjct: 697 LGQIYQTMGRKKDAIKEYTIALNL 720

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 60/265 (22%), Positives = 107/265 (40%), Gaps = 25/265 (9%)

Query: 242 IFPSETSFANYDEQSEADNF--LLKGLR------CLSERKTGSYEMSDEYFNKAADLLSL 293
           I P  T F  Y+ +   + F  LL  LR       LS+    S+  + E +    +  SL
Sbjct: 474 ILPELTKFPTYENEGPGNFFQLLLWHLRDKFTLFNLSDELMNSFPEAPETWCVVGNYFSL 533

Query: 294 ------SHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLL-QKAVDLHPRP-NSY 345
                 + +A  +  +L  K A A    G  +   NE  +  K++ +KA+   P+  N+Y
Sbjct: 534 IKDHGEAIKAFEKATSLDRKFAYAYTLQG-HEHAANETYDTAKIMYRKAIACDPQHYNAY 592

Query: 346 IYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKEC 405
             +    +  G+ D+ L YF+KA  + P ++ +    G         +++   ++ A++ 
Sbjct: 593 YGLGDCASRLGKYDKALLYFEKARVINPVNAILICCCGHSLEKLNLPDQALTYYELAEKL 652

Query: 406 NPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALK 465
            P+   P  + A L +   KF     +F    +  P    V     +I    G  + A+K
Sbjct: 653 QPEMTIPKYKKAQLLFSLGKFSSAMYIFESLTKLSPEEVTVHFMLGQIYQTMGRKKDAIK 712

Query: 466 EYEFARKLE--------DAQEGIHV 482
           EY  A  L+        DA +  H+
Sbjct: 713 EYTIALNLDPMGNQVIIDALQKCHI 737

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 61/149 (40%), Gaps = 30/149 (20%)

Query: 407 PDNIFPYIQLACLAYRENKFEDCETLFS---EARRKFPTAPE---VPNFYAEILSDKGDL 460
           P N F  +    L +  +KF    TLF+   E    FP APE   V   Y  ++ D G+ 
Sbjct: 489 PGNFFQLL----LWHLRDKF----TLFNLSDELMNSFPEAPETWCVVGNYFSLIKDHGE- 539

Query: 461 ESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGD--FAEATALFEEACKKDP 518
             A+K +E A  L+                A  L    H+ +  +  A  ++ +A   DP
Sbjct: 540 --AIKAFEKATSLDRK-----------FAYAYTLQGHEHAANETYDTAKIMYRKAIACDP 586

Query: 519 RSEQAKIGLAQLKLQQEQVDEAIQLFEEA 547
           +   A  GL     +  + D+A+  FE+A
Sbjct: 587 QHYNAYYGLGDCASRLGKYDKALLYFEKA 615

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%)

Query: 132 VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191
           +F+SNR+   + L+  +  ++D  +ALEL P   K   RR  +   L +F  A  DLS V
Sbjct: 48  IFFSNRALAQLKLDNFQSCLDDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV 107

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 12/98 (12%)

Query: 333 QKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQF 392
           Q+A+DL    N YI       +K  T + ++Y+ KA+EL    S  + +R         F
Sbjct: 11  QQAIDLKNEGNKYI------KEKKYT-KAVEYYTKAIELDSTQSIFFSNRALAQLKLDNF 63

Query: 393 EKSGKDFDKAKECNPDNIFPY-----IQLACLAYRENK 425
           +    D + A E +P NI  Y      QL  L +++ K
Sbjct: 64  QSCLDDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAK 101

>AGR398W Chr7 (1459591..1462764) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL145C (CTR9)
          Length = 1057

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 6/89 (6%)

Query: 458 GDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHS-GDFAEATALFEEACKK 516
           GD E  +  Y+     E +  G  VG + L   A    R  ++  D+ +A +LF+EA +K
Sbjct: 308 GDYEKVISLYQ-----EISNWGYLVGTSVLSESAFWCGRAYYARQDYRKAFSLFQEALRK 362

Query: 517 DPRSEQAKIGLAQLKLQQEQVDEAIQLFE 545
           +  +  AK GL Q ++Q   V+E+I  FE
Sbjct: 363 NEDNLLAKFGLGQTQIQNNLVEESILTFE 391

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN+ F            + A+ + + P  V +SNRSAC+       K ++D    ++
Sbjct: 7   KQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVK 66

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P ++K   R   A+  LG+  +A
Sbjct: 67  INPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R   D   YSNR+A    L      + D   A+E  P++ +  +R+AT   ++ ++A A+
Sbjct: 418 RNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPNFVRAYIRKATGQIAIKDYAGAI 477

Query: 186 LDLSA-----VSLYGGYNSQSIE 203
             L +       +  G N++ I+
Sbjct: 478 ETLDSARTKDAEVNSGANTREID 500

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 1/95 (1%)

Query: 98  SMAMKDKGNECFXXXXXXXXXXXXSCALRLKK-DPVFYSNRSACWVPLNKLEKVVEDTTA 156
           ++  KD+GN+              + A+ L     +F+SNR+   + L++ +  +ED++ 
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 157 ALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191
           A+EL     K   RR  A   L +F  A  DL  V
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 17/129 (13%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
           L Y  K+LE+ P+ +  +YH G+++ +   +  +   F +A   +  N   +  +  L Y
Sbjct: 290 LNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 349

Query: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKG--------DLESALKEYEFARKL 473
           + +++ D    ++ A R  P       + +E+  D G         L  AL  Y  A +L
Sbjct: 350 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYRQASRL 402

Query: 474 EDAQEGIHV 482
           +   + +H+
Sbjct: 403 DP--DNVHI 409

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 127 LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           L  + V+Y+NR+A    L K E+ V+D   A+++ P YSK   R   A  +LG   +A+
Sbjct: 127 LPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEAL 185

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 9/89 (10%)

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192
            ++NR+AC + L    + +ED + AL + P   KC  R + A  SL    +A     + +
Sbjct: 123 LFANRAACELELKNYRRCIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA----KSAA 178

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRK 221
           ++    +QSIEP  +  +N   + V++RK
Sbjct: 179 IFA---NQSIEPENKSILN--MLSVIERK 202

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (56%)

Query: 354 DKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIF 411
           ++ Q  + +++F  AL + PN+   +   GQ Y    + E S + F+KA E +PD+++
Sbjct: 680 ERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLY 737

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 53/104 (50%), Gaps = 7/104 (6%)

Query: 449 FYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAP--LVGKATVLARQSHSGDFAEA 506
           +  E   + G+  +A    +   K + A++ +     P  ++G A  L RQ  S    +A
Sbjct: 633 YMVETYCNSGNWSAAESISKILVKTDGAKKYLRYTCWPFRVIGIAN-LERQQES----DA 687

Query: 507 TALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
              F+ A + +P + ++ +GL Q  L   +++ +I++FE+AT+L
Sbjct: 688 IEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATEL 731

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            + A+ + + P  V YSNRSAC+    K E+ ++D    ++
Sbjct: 7   KQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVK 66

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P +SK   R   A   L    +A
Sbjct: 67  ISPSWSKGYNRVGAAQFGLSQLDEA 91

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 35/64 (54%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R  +D   +SNR+A    L    + +ED   A+ + P++ +  +R+ATA  ++  FA A+
Sbjct: 409 RAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRKATAQIAVKEFAAAI 468

Query: 186 LDLS 189
             L+
Sbjct: 469 ETLN 472

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 316 GIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIY--MALIMADKGQTDEYLQYFDKALELAP 373
           G   FL  + ++A  L  KA+++   PN  +Y   +   A   + +E L+  ++ ++++P
Sbjct: 10  GNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVKISP 69

Query: 374 NSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDN 409
           + S  Y   G   F   Q +++ K + +A E +  N
Sbjct: 70  SWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSN 105

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 86/210 (40%), Gaps = 9/210 (4%)

Query: 341 RPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFD 400
           +P ++  +  + + +   DE ++YF+KA E+ P+ +  Y  +G  +      + +   + 
Sbjct: 508 KPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYR 567

Query: 401 KAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDL 460
           KA   +P +   Y  L     +  ++E+    F +AR   P    +       L      
Sbjct: 568 KAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNVILICCCGVALEKMSYQ 627

Query: 461 ESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRS 520
           E AL+ YE A +L+ +        A L+    V+AR      ++ A   FEE  +  P  
Sbjct: 628 EKALQYYELASELQPSSSLAKFKKAHLL---YVMAR------YSVALENFEELAELAPDE 678

Query: 521 EQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
                 L QL     +  +A++ F  A +L
Sbjct: 679 ATVHFLLGQLYQIMGRKKDAVKEFTIAMNL 708

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 58/129 (44%), Gaps = 17/129 (13%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
           L    K+LE+ P+ +A +YH G+++ +   +  +   F +A   +  N   +  +  L Y
Sbjct: 291 LNLLLKSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 350

Query: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKG--------DLESALKEYEFARKL 473
           + +++ D    ++ A R  P       + +E+  D G         L  AL  Y+ A +L
Sbjct: 351 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNKQLNDALDAYKQAARL 403

Query: 474 EDAQEGIHV 482
           +   + +H+
Sbjct: 404 DP--DNVHI 410

>Skud_15.9 Chr15 complement(14799..18050) [3252 bp, 1083 aa] {ON}
           YOL145C (REAL)
          Length = 1083

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 23/126 (18%)

Query: 428 DCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPL 487
           D  T+FSE +      P +          KGD ++ L  Y              + ++PL
Sbjct: 286 DLNTVFSENQ----NHPVLLTLLQTYYYFKGDYQTVLNIYHHKI----------IKMSPL 331

Query: 488 VGKATVLARQSHS--------GDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDE 539
           + K TVL+  S          GD+ ++  +F+E+ KK+  +  AK+GL Q +++   ++E
Sbjct: 332 IAK-TVLSESSFWCGRAHYALGDYRKSFIMFQESLKKNEDNLLAKLGLGQTQIKNNLLEE 390

Query: 540 AIQLFE 545
           +I  FE
Sbjct: 391 SIITFE 396

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 136 NRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADA 184
           NR+ACW  + +LEK + D T    ++P   KC +R+    + L    DA
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDA 147

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 69/147 (46%), Gaps = 18/147 (12%)

Query: 265 GLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNE 324
           G+ C+   K G Y+ +  +F KA  +       +  +  L     +ALE +G     + +
Sbjct: 532 GMSCI---KLGQYDEALLHFEKARSI-------NPVNVILNCCCGVALERLG----RREK 577

Query: 325 PLEAYKLLQKAVDLHPRPNSYIYM-ALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRG 383
            L+ Y+L   A +L P  +  ++  + ++ + GQ    LQ F+K  +L PN + +++  G
Sbjct: 578 ALDFYQL---ACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPIHFLLG 634

Query: 384 QMYFVTQQFEKSGKDFDKAKECNPDNI 410
           Q+Y +  + + +   F  A   +P  I
Sbjct: 635 QLYQIVGRKKDAITQFTIAMNLDPKGI 661

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 85/217 (39%), Gaps = 10/217 (4%)

Query: 307 KLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPR-PNSYIYMALIMADKGQTDEYLQYF 365
           K AI    +G    L  +  EA K L+KA +L PR   +Y       ++    D     +
Sbjct: 455 KSAITWCCLGNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCY 514

Query: 366 DKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENK 425
            KAL + PN    +Y  G       Q++++   F+KA+  NP N+           R  +
Sbjct: 515 RKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVILNCCCGVALERLGR 574

Query: 426 FEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVA 485
            E     +  A    P +       +++L + G   +AL+ +E   +L   +  IH    
Sbjct: 575 REKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNFEKLEQLTPNEAPIHF--- 631

Query: 486 PLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQ 522
            L+G+   +      G   +A   F  A   DP+  Q
Sbjct: 632 -LLGQLYQIV-----GRKKDAITQFTIAMNLDPKGIQ 662

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 78/199 (39%), Gaps = 13/199 (6%)

Query: 276 SYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKA 335
           +YEMS +YF    +L          D  +   L   L        L +E LE  +L    
Sbjct: 356 NYEMSKKYFAALRELQPFR----IPDMEIFSTLLWHLNDTTGLSHLCHELLEVNRL---- 407

Query: 336 VDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKS 395
                 P ++  +  + + K   +E ++ F ++ +L P+ +  Y  +G  Y     F+ +
Sbjct: 408 -----APETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTA 462

Query: 396 GKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILS 455
              + KA   NP +   +  L     +  ++E+C   F +AR   P    +       L 
Sbjct: 463 MTCYRKALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINPVNVILICCCGVALE 522

Query: 456 DKGDLESALKEYEFARKLE 474
                E AL+ Y+ A +L+
Sbjct: 523 KLSHQEKALQYYDLACELQ 541

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPD 408
           LQY+D A EL P SS   + R Q+     ++  + ++F+K     PD
Sbjct: 531 LQYYDLACELQPVSSLALFKRAQLLLAMGKYNFALENFEKLVTIAPD 577

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 67/144 (46%), Gaps = 18/144 (12%)

Query: 265 GLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNE 324
           G+ CL   K G YE    +F KA  +       +  +  L     +ALE +      + +
Sbjct: 484 GMCCL---KLGQYEECLLHFEKARSI-------NPVNVILICCCGVALEKLSH----QEK 529

Query: 325 PLEAYKLLQKAVDLHPRPNSYIY-MALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRG 383
            L+ Y L   A +L P  +  ++  A ++   G+ +  L+ F+K + +AP+ + +++  G
Sbjct: 530 ALQYYDL---ACELQPVSSLALFKRAQLLLAMGKYNFALENFEKLVTIAPDEATIHFLLG 586

Query: 384 QMYFVTQQFEKSGKDFDKAKECNP 407
           Q+Y +  + + + K+   A   +P
Sbjct: 587 QLYQIVGRKQDAVKELTIAMNLDP 610

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 77/173 (44%), Gaps = 23/173 (13%)

Query: 262 LLKGLRCLSERKTGSYEMSD-EYFN--KAADLLSLSHQADSEDPALRMKLAIALEHVGIF 318
           LLK L CL       Y M + E++N   A   L  S + D  D       +    ++G  
Sbjct: 378 LLKQLGCL-------YSMENVEFYNLDIAMGHLVKSLELDPTD-------STTWYYLGRI 423

Query: 319 KFLKNEPLEAYKLLQKAVDLHPR-PNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSA 377
              K +   AY+ LQ+AV+   R P  +  + ++    GQ  + L  + +A+ L P  S 
Sbjct: 424 HMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISE 483

Query: 378 VYYHRGQMY-FVTQQFEKSGKDFDKAKECNPDNIFPYIQ--LACLAYRENKFE 427
           V+Y+ G +Y     Q   +   +++A   +P+N  P IQ  L  L  ++ K E
Sbjct: 484 VWYNLGTLYETCNDQITDALDSYERALSLDPEN--PVIQGRLNALKIQDKKSE 534

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 49/117 (41%), Gaps = 1/117 (0%)

Query: 359 DEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLAC 418
           D  + +  K+LEL P  S  +Y+ G+++   + F  + +   +A   +  N   +  +  
Sbjct: 397 DIAMGHLVKSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGV 456

Query: 419 LAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGD-LESALKEYEFARKLE 474
           L Y+  +  D    ++ A R  P   EV      +     D +  AL  YE A  L+
Sbjct: 457 LYYQIGQNHDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDALDSYERALSLD 513

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 56/129 (43%), Gaps = 17/129 (13%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
           L Y  K+LE  P+ +  +YH G+++ +   +  +   F +A   +  N   +  +  L Y
Sbjct: 286 LDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 345

Query: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKG--------DLESALKEYEFARKL 473
           + +++ D    ++ A R  P       + +E+  D G         L  AL  Y+ A +L
Sbjct: 346 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARL 398

Query: 474 EDAQEGIHV 482
           +     IH+
Sbjct: 399 D--VNNIHI 405

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 132 VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           ++Y+NR+A +  L   EK  ED  +A+ + P+YSK   R   A  +L    +A+
Sbjct: 134 IYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEAL 187

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%)

Query: 365 FDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYREN 424
           + +A+ ++PN++  Y +R   Y   + FEK+ +D + A   +P+    Y +L    Y  N
Sbjct: 122 YSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALN 181

Query: 425 KFEDC 429
           K E+ 
Sbjct: 182 KPEEA 186

>Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {ON}
           YJR032W (CPR7) - peptidyl-prolyl cis/trans isomerase
           [contig 270] FULL
          Length = 395

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALELAPNSSAV-----YYHRGQMYFVTQQFEKSGKDF 399
           Y+ ++L+M +  + +E + Y    LE+ P +S++     YY  G  +F  ++++K+  DF
Sbjct: 297 YLNLSLVMFNLKRYEEAITYTTYLLEI-PEASSIDKAKAYYRSGNCHFAKKRYDKALSDF 355

Query: 400 DKAKECNPDN 409
              KE NPD+
Sbjct: 356 KCCKENNPDD 365

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 53/121 (43%), Gaps = 15/121 (12%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
           L Y  K+LE  P+ +  +YH G+++ +   +  +   F +A   +  N   +  +  L Y
Sbjct: 284 LDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 343

Query: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKG--------DLESALKEYEFARKL 473
           + +++ D    ++ A R  P       + +E+  D G         L  AL  Y+ A +L
Sbjct: 344 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLSDALDAYKQAARL 396

Query: 474 E 474
           +
Sbjct: 397 D 397

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%)

Query: 127 LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           L  + V+Y+NR+A    +   E+ ++D  +A++  P YSK   R   A  +LG   DA+
Sbjct: 127 LPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDAL 185

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 2/85 (2%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDP--VFYSNRSACWVPLNKLEKVVEDTTAALE 159
           K +GN  F            + A+ + + P  V YSNRSA +    + E+ + D    ++
Sbjct: 9   KQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIK 68

Query: 160 LKPDYSKCLLRRATANESLGNFADA 184
           + P ++K   R+  A + L  + +A
Sbjct: 69  INPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 2/66 (3%)

Query: 126 RLKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           R   D   YSNR+A    L      + D   A+E  P + +  LR+AT   ++  FA A+
Sbjct: 414 RAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPSFIRAYLRKATCQIAVKEFAGAI 473

Query: 186 --LDLS 189
             LDL+
Sbjct: 474 ETLDLA 479

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 1/92 (1%)

Query: 365 FDKALELAPNSSAVYY-HRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRE 423
           F KA+E++   + V Y +R   Y  ++Q+E++  D D+  + NP     Y +        
Sbjct: 28  FTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIKINPSWAKGYTRKGAALQGL 87

Query: 424 NKFEDCETLFSEARRKFPTAPEVPNFYAEILS 455
           +K+E+ E  ++E  +  P      +  A+I+S
Sbjct: 88  HKYEEAEQCYNETLKIDPNNAIAKDSLAQIVS 119

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
           L Y  K+LE  P+ +  +YH G+++ +   +  +   F +A   +  N   +  +  L Y
Sbjct: 282 LDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 341

Query: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDL 460
           + +++ D    ++ A R  P       + +E+  D G L
Sbjct: 342 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 373

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 38.1 bits (87), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 3/95 (3%)

Query: 341 RPNSYIYMALIMA--DKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKD 398
           R N++ +  + +A  +K +  + +++F  AL + PN    +   GQ Y    + E S K 
Sbjct: 692 RSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKV 751

Query: 399 FDKAKECNPDNIFP-YIQLACLAYRENKFEDCETL 432
           FDKA E  P + +  Y +   L       E  ETL
Sbjct: 752 FDKAIELQPSHTYARYFRALSLCDMGEYLESLETL 786

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 37.7 bits (86), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 45/99 (45%), Gaps = 7/99 (7%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
           L Y  K+LE  P+ +  +YH G+++ +   +  +   F +A   +  N   +  +  L Y
Sbjct: 276 LDYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYY 335

Query: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDL 460
           + +++ D    ++ A R  P       + +E+  D G L
Sbjct: 336 QISQYRDALDAYTRAIRLNP-------YISEVWYDLGTL 367

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 37.7 bits (86), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 44/101 (43%), Gaps = 1/101 (0%)

Query: 367 KALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKF 426
           K  E  P SS  ++  G  YF      ++ K F KA   +P+  + ++  A     E + 
Sbjct: 413 KLAESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEH 472

Query: 427 EDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEY 467
           E   + +S A R FP    +P+ Y  +   + D  +  +EY
Sbjct: 473 EQALSAYSTAARFFP-GTHLPHLYLGMQYSRMDTLTLAEEY 512

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 83/229 (36%), Gaps = 5/229 (2%)

Query: 363 QYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYR 422
           +YF KA  L PN    +      Y V  + E++   +  A    P    P++ L     R
Sbjct: 443 KYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSR 502

Query: 423 ENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHV 482
            +     E  F  A    PT P + N    +   K D   A K ++ A +  + Q+    
Sbjct: 503 MDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINMQQSDAS 562

Query: 483 GVAPLVGKATVLARQSHSGDFAE-ATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAI 541
            VA  +     L       D  E A   F+   ++   S      LA + L+ +++ +AI
Sbjct: 563 SVA--ISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAI 620

Query: 542 QLFEEATDLARAFEEKLQATTFAEAAKIQKRI-RADPIM-SAKIQETLE 588
                   +    +   Q    A    +   +    P+M SAKI E ++
Sbjct: 621 DALHSVLAMEPNHQTGQQLLKIALDVNVHLPLDNGHPLMVSAKISENMK 669

>CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa]
           {ON} similar to uniprot|P89105 Saccharomyces cerevisiae
           YOL145c CTR9 required for G1 cyclin expression
          Length = 1110

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 30/45 (66%)

Query: 501 GDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFE 545
           GD+ +A  +F+E+ K+D  +  A++GL Q +++   V+E+I  FE
Sbjct: 351 GDYRKAFTMFQESLKRDENNLLARLGLGQTQIKNSLVEESILTFE 395

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
           complex component and TPR protein, mediates 3'-5' RNA
           degradation by the cytoplasmic exosome; null mutants
           have superkiller phenotype of increased viral dsRNAs and
           are synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 341 RPNSYIYMALIMA--DKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKD 398
           R N++ +  + +A  +K +  + +++F  AL + PN    +   GQ Y    + E S K 
Sbjct: 699 RSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKV 758

Query: 399 FDKAKECNPDNIF 411
           FDKA +  P + F
Sbjct: 759 FDKAIQLRPSHTF 771

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 88  SFTEEQKERYSMAMKDKGNECFXXXXXXXXXXXXSCALRLK-KDPVFYSNRSACWVPLNK 146
           S   E+  + ++  K++GN               S A+ L     +F+SNR+   + L+ 
Sbjct: 2   SIVSEEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDN 61

Query: 147 LEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191
               +ED   ++EL P   K + RR  +   L  F+ A  DL  +
Sbjct: 62  FLTALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 44/101 (43%), Gaps = 1/101 (0%)

Query: 367 KALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKF 426
           K  E  P SS  ++  G  YF      ++ K F KA   +P+  + ++  A     E + 
Sbjct: 423 KLAESFPKSSVTWFAVGTYYFSINNIPEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEH 482

Query: 427 EDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEY 467
           E   + +S A R FP    +P+ Y  +   + D  +  +EY
Sbjct: 483 EQALSAYSTAARFFP-GTHLPHLYLGMQYSRMDTLTLAEEY 522

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 83/226 (36%), Gaps = 5/226 (2%)

Query: 363 QYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYR 422
           +YF KA  L PN    +      Y V  + E++   +  A    P    P++ L     R
Sbjct: 453 KYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSAYSTAARFFPGTHLPHLYLGMQYSR 512

Query: 423 ENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHV 482
            +     E  F  A    PT P + N    +   K D   A K ++ A +  ++Q+    
Sbjct: 513 MDTLTLAEEYFMMAYDICPTDPLLLNELGVVYFKKMDYPRAKKFFKRACEAINSQQSDAS 572

Query: 483 GVAPLVGKATVLARQSHSGDFAE-ATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAI 541
            VA  +     L       D  E A   F+   ++   S      LA + L+ +++ +AI
Sbjct: 573 SVA--ISTYLNLGHTYRKLDEDERALHCFKTVLERWKPSANVWCALATVYLKMKKLQKAI 630

Query: 542 QLFEEATDLARAFEEKLQATTFAEAAKIQKRI-RADPIM-SAKIQE 585
                   +  + +   Q    A    +   +    P+M SAKI E
Sbjct: 631 DALHSVLAMDPSHQTGQQLLKIALDVNVHLPLDNGHPLMVSAKINE 676

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%)

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADA 184
            Y+NR+AC + L    + + D   AL L P   KC  R A A  ++  F D 
Sbjct: 114 LYANRAACELELKNYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

>KAFR0E01260 Chr5 complement(252045..254654) [2610 bp, 869 aa] {ON}
           Anc_3.265 YBR055C
          Length = 869

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 12/96 (12%)

Query: 284 FNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPN 343
            N+  +L++     +    +L +K AI LEH         EP   ++++++A  L   PN
Sbjct: 271 LNRCKELVAAGIHLNPNSKSLWIK-AIELEH---------EPFNKHRVIKRA--LQELPN 318

Query: 344 SYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVY 379
                 L++  +   DE L+  +KA+E  P+S  ++
Sbjct: 319 DETLWKLVIKHENDKDEALKILEKAVEFVPDSMDLW 354

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 52/121 (42%), Gaps = 15/121 (12%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421
           L Y  ++LE+    S  +YH G+++ +   +  + + F +A   +  N   +  +  L Y
Sbjct: 272 LNYLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYY 331

Query: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKG--------DLESALKEYEFARKL 473
           +  ++ D    ++ A R  P       + +E+  D G         L  AL  Y+ A +L
Sbjct: 332 QIYQYRDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARL 384

Query: 474 E 474
           E
Sbjct: 385 E 385

>TBLA0C01590 Chr3 complement(370571..371797) [1227 bp, 408 aa] {ON}
           Anc_1.456 YJR032W
          Length = 408

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALEL--AP--NSSAVYYHRGQMYFVTQQFEKSGKDFD 400
           Y+ M L+M D  + +E +QY    +E+   P  + +  YY  G  Y   ++ E + KD++
Sbjct: 295 YLNMCLMMFDMQKYEEAIQYATYIIEMENVPKLDVAKAYYRSGNCYLAKKRLEDALKDYN 354

Query: 401 KAKECNPDN 409
             KE NP++
Sbjct: 355 LCKENNPND 363

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 52/105 (49%), Gaps = 7/105 (6%)

Query: 448 NFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAP--LVGKATVLARQSHSGDFAE 505
           N+  E+ +   +  SA++  E   K E A+  +     P  ++G    L RQ  S    +
Sbjct: 629 NYMTEVYAKSNNWSSAVQIAERLVKAEKAKRVLQTMNWPYRVIGIGN-LERQQES----D 683

Query: 506 ATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
           +   F+ A + DP   ++ IGL Q  L   +++ +I++FE+A +L
Sbjct: 684 SIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIEL 728

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%)

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADA 184
            ++NR+AC + L      V D   A+E+ P   KC  R   A  +LG F +A
Sbjct: 125 LFANRAACELELKNYRSCVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>Suva_15.15 Chr15 complement(27309..30623) [3315 bp, 1104 aa] {ON}
           YOL145C (REAL)
          Length = 1104

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 19/97 (19%)

Query: 457 KGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHS--------GDFAEATA 508
           KGD ++ L  Y              + ++PL+ K TVL+  S          GD+ ++  
Sbjct: 335 KGDFQTVLNIYHHKI----------LKMSPLIAK-TVLSESSFWCGRAHYALGDYRKSFI 383

Query: 509 LFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFE 545
           +F+E+ KK+  +  A++GL Q +++   ++E+I  FE
Sbjct: 384 MFQESLKKNEDNLLARLGLGQTQIKSNLLEESIITFE 420

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 62/148 (41%), Gaps = 1/148 (0%)

Query: 328 AYKLLQKAVDLHP-RPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMY 386
           A +  +KA+   P   N+Y  + ++    GQ +E L +F+KA  + P +  +    G   
Sbjct: 581 AKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVAL 640

Query: 387 FVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEV 446
                 EK+ + ++ A E  P +     + A L Y   ++      F E +   P    V
Sbjct: 641 EKLSYQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATV 700

Query: 447 PNFYAEILSDKGDLESALKEYEFARKLE 474
                +I S  G  + A+KEY  A  L+
Sbjct: 701 HFLLGQIYSILGRKKDAIKEYTIALNLD 728

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 64/172 (37%), Gaps = 17/172 (9%)

Query: 383 GQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPT 442
           G++++    +E S + F   K   P  +      + L +  N       L SE     P 
Sbjct: 467 GKLHYELVNYEVSLQYFLNLKTLQPSRVKDLEIYSTLLWHLNDKSKLSILSSELITSNPR 526

Query: 443 APEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSH--- 499
            PE        LS + +   A+K +E A +           V P    A  L  Q H   
Sbjct: 527 IPETWCCLGNFLSLQKNHHEAIKAFEKATQ-----------VDPKFAYAYTL--QGHEYT 573

Query: 500 -SGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
            S  F  A   + +A   DP    A  GL  + ++  Q +EA+  FE+A  +
Sbjct: 574 SSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSI 625

>NDAI0G04870 Chr7 complement(1173964..1175148) [1185 bp, 394 aa]
           {ON} Anc_1.456
          Length = 394

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALEL----APNSSAVYYHRGQMYFVTQQFEKSGKDFD 400
           Y+ ++L++ +  + D+ + Y +  L++    + + +  YY RG   F  + +E S KD+ 
Sbjct: 296 YLNLSLVLFNLKKLDDAILYCNYLLDMENVPSLDKAKAYYRRGNCNFSKKHYEVSLKDYK 355

Query: 401 KAKECNPDN 409
             KE NPD+
Sbjct: 356 TCKEYNPDD 364

>Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} similar
           to Ashbya gossypii AEL281C
          Length = 1398

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKE 404
           Y  + +   +K Q  E +Q+F  A+ L    +  +   GQ Y V  +   S   ++KA E
Sbjct: 671 YRVLGIFYLEKQQEAEAIQWFQSAVRLDSLDTEAWIGLGQAYSVCGRIAASVNVYEKALE 730

Query: 405 CNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFP 441
            NP + F    LA    +  +FE    L S    ++P
Sbjct: 731 LNPKHKFARYLLAASLCQMGEFEKGIELLSVLNEEYP 767

>TBLA0C01010 Chr3 (198773..201367) [2595 bp, 864 aa] {ON} Anc_2.665
           YKL022C
          Length = 864

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 72/157 (45%), Gaps = 26/157 (16%)

Query: 262 LLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFL 321
           L  G++ +S     +  +++EYF        LS+  +  DP L       L  +G+  F 
Sbjct: 622 LFLGMQYMS---INTLSLAEEYF-------ILSYDINPNDPLL-------LNEMGVLYFK 664

Query: 322 KNEPLEAYKLLQKAVD-----LHPRPNSYIYMALIMADK----GQTDEYLQYFDKALELA 372
           K++  ++ K L++A+D     L+P   + + + + +A       + ++ +Q     LE++
Sbjct: 665 KSDLQKSKKFLKRALDASNKSLNPNSKTALSIQINLAHTFRKLNEFEKSVQLIKSVLEIS 724

Query: 373 PNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDN 409
             +S +  + G +Y   +QF+ +  +   A   NP N
Sbjct: 725 GKNSNLLCNLGFLYLKLRQFQYAIDNLHTALSINPSN 761

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADA 184
            Y+NR+AC + L    + +ED + AL + P   KC  R + A   L    +A
Sbjct: 123 LYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
           (REAL)
          Length = 1417

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 341 RPNSYIYMALIMA--DKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKD 398
           R N++ +  + +A  +K +  + +++F  AL + PN    +   GQ Y    + E S K 
Sbjct: 684 RKNNWPFRVVGIAHLEKQEESDSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEASIKV 743

Query: 399 FDKAKECNPDNIF 411
           FDKA +  P + +
Sbjct: 744 FDKAIQLRPSHTY 756

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%)

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
            Y+NR+AC + +    + + D   AL+L P   KC  R A A  +L    +A+
Sbjct: 121 LYANRAACELEIKNYRRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 60/143 (41%), Gaps = 15/143 (10%)

Query: 101 MKDKGNECFXXXXXXXXXXXXSCALRLKKDP-----VFYSNRSACWVPLNKLEKVVEDTT 155
            K++GNE +            +  + +K D        +SNR+AC + L    + V D  
Sbjct: 81  FKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCR 140

Query: 156 AALELKPDYSKCLLRRATANESLGNFADAMLDLSAVSLYGGYNSQS------IEPVLERN 209
            AL+  P   KC  R A A   L    DA     A+      +S+S      ++ V++R 
Sbjct: 141 QALQFNPTNIKCFYRIARAFFLLDKCEDAK---EAIEFGLKLDSESAALKALLQKVIKRE 197

Query: 210 MNKQAMQVLKRKLADGSKHQLPS 232
            +K+A +  KR   +  K +L +
Sbjct: 198 EDKKAHEA-KRLREETEKEKLKT 219

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%)

Query: 132 VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191
           +FYSNR+   + L+  +    D   AL L     K   RR  AN  L  F  A  DL+ V
Sbjct: 47  IFYSNRALAQLKLDNFQSAYNDCNEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 43/97 (44%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKE 404
           Y  + +   +K    E +++F  AL + P     +   GQ Y+   + E S K F+KA E
Sbjct: 684 YRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALE 743

Query: 405 CNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFP 441
            +P N + +   A    +   +++   +F E   + P
Sbjct: 744 VSPGNAYAHYFKALSLSKMGLYDESIEIFRELTAEHP 780

>SAKL0C13772g Chr3 (1211712..1214984) [3273 bp, 1090 aa] {ON}
           similar to uniprot|P89105 Saccharomyces cerevisiae
           YOL145C CTR9 Component of the Paf1p complex which is a
           large complex that binds to and modulates the activity
           of RNA polymerase II and is required for expression of a
           subset of genes including cyclin genes contains TPR
           repeats
          Length = 1090

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 30/45 (66%)

Query: 501 GDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFE 545
           GD+ +A  +F+E+ +++  +  AK GL Q ++Q + V+E+I  FE
Sbjct: 354 GDYRKAFLMFQESLRRNEDNLLAKFGLGQTQIQNKLVEESILTFE 398

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 100 AMKDKGNECFXXXXXXXXXXXXSCALRL-KKDPVFYSNRSACWVPLNKLEKVVEDTTAAL 158
           A+K +GN+              + A++L     V+Y+NR+A +    K ++ ++D  +A+
Sbjct: 105 ALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAI 164

Query: 159 ELKPDYSKCLLR 170
           +++P++SK   R
Sbjct: 165 KVEPNWSKGYSR 176

>Ecym_1366 Chr1 (753035..754213) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AEL062C
          Length = 392

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALEL----APNSSAVYYHRGQMYFVTQQFEKSGKDFD 400
           Y+ ++ ++    + DE + Y +  +E+    + + +  YY RG  Y V ++ E + +D+ 
Sbjct: 294 YLNLSFVLFILSRHDESITYANYLIEMEGVTSLDKAKAYYRRGNCYLVKKRLEDALQDYK 353

Query: 401 KAKECNPDN 409
             KE NP++
Sbjct: 354 NCKEYNPND 362

>Kpol_1020.18 s1020 complement(38564..40399) [1836 bp, 611 aa] {ON}
           complement(38564..40399) [1836 nt, 612 aa]
          Length = 611

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 7/70 (10%)

Query: 202 IEPVLERNMNKQAMQVLKRKLADGSKHQLPS------NTSLASFFGIFPSETSFANYDEQ 255
           I P +E+N N    + L  +  +   H+LPS      N  ++ F G FP ET+   +D  
Sbjct: 366 IWPFIEKNYNHDKKKPLHLRRTNEFLHKLPSIVLCTTNWLMSCFVGTFPIETTLRVWDCL 425

Query: 256 -SEADNFLLK 264
             E  NFL K
Sbjct: 426 FYEGSNFLFK 435

>KLTH0H14234g Chr8 (1236691..1237878) [1188 bp, 395 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 395

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALELAPNSSAV-----YYHRGQMYFVTQQFEKSGKDF 399
           Y+ + L+M ++ + ++ ++Y    LE+ P +S +     YY  G  + + ++F+K+  DF
Sbjct: 297 YLNLILVMFNQKKYEDAIKYSVYLLEI-PEASGLDRAKAYYRSGNCHLMKKRFDKALADF 355

Query: 400 DKAKECNPDN 409
           +  KE NP++
Sbjct: 356 NACKEHNPND 365

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 1/95 (1%)

Query: 98  SMAMKDKGNECFXXXXXXXXXXXXSCALRLKKD-PVFYSNRSACWVPLNKLEKVVEDTTA 156
           ++  K++GN+              + A++L     +++SNR+   + ++  +  + D   
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 157 ALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191
           ALE+ P   K   RR  +   L  F +A  DL  V
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV 106

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 37/77 (48%)

Query: 370 ELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDC 429
           E+ P+ +A +YH G+++ +   +  +   F +A   +  N   +  +  L Y+ +++ D 
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 430 ETLFSEARRKFPTAPEV 446
              ++ A R  P   EV
Sbjct: 367 LDAYTRAIRLNPYISEV 383

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 27/52 (51%)

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADA 184
            ++N++AC + L    + +ED + AL + P  +KC  R + A   L    +A
Sbjct: 123 LFANKAACELELKNYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>YOL145C Chr15 complement(49555..52788) [3234 bp, 1077 aa] {ON}
           CTR9Component of the Paf1p complex involved in
           transcription elongation; binds to and modulates the
           activity of RNA polymerases I and II; required for
           expression of a subset of genes, including cyclin genes;
           involved in SER3 repression by helping to maintain SRG1
           transcription-dependent nucleosome occupancy; contains
           TPR repeats
          Length = 1077

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 73/173 (42%), Gaps = 39/173 (22%)

Query: 397 KDFDKAKECNPDNIFPYIQLACLAYREN----------------KFEDCETLFSEARRKF 440
           K + +A + NP N    I +    +RE+                   D   +FSE +   
Sbjct: 239 KSWQRALQLNPKNTSASILVLLGEFRESFTNSTNDKTFKEAFTKALSDLNNIFSENQHNP 298

Query: 441 PTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHS 500
                +  +Y      KGD ++ L  Y   R L+         ++P++ K  VL+  S  
Sbjct: 299 VLLTLLQTYYY----FKGDYQTVLDIYHH-RILK---------MSPMIAK-IVLSESSFW 343

Query: 501 --------GDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFE 545
                   GD+ ++  +F+E+ KK+  +  AK+GL Q +++   ++E+I  FE
Sbjct: 344 CGRAHYALGDYRKSFIMFQESLKKNEDNLLAKLGLGQTQIKNNLLEESIITFE 396

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 33/59 (55%)

Query: 127 LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185
           L  + ++Y+NR+A +  + + +  ++D   A+E+ P YSK   R A A  +L    +A+
Sbjct: 129 LPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEAL 187

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%)

Query: 136 NRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLG 179
           N +ACW  LN L++ +  +   ++L+P   KC +RR    + LG
Sbjct: 72  NLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRRGKVLQKLG 115

>Kpol_1014.32 s1014 (58546..61800) [3255 bp, 1084 aa] {ON}
           (58546..61800) [3255 nt, 1085 aa]
          Length = 1084

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 99/245 (40%), Gaps = 44/245 (17%)

Query: 320 FLKNEPLEAYKLLQKAVDLHP--RPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSA 377
           + KN  L + +L Q+ + L+P  +P+  I + L           ++ + +ALEL P   +
Sbjct: 194 YQKNNYLASLRLFQELLVLNPVLQPDPRIGIGLCFWQLKDYKMAIKSWKRALELNPKDKS 253

Query: 378 VYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEAR 437
                 ++  +   F KS        E + DN F         Y     ++   L+S  +
Sbjct: 254 -----AEILVLLGDFHKS------LTESSNDNQFS-------DYYTEALKNLNNLYSNNK 295

Query: 438 RKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATV---- 493
                 P +          KGD ++ L          D  E     VA +   + +    
Sbjct: 296 EN----PVLLTLLQSYFYFKGDYKAVL----------DIHENKISKVASITTNSVLSDSA 341

Query: 494 --LARQSHS-GDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
              AR  +S  D+ +A  +F+E+ +K+  +  AK GL Q + +   ++E+I  FE   +L
Sbjct: 342 FWCARAHYSLHDYRKAFTMFQESLRKNEDNLLAKFGLGQTQFKTNLLEESILTFE---NL 398

Query: 551 ARAFE 555
            ++FE
Sbjct: 399 YKSFE 403

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 5/97 (5%)

Query: 98  SMAMKDKGNECFXXXXXXXXXXXXSCALRLKKDP---VFYSNRSACWVPLNKLEKVVEDT 154
           ++A K++GN               S A+ L  DP   +F+SNR+   + L+  +  + D 
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIEL--DPTQSIFFSNRALAQLKLDNFQSCMNDC 69

Query: 155 TAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191
             AL L P   K   RR  ++  L     A  DL  V
Sbjct: 70  DVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 34/88 (38%), Gaps = 5/88 (5%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKDPV-----FYSNRSACWVPLNKLEKVVEDTTA 156
           K++GN+ +            +  + +K D        Y+NR+AC + L      + D   
Sbjct: 82  KNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCKT 141

Query: 157 ALELKPDYSKCLLRRATANESLGNFADA 184
           AL   P   KC  R   A  ++  F  A
Sbjct: 142 ALTYNPKNIKCYFRMGKAFTAINKFESA 169

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 48/111 (43%), Gaps = 16/111 (14%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALELAP----NSSAVYYHRGQMYFVTQQFEKSGKDFD 400
           Y+ ++L++ +  + D  + +    LE+      + +  YY RG  Y    + E++ KD+ 
Sbjct: 334 YLNISLVLFNLKKYDSAITHATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRLEEALKDYK 393

Query: 401 KAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYA 451
             KE NPD+             + K E  E L  E + K  T   +  F++
Sbjct: 394 NCKENNPDD----------KVIDQKIESVENLLEERKEK--TRKNIAKFFS 432

>NCAS0C04350 Chr3 (891570..894833) [3264 bp, 1087 aa] {ON} Anc_3.5
           YOL145C
          Length = 1087

 Score = 34.7 bits (78), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 62/124 (50%), Gaps = 14/124 (11%)

Query: 428 DCETLFSEARRKFPTAPEVPNFYAEILSD---KGDLESALKEYEFARKLEDAQEGIHVGV 484
           D  TL+++     P   E P     + S    K D E+ LK Y+      +  + I   V
Sbjct: 289 DLNTLYNDTNH--PENKENPVLLTLLQSYFYYKNDFENVLKIYD------EKIKPISTLV 340

Query: 485 A-PLVGKATVLARQSHSG--DFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAI 541
           A  ++ ++T+   +++    D+ +A A+F+E+ K +  +  AK+GL Q +L+   ++E+I
Sbjct: 341 ADSILSESTLWCGRAYYALDDYRKAFAMFQESLKTNEENLLAKLGLGQAQLKTNLLEESI 400

Query: 542 QLFE 545
             FE
Sbjct: 401 LTFE 404

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 52/117 (44%), Gaps = 16/117 (13%)

Query: 309 AIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFD-- 366
           +I+   +G +  L N+  +A K L+KA  ++PR  +Y Y       +G     +  FD  
Sbjct: 618 SISWCFIGNYFSLINDHDKAIKYLKKATTINPRF-TYAYTL-----EGHEQASIDAFDTA 671

Query: 367 -----KALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLAC 418
                KA+   PN    YY  G       Q++++   F+KAK  NP N    I L C
Sbjct: 672 KNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSNA---ILLCC 725

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 55/281 (19%), Positives = 103/281 (36%), Gaps = 66/281 (23%)

Query: 276 SYEMSDEYFNKAADLLSLSHQADSEDPALRMK----LAIALEHVGIFKFLKNEPLEAYKL 331
           +Y++S  YF K  DL           P  R+K     +  L H+        + +   ++
Sbjct: 565 NYKLSINYFKKLYDL----------QPT-RLKDFEIFSTVLWHLK-------DKINLSQI 606

Query: 332 LQKAVDLHPRPN-SYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQ 390
            +  +D +P  + S+ ++    +     D+ ++Y  KA  + P  +  Y   G       
Sbjct: 607 SKTLIDNYPNNSISWCFIGNYFSLINDHDKAIKYLKKATTINPRFTYAYTLEGHEQASID 666

Query: 391 QFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFY 450
            F+ +   + KA  C+P++   Y  L     R  +++     F +A+   P+        
Sbjct: 667 AFDTAKNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINPSN------- 719

Query: 451 AEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALF 510
           A +L   G   SAL++  F  K                                 A   +
Sbjct: 720 AILLCCCG---SALEKLNFNEK---------------------------------ALNYY 743

Query: 511 EEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLA 551
           E AC   P S  AK  LA+L     + + A+++ E+  ++A
Sbjct: 744 ELACNLQPNSSFAKFKLAKLLYSMSRYNLALEILEQVIEMA 784

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 38/81 (46%), Gaps = 9/81 (11%)

Query: 332 LQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQ 391
            Q + DLHP+ +        ++D G+++ + ++ +    L+P S+++Y      YF+   
Sbjct: 441 FQTSHDLHPQDH--------ISDYGKSNLF-EFHNNHFRLSPTSNSLYPKLNSKYFIDSS 491

Query: 392 FEKSGKDFDKAKECNPDNIFP 412
           F+      D   + +  N FP
Sbjct: 492 FKDKNSIIDSQTQASTKNAFP 512

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 100 AMKDKGNECFXXXXXXXXXXXXSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAAL 158
           A+K +GN+              + A++ L  + V+++NR+A +      ++ V+D   A+
Sbjct: 103 ALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI 162

Query: 159 ELKPDYSKCLLRRATANESLGNFADAM 185
           +L P YSK   R A A     NF +++
Sbjct: 163 KLDPAYSKGYSRLAYAKYVQENFEESL 189

>Smik_15.9 Chr15 complement(17702..20935) [3234 bp, 1077 aa] {ON}
           YOL145C (REAL)
          Length = 1077

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 30/45 (66%)

Query: 501 GDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFE 545
           GD+ ++  +F+E+ KK+  +  AK+GL Q +++   ++E+I  FE
Sbjct: 352 GDYRKSFIMFQESLKKNEENLLAKLGLGQTQIKSNLLEESIITFE 396

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 76/339 (22%), Positives = 123/339 (36%), Gaps = 70/339 (20%)

Query: 231 PSNTSLASFFGIFPSETSFANYDEQSEADNFLLKGLR-----CLSER-----KTGSYEMS 280
           P N  L SF  I  + + + +Y      ++ L   +R     C S+      +  +YEMS
Sbjct: 457 PLNNLLYSFALILKTSSQYNSYKAIRLINSLLPTHIRDEMPWCQSQLGMLHFEIVNYEMS 516

Query: 281 DEYFNKAADLLSLSHQADSEDPA-----LRMKLAIALEHVGIFKFLKNEPL--------- 326
            +YF K   L   +   D E  +     L  K+ + +    + K  KNEP          
Sbjct: 517 LKYFEKLRKLQP-TRLKDLETYSTLLWHLHDKIKLTVLSNELLKEFKNEPQTWCCLGNLF 575

Query: 327 -------EAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYL----QYFDKALELAPNS 375
                  EA K  +K   L P   ++ Y   + A +  +D+       YF KA+      
Sbjct: 576 SLQKDHKEAIKAFEKVTKLDP---TFTYGYTLQAHEYLSDDSFDLAKNYFRKAVSTDSQH 632

Query: 376 SAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLAC-------LAYRENKFE- 427
              YY  G       +FE +   F+KA+  NP N+   I + C       L+Y E     
Sbjct: 633 YNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNV---ILICCCGVAFEKLSYPEKALSY 689

Query: 428 ---DCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGV 484
               C+   S +  KF          A +L    +   AL+ +E   KL   +  +H  +
Sbjct: 690 YELACQVQPSSSLAKFKR--------AHLLYSMANYPLALECFEELTKLAPEEATVHFIL 741

Query: 485 APLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQA 523
             L     ++ R+       +A   +  A   DP+  Q 
Sbjct: 742 GQLYN---IMGRKK------DAVKEYTIAMNLDPKGNQV 771

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 72/172 (41%), Gaps = 15/172 (8%)

Query: 383 GQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPT 442
           G ++ + +  +++ K F+K  + +P   + Y   A     ++ F+  +  F   R+   T
Sbjct: 572 GNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNYF---RKAVST 628

Query: 443 APEVPNFYAEI--LSDK-GDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSH 499
             +  N Y  I   S K G+ E AL  +E AR +  +       V  +        + S+
Sbjct: 629 DSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPS------NVILICCCGVAFEKLSY 682

Query: 500 SGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLA 551
                +A + +E AC+  P S  AK   A L         A++ FEE T LA
Sbjct: 683 P---EKALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKLA 731

>TDEL0D03600 Chr4 (661898..664537) [2640 bp, 879 aa] {ON} Anc_3.265
           YBR055C
          Length = 879

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 112/281 (39%), Gaps = 40/281 (14%)

Query: 260 NFLLKGLR--CLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGI 317
           +F +  L+  CLS      ++++ + F +A D  S S  ++           + L++V  
Sbjct: 576 DFWIAKLKVLCLS----SQFDIAQDTFLQAIDTHSQSESSNLH--------RLYLKYVNF 623

Query: 318 FKFLKNEPLEAYKLLQKAVDLHPRPNSY-IYMALIMADKGQTDEYLQYFDKALELAPNSS 376
            +F +NE   A   L++   +   PN Y  Y+ L     GQ  +Y+    K  E     S
Sbjct: 624 LRF-RNENQRAIDFLEQEC-IGRFPNYYKFYIQL-----GQIYQYIGQPKKMRETYSIGS 676

Query: 377 AVYYHRGQMYFVT--------QQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFED 428
               H   ++ +         QQ  ++  + DKA   NP+ I  Y+    +  R    + 
Sbjct: 677 KTLPHCAILWILKAKADEIDFQQPTRARSELDKALLKNPNEISLYLAKIQMEVRLGFQDQ 736

Query: 429 CETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLV 488
              +  +A +KFP +P++ +    +L  K    +++K+  F   L+       V    L+
Sbjct: 737 ARLIVQQALQKFPNSPDLWSANISLLPAK---RASMKKTMFQDALKKTNNSCQV----LL 789

Query: 489 GKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQ 529
                  R S    F  A   F+ A K DP+   A +  A+
Sbjct: 790 EIGLSFYRDSQ---FVTALKWFDRASKSDPKYADAFVWSAR 827

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
           antiviral protein
          Length = 1411

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 504 AEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
           AE+   F+ A + DP   ++ IGL Q  L   +V+ ++++FE A DL
Sbjct: 696 AESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDL 742

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 76/189 (40%), Gaps = 15/189 (7%)

Query: 366 DKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENK 425
           ++ +E  PN    +   G +Y + +  E + K F+KA + + +  + Y       +  + 
Sbjct: 472 NELVETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAY---TLQGHEHSS 528

Query: 426 FEDCETLFSEARRKFPTAPEVPNFYAEI---LSDKGDLESALKEYEFARKLEDAQEGIHV 482
            +  +T  +  RR     P+  N Y  +       G  + AL  +E AR +        V
Sbjct: 529 NDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINP------V 582

Query: 483 GVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQ 542
            V  +      L + S+     +A   +E+AC+  P S  AK   A L     +   A++
Sbjct: 583 NVILICCCGVALEKLSYQ---EKALQYYEQACELQPSSSLAKFKKAHLLYSMARYSAALE 639

Query: 543 LFEEATDLA 551
            FEE   LA
Sbjct: 640 NFEELAKLA 648

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 42/210 (20%), Positives = 84/210 (40%), Gaps = 9/210 (4%)

Query: 341 RPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFD 400
           +P ++  +  + + +   ++ ++YF+KA ++  N +  Y  +G  +      + +   + 
Sbjct: 481 KPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDTAKNCYR 540

Query: 401 KAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDL 460
           +A  C+P +   Y  L     +  +++     F +AR   P    +       L      
Sbjct: 541 RALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNVILICCCGVALEKLSYQ 600

Query: 461 ESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRS 520
           E AL+ YE A +L+ +        A L+     +AR      ++ A   FEE  K  P  
Sbjct: 601 EKALQYYEQACELQPSSSLAKFKKAHLLYS---MAR------YSAALENFEELAKLAPDE 651

Query: 521 EQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550
                 L QL     +  +A++ F  A +L
Sbjct: 652 ATVHFLLGQLYQIMGRKKDAVKEFTVAMNL 681

>Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR189W
           (REAL)
          Length = 1425

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 341 RPNSYIYMALIMA--DKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKD 398
           R N++ +  + +A  +K +  + +++F  AL + PN    +   GQ Y    + E S K 
Sbjct: 692 RSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKV 751

Query: 399 FDKAKECNPDNIF 411
           FDKA    P + +
Sbjct: 752 FDKAIGLKPSHTY 764

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 100 AMKDKGNECFXXXXXXXXXXXXSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAAL 158
           A+K +GN+              S A+R L  + V+++NR+A +  L K  + VED  AA+
Sbjct: 100 ALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAI 159

Query: 159 ELKPDYSKCLLRRATANESLGNFADAM 185
           ++ P YSK   R   A  +LG   +A+
Sbjct: 160 KVNPSYSKGYSRLGFAQYALGRPEEAL 186

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQ--LACL 419
           ++ +DKA+EL    S  + +R   +     F+ + +D DKA   +P N+  Y +  LAC+
Sbjct: 29  IEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACV 88

Query: 420 AYRENK 425
              E K
Sbjct: 89  GLLEFK 94

>KLLA0E01915g Chr5 complement(180022..183243) [3222 bp, 1073 aa]
           {ON} similar to uniprot|P89105 Saccharomyces cerevisiae
           YOL145C CTR9 Component of the Paf1p complex which is a
           large complex that binds to and modulates the activity
           of RNA polymerase II and is required for expression of a
           subset of genes including cyclin genes contains TPR
           repeats
          Length = 1073

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%)

Query: 501 GDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFE 545
           GD  +A   F+EA KK+  +  AKIGL Q +++   V+E+I  FE
Sbjct: 349 GDSRKAFHYFQEALKKNEGNLLAKIGLGQSQVKNNLVEESILTFE 393

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 1/98 (1%)

Query: 98  SMAMKDKGNECFXXXXXXXXXXXXSCALRL-KKDPVFYSNRSACWVPLNKLEKVVEDTTA 156
           ++  KD+GN               + A+ L     +FYSNR+   + L+  +  + D   
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 157 ALELKPDYSKCLLRRATANESLGNFADAMLDLSAVSLY 194
           A++L  +  K   RR  A   L  F  A  DL+ +  Y
Sbjct: 72  AIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTILLKY 109

>KLTH0E16258g Chr5 (1444885..1447011) [2127 bp, 708 aa] {ON} similar
           to uniprot|Q03104 Saccharomyces cerevisiae YML128C MSC1
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the endoplasmic
           reticulum msc1 mutants are defective in directing
           meiotic recombination events to homologous chromatids
          Length = 708

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 34/62 (54%)

Query: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLADGSKHQLPSNTSLASFFGIFPSETSFANY 252
            +  ++++ +  +L +N  K  ++  + +LA  +K    S +S     G++PSE+ F N+
Sbjct: 92  FFDSWSAKDLRKLLSKNKVKFDVEASRDELAQAAKKNFNSISSKLGASGLYPSESYFQNW 151

Query: 253 DE 254
           DE
Sbjct: 152 DE 153

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 100 AMKDKGNECFXXXXXXXXXXXXSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAAL 158
           A+K +GN+              S A+  L  + ++Y+NR+A    L + ++ V D   A+
Sbjct: 95  ALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAI 154

Query: 159 ELKPDYSKCLLR 170
           E+ P YSK   R
Sbjct: 155 EIDPAYSKGYSR 166

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (53%)

Query: 365 FDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYREN 424
           + +A+E+ P ++  Y +R   +   +Q++++  D +KA E +P     Y +L    Y +N
Sbjct: 116 YSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQN 175

Query: 425 KFEDC 429
           K E+ 
Sbjct: 176 KPEEA 180

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
           (SKI3) - Contains 8 copies of the TPR domain [contig 8]
           FULL
          Length = 1410

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 33/69 (47%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKE 404
           Y  + +   +K    E +++F  AL + P+    +   GQ Y+   + E S K F+KA E
Sbjct: 683 YRVLGIANLEKQSESESIEWFQSALRVDPSDLESWVGLGQAYYACGRVEASVKVFEKALE 742

Query: 405 CNPDNIFPY 413
             P + + +
Sbjct: 743 VEPTSAYAH 751

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 5/88 (5%)

Query: 102 KDKGNECFXXXXXXXXXXXXSCALRLKKD-----PVFYSNRSACWVPLNKLEKVVEDTTA 156
           K++GNE +            +  + +K D        Y+NR+AC + L    K +ED   
Sbjct: 78  KNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCKK 137

Query: 157 ALELKPDYSKCLLRRATANESLGNFADA 184
           AL       KC  R   A  S+  F ++
Sbjct: 138 ALSFNVKNIKCYYRMGKAFLSVDRFDES 165

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 5/91 (5%)

Query: 132 VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191
           +++SNR+   + L+  +  + D   A+EL P   K   RR  +   L  F  A  DL  V
Sbjct: 47  IYFSNRAFAHLKLDNFQTALNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV 106

Query: 192 SLYGGYNSQSIEPVLERNMNKQAMQVLKRKL 222
                  ++  EPV  R ++     + K K 
Sbjct: 107 -----LRAKPNEPVATRALDVCERVIRKEKF 132

>Ecym_2007 Chr2 complement(6770..10111) [3342 bp, 1113 aa] {ON}
           similar to Ashbya gossypii AGR398W
          Length = 1113

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 9/69 (13%)

Query: 485 APLVGKATVLARQSH--------SGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQ 536
           APLV   T+L+  +           DF  A ++F+E+ +++  +  AK GL Q +LQ + 
Sbjct: 326 APLVAN-TILSDSAFWCGRAYYAKSDFRRAFSMFQESLRRNEDNLLAKFGLGQSQLQNKL 384

Query: 537 VDEAIQLFE 545
            +E+I  FE
Sbjct: 385 FEESILTFE 393

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 23/52 (44%)

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADA 184
            ++NR+AC + L      + D   AL L P   KC  R   A   L N  +A
Sbjct: 120 LFANRAACQLELKNYRSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%)

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLR 170
            ++NR+AC + L    K VED   AL + P   KC  R
Sbjct: 123 LFANRAACELELKNYRKCVEDCGKALTINPKNIKCYYR 160

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 30/45 (66%)

Query: 501 GDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFE 545
            D+ +A A+F+E+ KK+  +  +K+GL Q +++   ++E++  FE
Sbjct: 368 NDYRQAFAMFQESLKKNEDNLLSKLGLGQTQIKTNLLEESVLTFE 412

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 55/278 (19%), Positives = 98/278 (35%), Gaps = 60/278 (21%)

Query: 276 SYEMSDEYFNKAADLLSLSHQADSEDPALRM--KLAIALEHVGIFKFLKNEPLEAYKLLQ 333
           +YEMS +YF      ++L        P + +   L   L        L +E LE  +L  
Sbjct: 357 NYEMSKKYF------MALREAQPFRLPDMEIFSTLLWHLNDTTGLSHLCHELLEVNRL-- 408

Query: 334 KAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFE 393
                   P ++  +  + + K   +E ++ F ++ +L P+ +  Y  +G  Y     F+
Sbjct: 409 -------APETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFD 461

Query: 394 KSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEI 453
            +   + KA   N  +   Y  L   + +  ++E+C   F +AR   P            
Sbjct: 462 TAMTCYRKALASNSQHYNAYYGLGMCSLKLGQYEECLLHFEKARSINP------------ 509

Query: 454 LSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEA 513
                                       V V  +      L + SH      A   ++ A
Sbjct: 510 ----------------------------VNVILICCCGVALEKLSHQ---ERALQNYDLA 538

Query: 514 CKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDLA 551
           C+  P S  A    AQL L   + + A++ FE+   +A
Sbjct: 539 CELQPMSSLALFKRAQLLLAMGKYNYALESFEKLVKIA 576

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 63/136 (46%), Gaps = 15/136 (11%)

Query: 273 KTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAIALEHVGIFKFLKNEPLEAYKLL 332
           K G YE    +F KA  +       +  +  L     +ALE +      +   L+ Y L 
Sbjct: 490 KLGQYEECLLHFEKARSI-------NPVNVILICCCGVALEKLSH----QERALQNYDL- 537

Query: 333 QKAVDLHPRPNSYIY-MALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQ 391
             A +L P  +  ++  A ++   G+ +  L+ F+K +++AP+ + +++  GQ+Y +  +
Sbjct: 538 --ACELQPMSSLALFKRAQLLLAMGKYNYALESFEKLVKIAPDEATIHFLLGQLYQIVGR 595

Query: 392 FEKSGKDFDKAKECNP 407
            + + K+   A   +P
Sbjct: 596 KQDAVKELTIAMNLDP 611

>YJR032W Chr10 (491081..492262) [1182 bp, 393 aa] {ON}
           CPR7Peptidyl-prolyl cis-trans isomerase (cyclophilin),
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues; binds to Hsp82p and
           contributes to chaperone activity
          Length = 393

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALEL--APN--SSAVYYHRGQMYFVTQQFEKSGKDFD 400
           Y+ ++L++ +  + D+ + Y    LE+   PN   +  YY RG  Y   ++ +++ +D+ 
Sbjct: 295 YLNLSLVLFNLERYDDAIMYATYLLEMDNVPNRDQAKAYYRRGNSYLKKKRLDEALQDYI 354

Query: 401 KAKECNPDN 409
             KE NPD+
Sbjct: 355 FCKEKNPDD 363

>AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR032W
           (CPR7)
          Length = 383

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALEL----APNSSAVYYHRGQMYFVTQQFEKSGKDFD 400
           Y+ M L + + G  D  + Y +  LE+    + + +  YY RG  Y      E++  ++ 
Sbjct: 286 YLNMTLALFNMGSYDSAISYTNYVLEMDRVPSMDLAKAYYRRGNCYLAKNLLEEALSNYK 345

Query: 401 KAKECNPD 408
           + KE N D
Sbjct: 346 RCKEHNSD 353

>KLTH0C07458g Chr3 (642381..645116) [2736 bp, 911 aa] {ON} similar
           to uniprot|P19735 Saccharomyces cerevisiae YBR055C PRP6
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 911

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 73/186 (39%), Gaps = 21/186 (11%)

Query: 355 KGQTDEYLQYFDKAL------ELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPD 408
           + + DE  + F+K L       L  NS     +   ++      EK+ +  DK+ + +P 
Sbjct: 546 QSKLDEVYRLFEKLLFSDSNEVLRKNSVLALMYSKLLWKSETSIEKALEVLDKSLKVDPL 605

Query: 409 NIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNF---YAEILSDKGDLESALK 465
           N+  ++  A L     KFE  E L+ +   K    P +      Y   L  +   E ALK
Sbjct: 606 NVEFWLAKAKLLVNARKFEAAENLYKDGVIKLSQQPGLERVFYRYVSFLRFQNRNEEALK 665

Query: 466 --EYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQA 523
             E +F ++     E +++      G+  V     H GD  +A   F    K+ P S   
Sbjct: 666 LLETDFLQRAHGC-EKLYLQ----WGQIYV-----HLGDLPQAQKCFAAGVKELPTSANL 715

Query: 524 KIGLAQ 529
            I LA 
Sbjct: 716 WIALAH 721

>ZYRO0E01254g Chr5 complement(90540..92498) [1959 bp, 652 aa] {ON}
           similar to uniprot|P25298 Saccharomyces cerevisiae
           YMR061W RNA14 Cleavage and polyadenylation factor I (CF
           I) component involved in cleavage and polyadenylation of
           mRNA 3' ends bridges interaction between Rna15p and
           Hrp1p in the CF I complex
          Length = 652

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 7/70 (10%)

Query: 404 ECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESA 463
           E NP +I PY++L      ++ F++   +++    KFPT   +       L  KG+L+  
Sbjct: 37  ELNPADILPYLELVQYYESKDSFQESREVYNSLHDKFPTYSPL-----WTLQLKGELQR- 90

Query: 464 LKEYEFARKL 473
             E+EF  K+
Sbjct: 91  -DEFEFVEKM 99

>KLTH0C04950g Chr3 (431617..433491) [1875 bp, 624 aa] {ON} conserved
           hypothetical protein
          Length = 624

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 56/134 (41%), Gaps = 12/134 (8%)

Query: 315 VGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALE-LAP 373
           +GI +F  N    AY ++Q+A+   P+ ++   +   +A     DE L      L  L  
Sbjct: 272 LGIIQFKMNYKASAYSVIQEAMSALPQVSATARLLATLAQFYMIDENLPQLRAILPALLV 331

Query: 374 NSSAVY-----------YHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYR 422
             +A+            +  G++Y +    ++S   + +A  C P +   ++ +  L  R
Sbjct: 332 EKTALTEKELIRLYLMNWLLGRVYDMLDDTKQSYHFYQQAVNCKPQSASLWVGIGSLYLR 391

Query: 423 ENKFEDCETLFSEA 436
             +FED    FS A
Sbjct: 392 MRQFEDAHIAFSHA 405

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 25/52 (48%)

Query: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADA 184
            ++N++AC + L    + + D   AL+L P   KC  R   A  +L    +A
Sbjct: 117 LFANKAACELELKNFRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 27/52 (51%)

Query: 357 QTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPD 408
           Q +  L +++ A EL PNSS   + + Q+     Q+  +  +F++ +   PD
Sbjct: 609 QPERALNFYELATELQPNSSLALFKKSQLLLNMGQYSSALHNFERLESLTPD 660

>Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032W
           (REAL)
          Length = 370

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKALEL--APNS--SAVYYHRGQMYFVTQQFEKSGKDFD 400
           Y+ ++L + +  + D  + Y    LE+   PN   +  YY RG  Y   ++ +++ +D+ 
Sbjct: 295 YLNLSLALFNLERYDSAITYATYLLEMDNVPNKDRAKAYYRRGNSYLRKKRLDEALRDYR 354

Query: 401 KAKECNPDN 409
             KE NPD+
Sbjct: 355 LCKEMNPDD 363

>NDAI0A05760 Chr1 complement(1305203..1307671) [2469 bp, 822 aa]
           {ON} 
          Length = 822

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 86/212 (40%), Gaps = 24/212 (11%)

Query: 345 YIYMALIMADKGQTDEYLQYFDKA-LELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAK 403
           + Y A ++   GQ ++ +Q+  ++ L   P +   Y   GQ+Y  T+ ++ S + +    
Sbjct: 608 HYYYASLLRYNGQNEKAIQFLSESCLPHFPKNYKFYLQLGQIYIDTKDYKTSREIYLSGT 667

Query: 404 ECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESA 463
           +  PD+   +I LA    R ++     T+   AR +  TA         +L  K  +ES 
Sbjct: 668 KELPDSPLLWIYLA----RTDEIYLKNTI--RARSELDTAILKNPTLDILLITKAQMESR 721

Query: 464 LKEYEFARKLED-------AQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKK 516
           L+ Y+ A  + D          G+ V    L+G      R++          +F++A KK
Sbjct: 722 LENYQQAELIVDQGLMKFPKSPGLWVERIRLLGNKRASQRKT----------IFQDALKK 771

Query: 517 DPRSEQAKIGLAQLKLQQEQVDEAIQLFEEAT 548
                   + +      + Q   +++ FE A 
Sbjct: 772 TGNDHAILLEIGMSLYSESQYQASLKWFERAV 803

>KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 632

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 68/160 (42%), Gaps = 12/160 (7%)

Query: 305 RMKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDE---Y 361
           ++  A+ +  +GI +  +  P  A     K++ L+P   ++     +++   +TDE    
Sbjct: 222 KLGTALLMYLLGIIQKKQGVPSGAMSYFLKSLKLYPY--NWTCWCELLSCISRTDESILL 279

Query: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKE-------CNPDNIFPYI 414
           L+Y +    +   +  ++ H    +F    F++ G DFDK  E         P+  F   
Sbjct: 280 LKYLNDNFSIVKENGIIHEHLMLRFFKLAVFKEFGGDFDKYIEELGEIMKVFPNFSFLRA 339

Query: 415 QLACLAYRENKFEDCETLFSEARRKFPTAPEVPNFYAEIL 454
           Q A + Y+   + + E +F E     P   +  + Y+ +L
Sbjct: 340 QHALINYKYMDYANAEIVFDELVTMDPYRLDDLDTYSNVL 379

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 23/125 (18%)

Query: 321 LKNE--PLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQ-------YFDKALEL 371
           LKN    +E Y+   +AVD++PR     Y        GQ  E L        YF KA  L
Sbjct: 500 LKNSHAAIECYR---RAVDINPRDFKAWY------GLGQAYEVLDMHLYSLYYFQKACAL 550

Query: 372 APNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECN----PDNIFPYIQLACLAYRENKFE 427
            P    ++   G+ YF+    + + K + +A + +     D+I  Y +LA L  + +  E
Sbjct: 551 KPLDKRMWQALGECYFIVDNTDSALKCYKRALQLSDLALQDSIILY-KLAILYEKMDDIE 609

Query: 428 DCETL 432
           +C+ +
Sbjct: 610 NCKKM 614

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 136 NRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLR 170
           NR+A W  L KL+K ++D    + ++P   KC +R
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIR 110

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 49/107 (45%), Gaps = 2/107 (1%)

Query: 337 DLHPRPNSYIY--MALIMADKGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEK 394
           D+H    ++ Y  + +   +  Q  E +++F  AL +  +    +   GQ Y    + E 
Sbjct: 653 DMHLNSVNWPYRVLGVYYLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEA 712

Query: 395 SGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFP 441
           S K F++A E +P++ +  + LA    + ++FE       +   K+P
Sbjct: 713 SIKVFERALELSPEHKYAGLFLAISLCQLSEFEKSLEALRKLVNKYP 759

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 49/101 (48%), Gaps = 17/101 (16%)

Query: 464 LKEYEFARKLEDAQEGIHVGVAPL--VGKATVLARQSHSGDFAE-------------ATA 508
           L+EYEF   L   + GI +    +  +G   + A++  S D+A              A +
Sbjct: 399 LEEYEFV--LPYIKNGITLVAQAIRDLGARLINAKRDLSLDYATVYTYLESPKYHSIALS 456

Query: 509 LFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATD 549
           LF++    DP++ +AK+  + + ++++Q DEA  L +   D
Sbjct: 457 LFDKVLADDPQNYRAKLKKSHILIERKQWDEAYALLKGVVD 497

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%)

Query: 132 VFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAV 191
           +++SNR+     ++  +  + D   AL+L P   K   RRA +  +L  F  A  DL+ +
Sbjct: 47  IYFSNRAFAHFKVDNFQSALNDCDEALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 24/44 (54%)

Query: 127 LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLR 170
           L  + ++Y+NR+A    L   ++ VED  +A+ + P Y +   R
Sbjct: 132 LPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSR 175

>TPHA0P01590 Chr16 (328049..331282) [3234 bp, 1077 aa] {ON} Anc_3.5
           YOL145C
          Length = 1077

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 75/178 (42%), Gaps = 21/178 (11%)

Query: 383 GQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCET------LFSEA 436
           G  ++  +    + K + +AKE +P+N    I L  L    N   + E        +SEA
Sbjct: 224 GMCFWQLKDHSMAVKSWSRAKEIDPENKTASI-LVLLGDFHNSLTNSENDEQFKKQYSEA 282

Query: 437 RRKF-------PTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVG 489
                       + P +          KG+ +S +  YE  +K+        +    ++ 
Sbjct: 283 ILNLENLYSGNKSNPVILTLLQSYFYFKGEYQSVIDIYE--KKIMGMSS---ITANTILS 337

Query: 490 KATVLARQSHSG--DFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFE 545
           +A+    +S+    D+ +A  +F+E+ KK   +  +K GL Q +++ + ++E I  FE
Sbjct: 338 EASFWCARSYYALNDYRKAFTMFQESLKKSEDNLLSKFGLGQTQIKNDLLEEGILTFE 395

>KAFR0J02990 Chr10 (571614..573029) [1416 bp, 471 aa] {ON} 
          Length = 471

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 230 LPSNTSLASFFG--IFPSETSFANYDEQSEADNFLLKGLR 267
           + SNT++A ++G   + S+T+ ANY + S+AD FLL  L 
Sbjct: 28  INSNTNVAVYWGQNSYGSQTNLANYCQSSDADIFLLSFLN 67

>CAGL0A03630g Chr1 complement(369404..372592) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047c TFC4
          Length = 1062

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 69/161 (42%), Gaps = 9/161 (5%)

Query: 387 FVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCETLFSEARRKFPTAPEV 446
           FV Q   ++ + F++  + +P N   Y  L  +   + +  DC   +  A     +  E 
Sbjct: 144 FVKQDLPEAERLFNEVIKKDPRNFAAYETLGDIYQLQGRMNDCCNSWFLAAHLNASDWEF 203

Query: 447 PNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEA 506
               A + SD G +  A+  Y F+R +   +E         + +  +L +Q  +G  A A
Sbjct: 204 WKIVAILSSDLGHIRQAI--YCFSRVIHLNKEEWEC-----IYRRALLYKQ--TGQIARA 254

Query: 507 TALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEA 547
              F++   K P        LA L +   +V++AI+L+ E+
Sbjct: 255 LDGFQKMYTKSPSDANILRELAILYVDYNKVEKAIELYLES 295

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 10/74 (13%)

Query: 366 DKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENK 425
           D AL+L P +   Y+ RG  Y    +F K+  D +   +  P++I             N 
Sbjct: 70  DNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDITA----------SNA 119

Query: 426 FEDCETLFSEARRK 439
            + CE    E R K
Sbjct: 120 LKVCENFIREERFK 133

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 136 NRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESL 178
           NR+A W  +  L+K ++D   A   +P   KC LRR    + L
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKL 118

>ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR023W (MYO1)
          Length = 1805

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 60/120 (50%), Gaps = 12/120 (10%)

Query: 469 FARKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEE--ACKKDPRSEQAKIG 526
           +++ +ED    ++V V P++G +  +A+   S   AE     E+  +  K  R + A   
Sbjct: 775 YSKLMEDPWYSLYVKVKPMLGSSQFIAK---SKKIAEQVKQLEKDLSATKSERDDLATKN 831

Query: 527 ------LAQLKLQQEQVDEAIQLFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMS 580
                 LA+++    +  E +Q FE   D A+  EE+L++  + EA K++  ++++  ++
Sbjct: 832 FNVEKELAEIRTALSKETEKLQNFERLYDTAKKREEELRS-AYEEAVKLKDTLQSETTIN 890

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 25/44 (56%)

Query: 127 LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLR 170
           L  + ++Y+NR+A    L + ++ V+D  +A+ + P Y +   R
Sbjct: 132 LPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSR 175

>CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166c CDC23
          Length = 639

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 71/179 (39%), Gaps = 17/179 (9%)

Query: 355 KGQTDEYLQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNP---DNIF 411
           +G  DEYL  F+  L L PN + +   +    +    +  S + F+K  E +P   D++ 
Sbjct: 321 QGNVDEYLTTFEDLLTLFPNFTFLQAQKALTSYQYMDYVNSEQIFEKIMEDDPYRLDDMD 380

Query: 412 PYIQLACLAYRENKFEDCETLFSEARRKFP-TAPEVPNFYAEILSDKGDLESALKEYEFA 470
            +  +  +  +  K        S+  R  P T   + N+Y    S + + E ++  +  A
Sbjct: 381 TFSNILYVMQKNAKLAYLAQFVSQIDRFRPETCCVIANYY----SARQEHEKSIMYFRRA 436

Query: 471 RKLEDAQEGIHVGVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQ 529
             L+            L+G   V  + S++     A   +  A   DPR  +A  GL Q
Sbjct: 437 LTLDKKT----TSAWTLMGHEFVELKNSNA-----AIESYRRAVDIDPRDFRAWYGLGQ 486

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,687,162
Number of extensions: 2305672
Number of successful extensions: 8012
Number of sequences better than 10.0: 237
Number of HSP's gapped: 8042
Number of HSP's successfully gapped: 363
Length of query: 597
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 482
Effective length of database: 40,294,809
Effective search space: 19422097938
Effective search space used: 19422097938
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)