Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_82022.151ON98984192e-54
KLLA0F24068g2.151ON95682846e-34
SAKL0E10978g2.151ON95972621e-30
ABR133W2.151ON96932534e-29
TDEL0B051302.151ON93662508e-29
Suva_14.2182.151ON112982492e-28
ZYRO0G06490g2.151ON92672472e-28
KNAG0I021302.151ON92682447e-28
KAFR0J020902.151ON92922447e-28
Smik_14.2062.151ON113982397e-27
Kwal_33.147622.151ON91692342e-26
NCAS0G024702.151ON88672291e-25
KLTH0B05214g2.151ON91682281e-25
YNL122C2.151ON115982275e-25
CAGL0L04070g2.151ON95672247e-25
Skud_14.2102.151ON103672257e-25
NDAI0F028202.151ON128682208e-24
Kpol_505.212.151ON85692091e-22
TPHA0F018802.151ON99702082e-22
TBLA0B012302.151ON97671474e-13
Smik_11.2612.516ON26463622.8
Skud_2.47.441ON115139613.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_8202
         (98 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON} s...   166   2e-54
KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} simila...   114   6e-34
SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some sim...   105   1e-30
ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homo...   102   4e-29
TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}...   100   8e-29
Suva_14.218 Chr14 complement(394669..394965,394969..394983,39499...   100   2e-28
ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON...   100   2e-28
KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151...    99   7e-28
KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.15...    99   7e-28
Smik_14.206 Chr14 complement(377692..377997,378001..378009,37801...    97   7e-27
Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON...    95   2e-26
NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}...    93   1e-25
KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some sim...    92   1e-25
YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON} P...    92   5e-25
CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly ...    91   7e-25
Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309...    91   7e-25
NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.15...    89   8e-24
Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..570...    85   1e-22
TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151...    85   2e-22
TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}...    61   4e-13
Smik_11.261 Chr11 complement(437432..438226) [795 bp, 264 aa] {O...    28   2.8  
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    28   3.6  

>Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON}
          similar to Ashbya gossypii ABR133W
          Length = 98

 Score =  166 bits (419), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 86/98 (87%), Positives = 86/98 (87%)

Query: 1  MLIQGLFRPLEKLTSRFXXXXXXXXXXXXYLIFSRSLMKTHKGAAKRWRKTANSFKRGKA 60
          MLIQGLFRPLEKLTSRF            YLIFSRSLMKTHKGAAKRWRKTANSFKRGKA
Sbjct: 1  MLIQGLFRPLEKLTSRFGGGVGCGSVGVSYLIFSRSLMKTHKGAAKRWRKTANSFKRGKA 60

Query: 61 GRSHGNSGWSKNSLKVLSGRALANGSQLNRLKRLLPYH 98
          GRSHGNSGWSKNSLKVLSGRALANGSQLNRLKRLLPYH
Sbjct: 61 GRSHGNSGWSKNSLKVLSGRALANGSQLNRLKRLLPYH 98

>KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} similar
          to uniprot|P53921 Saccharomyces cerevisiae YNL122C
          Hypothetical ORF
          Length = 95

 Score =  114 bits (284), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 64/68 (94%)

Query: 31 LIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNR 90
          LI +R+LMKTHKGAAKRWRKTANSFKRGKAGR+HGN+GWS+NSLK LSGR+LA+ + ++R
Sbjct: 28 LILTRNLMKTHKGAAKRWRKTANSFKRGKAGRNHGNAGWSRNSLKSLSGRSLADSTHMHR 87

Query: 91 LKRLLPYH 98
          LKRLLPYH
Sbjct: 88 LKRLLPYH 95

>SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some
          similarities with uniprot|P53921 Saccharomyces
          cerevisiae YNL122C Hypothetical ORF
          Length = 95

 Score =  105 bits (262), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 70/97 (72%), Gaps = 2/97 (2%)

Query: 2  LIQGLFRPLEKLTSRFXXXXXXXXXXXXYLIFSRSLMKTHKGAAKRWRKTANSFKRGKAG 61
          ++  L RPL  ++ +F             L+ +R+LMKTHKGAAKRW+KTANS+KRG+AG
Sbjct: 1  MLSSLLRPLSNISVKFGTSLSQIQHPS--LVLTRNLMKTHKGAAKRWKKTANSYKRGRAG 58

Query: 62 RSHGNSGWSKNSLKVLSGRALANGSQLNRLKRLLPYH 98
          R+HGN+GW+K++LK L G+ LA+ + +  LKRLLPYH
Sbjct: 59 RNHGNAGWNKSTLKSLDGKTLAHPTHIKHLKRLLPYH 95

>ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL122C
          Length = 96

 Score =  102 bits (253), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 53/93 (56%), Positives = 62/93 (66%), Gaps = 1/93 (1%)

Query: 6  LFRPLEKLTSRFXXXXXXXXXXXXYLIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHG 65
          + RPL  L  RF             LI  R+LMKTHKGAAKRWRKTA  +KR KAGRSHG
Sbjct: 5  MLRPLTGLPVRFGSGAFAATTQPS-LIMVRTLMKTHKGAAKRWRKTAGGYKRSKAGRSHG 63

Query: 66 NSGWSKNSLKVLSGRALANGSQLNRLKRLLPYH 98
          N+GW + +LK LSGR +A  + L RL+RLLPYH
Sbjct: 64 NTGWGQRALKQLSGRTMAASAHLKRLRRLLPYH 96

>TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}
          Anc_2.151 YNL122C
          Length = 93

 Score =  100 bits (250), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%)

Query: 31 LIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNR 90
          LI +RSLMKTHKGAAKRWRKTA SFKRGKAGRSHGN+GWS+ SLK LSG+ LA+ + +  
Sbjct: 27 LILTRSLMKTHKGAAKRWRKTATSFKRGKAGRSHGNAGWSRRSLKSLSGKTLAHETHIKH 86

Query: 91 LKRLLP 96
          LKRL+P
Sbjct: 87 LKRLMP 92

>Suva_14.218 Chr14
           complement(394669..394965,394969..394983,394990..395013)
           [336 bp, 112 aa] {ON} YNL122C (REAL)
          Length = 112

 Score =  100 bits (249), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 62/98 (63%)

Query: 1   MLIQGLFRPLEKLTSRFXXXXXXXXXXXXYLIFSRSLMKTHKGAAKRWRKTANSFKRGKA 60
           M +  LF PL K ++ F              I  R+LMKTHKG AKRWR+T N+FKRG A
Sbjct: 15  MSLFNLFNPLLKGSNSFKPRLNQLLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIA 74

Query: 61  GRSHGNSGWSKNSLKVLSGRALANGSQLNRLKRLLPYH 98
           GR HGN GWS  SLKVL+GR  AN S L  LKRLLPYH
Sbjct: 75  GRKHGNIGWSHRSLKVLTGRKTANSSYLKHLKRLLPYH 112

>ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON}
          similar to uniprot|Q75D91 Ashbya gossypii ABR133W 50S
          ribosomal protein L35 and some similarites with YNL122C
          uniprot|P53921 Saccharomyces cerevisiae YNL122C
          Hypothetical ORF
          Length = 92

 Score = 99.8 bits (247), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (86%)

Query: 31 LIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNR 90
          L+F+R+LMKTHKG AKRW+KTA+ FKRGKAGR+HGN GWS+ SLKVLSG+  A+ S + R
Sbjct: 26 LVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQR 85

Query: 91 LKRLLPY 97
          L+RLLPY
Sbjct: 86 LRRLLPY 92

>KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151
          YNL122C
          Length = 92

 Score = 98.6 bits (244), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 55/68 (80%)

Query: 31 LIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNR 90
          +I +RSLMKTHKGAAKRWRK AN FKRG +GR HGN GWS+  LK L+GR  A+ SQ+ R
Sbjct: 25 MIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGNCGWSQRGLKALTGRTEAHQSQIKR 84

Query: 91 LKRLLPYH 98
          LK+LLPYH
Sbjct: 85 LKKLLPYH 92

>KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.151
          YNL122C
          Length = 92

 Score = 98.6 bits (244), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 61/92 (66%), Gaps = 2/92 (2%)

Query: 6  LFRPLEKLTSRFXXXXXXXXXXXXYLIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHG 65
          LF+P    ++ F             LI +R+LMKTHKG AKRWRKTAN FKRG AGR+HG
Sbjct: 2  LFKPF--FSALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHG 59

Query: 66 NSGWSKNSLKVLSGRALANGSQLNRLKRLLPY 97
          N GWS+ SLK L+GR  A  SQ  RLKRLLP+
Sbjct: 60 NGGWSRRSLKCLTGRKTATPSQAKRLKRLLPF 91

>Smik_14.206 Chr14
           complement(377692..377997,378001..378009,378013..378036)
           [339 bp, 113 aa] {ON} YNL122C (REAL)
          Length = 113

 Score = 96.7 bits (239), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 61/98 (62%)

Query: 1   MLIQGLFRPLEKLTSRFXXXXXXXXXXXXYLIFSRSLMKTHKGAAKRWRKTANSFKRGKA 60
           M +  +F PL K ++ F              +  R+LMKTHKG AKRWR+T N+FKRG A
Sbjct: 16  MSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTFKRGIA 75

Query: 61  GRSHGNSGWSKNSLKVLSGRALANGSQLNRLKRLLPYH 98
           GR HGN GWS  SLK L+GR  AN + L  LKRLLPYH
Sbjct: 76  GRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113

>Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON}
          YNL122C - Hypothetical ORF [contig 101] FULL
          Length = 91

 Score = 94.7 bits (234), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 42/69 (60%), Positives = 57/69 (82%)

Query: 30 YLIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLN 89
          ++  +R+LMKTHKG AKRWRKT+ S+KRG+AGR+HGN+GW K++LK L G+ LA+ + + 
Sbjct: 23 FMQQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKALDGKTLAHSTHIK 82

Query: 90 RLKRLLPYH 98
           LKRLLPYH
Sbjct: 83 HLKRLLPYH 91

>NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}
          Anc_2.151 YNL122C
          Length = 88

 Score = 92.8 bits (229), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 46/67 (68%), Positives = 54/67 (80%)

Query: 31 LIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNR 90
          L  +R+LMKTHKG AKRWR+TA SFKRG AGR+HGN+GWS+ SLK LSGR  A+ S L  
Sbjct: 21 LTITRNLMKTHKGTAKRWRRTAQSFKRGIAGRNHGNAGWSRRSLKHLSGRKDADPSYLRH 80

Query: 91 LKRLLPY 97
          LKRL+PY
Sbjct: 81 LKRLMPY 87

>KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some
          similarities with uniprot|P53921 Saccharomyces
          cerevisiae YNL122C Hypothetical ORF
          Length = 91

 Score = 92.4 bits (228), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 57/68 (83%)

Query: 30 YLIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLN 89
          +++ +R+LMKTHKG AKRWRKT+ S+KRG+AGR+HGN+GW K++LK L G+ LA+ + + 
Sbjct: 23 FMMQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKSLDGKTLAHPTHIK 82

Query: 90 RLKRLLPY 97
           LKRLLPY
Sbjct: 83 HLKRLLPY 90

>YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to mitochondria;
           YNL122C is not an essential gene
          Length = 115

 Score = 92.0 bits (227), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 61/98 (62%)

Query: 1   MLIQGLFRPLEKLTSRFXXXXXXXXXXXXYLIFSRSLMKTHKGAAKRWRKTANSFKRGKA 60
           M +  + +PL K ++ F              I  R+LMKTHKG AKRWR+T N+FKRG A
Sbjct: 18  MSVFNVLKPLLKGSNSFKVKLNGFLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGIA 77

Query: 61  GRSHGNSGWSKNSLKVLSGRALANGSQLNRLKRLLPYH 98
           GR HGN GWS  SLK L+GR +A+ +    LKRLLPYH
Sbjct: 78  GRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115

>CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly
          similar to uniprot|P53921 Saccharomyces cerevisiae
          YNL122c
          Length = 95

 Score = 90.9 bits (224), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%)

Query: 31 LIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNR 90
          ++F R+LMKTH+GA KRWR+T+  FKRG AGR HGN GWS  SLK L+GR  A+ +Q+ R
Sbjct: 28 MVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKR 87

Query: 91 LKRLLPY 97
          L+RL+PY
Sbjct: 88 LRRLMPY 94

>Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309
           bp, 103 aa] {ON} YNL122C (REAL)
          Length = 103

 Score = 91.3 bits (225), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 51/67 (76%)

Query: 32  IFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNRL 91
           I  R+LMKTHKG AKRWR+T N+FKRG AGR HGN GWS  SLK L+GR  A+ + L  L
Sbjct: 37  ITIRTLMKTHKGTAKRWRRTGNTFKRGIAGRKHGNIGWSHRSLKALTGRKTAHPAYLKHL 96

Query: 92  KRLLPYH 98
           KRLLPYH
Sbjct: 97  KRLLPYH 103

>NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.151
           YNL122C
          Length = 128

 Score = 89.4 bits (220), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 42/68 (61%), Positives = 52/68 (76%)

Query: 31  LIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNR 90
           L+ +R+LMKTHKGAAKRWRK+A  FKRG AGR+HGN GWS   L  L+GR  A+ + +  
Sbjct: 61  LVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRNHGNVGWSHRYLNKLTGRKEADPTHVKH 120

Query: 91  LKRLLPYH 98
           LKR+LPYH
Sbjct: 121 LKRMLPYH 128

>Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON}
          (56756..57013) [258 nt, 86 aa]
          Length = 85

 Score = 85.1 bits (209), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 42/69 (60%), Positives = 55/69 (79%), Gaps = 2/69 (2%)

Query: 31 LIFSRSLMKTHKGAAKRWR--KTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQL 88
          L  +RSLMKTHKG AKRW+  K+ ++FKRGK+GR HGN GWS+ SLK LSGR  A+ + +
Sbjct: 16 LQITRSLMKTHKGTAKRWKFIKSLDTFKRGKSGRQHGNVGWSQRSLKHLSGRTYAHTTHV 75

Query: 89 NRLKRLLPY 97
          +RL++LLPY
Sbjct: 76 SRLRKLLPY 84

>TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151
          YNL122C
          Length = 99

 Score = 84.7 bits (208), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 55/70 (78%), Gaps = 2/70 (2%)

Query: 30 YLIFSRSLMKTHKGAAKRWRKTA--NSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQ 87
          +L F R+LMKTHKG AKRW+  +  ++FKRGK+GR HGN GWS+ SLK LSGR  A+ + 
Sbjct: 29 HLDFRRTLMKTHKGTAKRWKYISKLDTFKRGKSGRQHGNIGWSQRSLKTLSGRTYADKTH 88

Query: 88 LNRLKRLLPY 97
          +++L++LLPY
Sbjct: 89 VSKLRKLLPY 98

>TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}
          Anc_2.151 YNL122C
          Length = 97

 Score = 61.2 bits (147), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 41/67 (61%), Gaps = 7/67 (10%)

Query: 38 MKTHKGAAKRWRK-------TANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNR 90
          +KTHKG  KRWR+        A  F R KAGR+HGN GWS  +L  LS R  A+ + +  
Sbjct: 31 LKTHKGTLKRWRRRVAPGGPAAEQFVRSKAGRNHGNIGWSHRALAALSRRVPAHSTHVKA 90

Query: 91 LKRLLPY 97
          L++LLPY
Sbjct: 91 LRKLLPY 97

>Smik_11.261 Chr11 complement(437432..438226) [795 bp, 264 aa] {ON}
           YKR006C (REAL)
          Length = 264

 Score = 28.5 bits (62), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%)

Query: 33  FSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNRLK 92
           F R   + HK   K  ++     + GKA  S  +S  SKN L+++    +  GS  N+ +
Sbjct: 43  FKRKKQEKHKEPVKDTKQLIKDIEEGKAEASSQSSFKSKNRLELIPENFIGEGSGRNKRQ 102

Query: 93  RLL 95
           + L
Sbjct: 103 KEL 105

>Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON}
           YBL105C (REAL)
          Length = 1151

 Score = 28.1 bits (61), Expect = 3.6,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 52  ANSFKRGKAGRSHGNSGWSKNSLKVLSGRALAN--GSQL 88
           A   ++ KAG++ G  GW  N+  + SG +LAN  GS L
Sbjct: 297 AEEIRKKKAGQTTGQQGWV-NASNINSGSSLANEEGSTL 334

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.133    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,815,239
Number of extensions: 224063
Number of successful extensions: 630
Number of sequences better than 10.0: 24
Number of HSP's gapped: 627
Number of HSP's successfully gapped: 24
Length of query: 98
Length of database: 53,481,399
Length adjustment: 69
Effective length of query: 29
Effective length of database: 45,569,445
Effective search space: 1321513905
Effective search space used: 1321513905
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)