Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_81855.348ON47147124000.0
AGR348W5.348ON54238012281e-165
Kwal_34.159895.348ON5064244301e-46
SAKL0G08910g5.348ON5053704186e-45
TDEL0E027905.348ON4114163996e-43
Smik_4.5765.348ON4154013944e-42
Suva_2.4865.348ON4153983934e-42
Skud_4.5835.348ON4153923864e-41
YDR317W (HIM1)5.348ON4144013778e-40
KLTH0H14784g5.348ON5144133485e-35
CAGL0H07161g5.348ON4243873392e-34
ZYRO0F00550g5.348ON4153883321e-33
KLLA0B10120g5.348ON3482552808e-27
Kpol_1051.45.348ON4263372785e-26
KAFR0C018805.348ON3452522674e-25
TPHA0D020605.348ON4962542151e-17
TBLA0A031005.348ON3723521632e-11
ZYRO0D09548g7.148ON2251621183e-06
Ecym_44797.148ON2241731077e-05
NCAS0E020907.148ON225149998e-04
TBLA0A105007.148ON237136980.001
NDAI0E036407.148ON225186960.002
KLTH0H00264g7.148ON222143950.002
TDEL0H031107.148ON22494880.019
TBLA0F033107.148ON16174820.070
Kpol_312.97.148ON221136830.079
NCAS0E02080singletonON22578810.15
KAFR0G027507.148ON225140800.21
KNAG0L00930singletonON229101790.28
Smik_5.1187.148ON23193760.56
Suva_5.917.148ON22974721.7
Skud_5.1037.148ON22777712.9
YER004W (FMP52)7.148ON23174713.0
KAFR0I011305.576ON3289121723.4
Suva_7.5675.31ON196662723.7
TPHA0L007607.148ON22639703.9
KLTH0C09636g3.95ON60258705.6
Ecym_51771.190ON1118119689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_8185
         (471 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...   929   0.0  
AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...   477   e-165
Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...   170   1e-46
SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...   165   6e-45
TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   158   6e-43
Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...   156   4e-42
Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   155   4e-42
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   153   4e-41
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   149   8e-40
KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...   138   5e-35
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...   135   2e-34
ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...   132   1e-33
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...   112   8e-27
Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   111   5e-26
KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...   107   4e-25
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...    87   1e-17
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...    67   2e-11
ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar...    50   3e-06
Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON} ...    46   7e-05
NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON}      43   8e-04
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    42   0.001
NDAI0E03640 Chr5 complement(784609..785286) [678 bp, 225 aa] {ON...    42   0.002
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    41   0.002
TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.14...    39   0.019
TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON...    36   0.070
Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..222...    37   0.079
NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON}      36   0.15 
KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.14...    35   0.21 
KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON}               35   0.28 
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    34   0.56 
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    32   1.7  
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    32   2.9  
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    32   3.0  
KAFR0I01130 Chr9 complement(218147..228016) [9870 bp, 3289 aa] {...    32   3.4  
Suva_7.567 Chr7 (986644..992544) [5901 bp, 1966 aa] {ON} YGR271W...    32   3.7  
TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.1...    32   3.9  
KLTH0C09636g Chr3 (800421..802229) [1809 bp, 602 aa] {ON} weakly...    32   5.6  
Ecym_5177 Chr5 complement(368135..371491) [3357 bp, 1118 aa] {ON...    31   9.0  

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/471 (96%), Positives = 455/471 (96%)

Query: 1   MTEEVREPPTITAFGSVRTVDTVNSGHYRLSRKTSLHYQDIKIKIKSTRNKLFKHDQNQQ 60
           MTEEVREPPTITAFGSVRTVDTVNSGHYRLSRKTSLHYQDIKIKIKSTRNKLFKHDQNQQ
Sbjct: 1   MTEEVREPPTITAFGSVRTVDTVNSGHYRLSRKTSLHYQDIKIKIKSTRNKLFKHDQNQQ 60

Query: 61  IIXXXXXXXXXXXXXXXXAAKAISVPKVSINPPKVNEKGDNVIILGSTGLTGSQVLKGCM 120
           II                AAKAISVPKVSINPPKVNEKGDNVIILGSTGLTGSQVLKGCM
Sbjct: 61  IISTTTPVNSPPPPEDSSAAKAISVPKVSINPPKVNEKGDNVIILGSTGLTGSQVLKGCM 120

Query: 121 APWTSGVLYDLKLTKNIWCFNRRLKTVDFSISKLPPTWTAVVNYGGEPHIIRKYDLKIKQ 180
           APWTSGVLYDLKLTKNIWCFNRRLKTVDFSISKLPPTWTAVVNYGGEPHIIRKYDLKIKQ
Sbjct: 121 APWTSGVLYDLKLTKNIWCFNRRLKTVDFSISKLPPTWTAVVNYGGEPHIIRKYDLKIKQ 180

Query: 181 HITEIGKLDGLEFQWDQFDWELKLPTDEVKNVTVNVFQIIQNDSKKWDKTFSELFTGNRK 240
           HITEIGKLDGLEFQWDQFDWELKLPTDEVKNVTVNVFQIIQNDSKKWDKTFSELFTGNRK
Sbjct: 181 HITEIGKLDGLEFQWDQFDWELKLPTDEVKNVTVNVFQIIQNDSKKWDKTFSELFTGNRK 240

Query: 241 PLNDRIEVYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSL 300
           PLNDRIEVYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSL
Sbjct: 241 PLNDRIEVYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSL 300

Query: 301 IKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPGLTHLTILRPGPLIGQHGKQIIL 360
           IKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPGLTHLTILRPGPLIGQHGKQIIL
Sbjct: 301 IKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPGLTHLTILRPGPLIGQHGKQIIL 360

Query: 361 APQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVTELIAKATYHLPGNWIVGY 420
           APQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVTELIAKATYHLPGNWIVGY
Sbjct: 361 APQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVTELIAKATYHLPGNWIVGY 420

Query: 421 SIPSSKVARIAAKEAMTKRNLARNDSDALVVEVTLWSSQEMDRALSGSVAL 471
           SIPSSKVARIAAKEAMTKRNLARNDSDALVVEVTLWSSQEMDRALSGSVAL
Sbjct: 421 SIPSSKVARIAAKEAMTKRNLARNDSDALVVEVTLWSSQEMDRALSGSVAL 471

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score =  477 bits (1228), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 211/380 (55%), Positives = 297/380 (78%), Gaps = 3/380 (0%)

Query: 93  PKVNEKGDNVIILGSTGLTGSQVLKGCMAPWTSGVLYDLKLTKNIWCFNRRLKTVDFSIS 152
           P +N+ G+N ++LGSTGLTGSQVL+  + PW    L  +   +  WCF+R+ + V+  IS
Sbjct: 164 PALNDTGENYVLLGSTGLTGSQVLQDLITPWIGAPLEGVT-ARTFWCFSRKFQDVEIDIS 222

Query: 153 KLPPTWTAVVNYGGEPHIIRKYDLKIKQHITEIGKLDGLEFQWDQFDWELKLPTDEVKNV 212
            LP TWTA+V + GE H+IRK D+++ +H++E G + GL+  WDQ++W++ L T EV+N 
Sbjct: 223 NLPKTWTAIVEFEGEKHVIRKNDVRLIRHLSECGGMLGLKCHWDQYNWDVVLTTGEVRNA 282

Query: 213 TVNVFQIIQNDSKKWDKTFSELFTGNRKPLNDRIEVYLPSIDQVETLISTLGSSSWESRK 272
           T+NV Q++Q DS++W   F+++FTG  +  N   E+Y+P++ ++ETLISTLGS+SWE+RK
Sbjct: 283 TINVVQVVQPDSRRWPDLFNKMFTGGVRTFNAYSEIYMPAVTEIETLISTLGSTSWEARK 342

Query: 273 MKTPRSFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDL 332
            K PR+FVDYTLNM MAK FAPD KK  +KHMVIVTSFN+LALG++S YFRTKQ+LENDL
Sbjct: 343 SKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDL 402

Query: 333 TYDVPGLTHLTILRPGPLIGQHGKQIILAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQV 392
           TYDVPGLTHLTILRPGPL+G+HG + +++P  P    +L +CY +K+++++ + +WL+QV
Sbjct: 403 TYDVPGLTHLTILRPGPLLGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFNWLAQV 462

Query: 393 KDVGPSKKVTELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAMTKRNLARND--SDALV 450
           K+VGP+ KVTEL+AKATYHLPGNWIVGYSIP+ +VA+IAA+EA+ KRN  + +  S +++
Sbjct: 463 KEVGPTTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEALVKRNYIKQNLRSSSMI 522

Query: 451 VEVTLWSSQEMDRALSGSVA 470
           VEVT+WSSQ+MD A + + A
Sbjct: 523 VEVTIWSSQDMDTAETSNPA 542

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 23/25 (92%)

Query: 32 RKTSLHYQDIKIKIKSTRNKLFKHD 56
          RK+SL+Y ++K KI++TR+KLFKH+
Sbjct: 15 RKSSLNYHELKSKIRTTRDKLFKHE 39

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score =  170 bits (430), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 125/424 (29%), Positives = 197/424 (46%), Gaps = 83/424 (19%)

Query: 90  INPPKVNEKGDNVIILGSTGLTGSQVLKGCMAPW-------------------------- 123
           +N P  N   D+ +I G TGLTG  +      PW                          
Sbjct: 68  LNVPS-NRTVDSTLIFGITGLTGGLIAANLAQPWVYLNATNDLQRKISSLFPFSDQLEKH 126

Query: 124 ------TSGVLYDL-------KLTKNIWCFNRRLKTVD-FSISKLPPTWTAVVNYGGEPH 169
                 T   L +L       ++TKN++CF RR  T++   +  L  +W   ++Y G   
Sbjct: 127 HHFMRRTRSPLCNLLTKEKSVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSIDYKGSKM 186

Query: 170 IIRKYDLKIKQHITEIGKLD-----------GLEFQWDQFDWELKLPTDEVKNV------ 212
           +  K +L  ++   + G               L  Q  +F + L    D  ++V      
Sbjct: 187 VCSKENLSCEEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNY--DNSRDVHGETCR 244

Query: 213 -------TVNVFQIIQNDSKKWDKTFSELF--TGNRKPL--NDRIEVYL---PSIDQVET 258
                   VN+  I++ DS+KW    + +F    +++PL   D  E  L   P + Q+ T
Sbjct: 245 HTLMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQINT 304

Query: 259 LISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVL 318
           ++S+LGS S+E +K K  R F DY LNM +A  F  D+ + L K +VI+TSFNNL L   
Sbjct: 305 MVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSST 364

Query: 319 SPYFRTKQKLENDLTYDVPGLTHLTILRPGPLIGQHGKQ-----IILAPQ-LPVGSGVLY 372
           S YF++K  LE DL   V  L  L +LRPGPL+G H  Q     II  P  +P     ++
Sbjct: 365 SDYFQSKLMLEQDLVTKVQALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTA---MF 421

Query: 373 KCYAWKRSLLKAKLHWLSQVKDVGPSKKVTELIAKATYHLPGNWIVGYSIPSSKVARIAA 432
           K   +K++ ++ KL  L ++  VG   K++EL+A+  Y    + ++G+ +P+ KVA +A+
Sbjct: 422 KVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVAS 481

Query: 433 KEAM 436
             A+
Sbjct: 482 IRAV 485

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score =  165 bits (418), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 121/370 (32%), Positives = 191/370 (51%), Gaps = 47/370 (12%)

Query: 131 LKLTKNIWCFNRRLKTVDFSISKLPPT-------WTAVVNYGGEPHIIRKYDLKIKQHIT 183
           +++TKN++CFNR+L     ++ ++P T       W   ++Y G  +  +K ++       
Sbjct: 142 IEITKNLFCFNRKL-----ALLEIPSTPEYINDYWEYSIDYKGTKYHSKKNNISFGVPTL 196

Query: 184 EIGKLDGL-------EFQWDQFDWELKLPTDE-------------VKNVTVNVFQIIQND 223
           + GKL          + Q  QFD++ +   ++             + ++ +NV QI++ +
Sbjct: 197 KFGKLVNSNENSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPN 256

Query: 224 SKKW----DKTFSELFTGNRKPLNDRIE--VYLPSIDQVETLISTLGSSSWESRKMKTPR 277
           SK W      TF +  T     +  ++   +  PS+ +V TL+S LGS+++E +K    R
Sbjct: 257 SKLWPLLLHSTFGDTDTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSR 316

Query: 278 SFVDYTLNMDMAKVFAPDQKKSLIKH-MVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV 336
            FVDY LN  MA+ F  +  +  IK  +V++TSFNN AL   SPYF TK KLE DL   +
Sbjct: 317 DFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRI 376

Query: 337 PGLTHLTILRPGPLIGQHGKQIILAPQLPVGSGVLYK----CYAWKRSLLKAKLHWLSQV 392
           P L  L ILRPGPLIG H  + I        +G+L      CY +K++    K H+L  V
Sbjct: 377 PELDELVILRPGPLIGSHTPEFIPGDPPKSTNGLLKPLSTVCY-YKKACYDHKRHFLQSV 435

Query: 393 KDVGPSKKVTELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAMTKRNLARNDSDALVVE 452
             VG   K+TE+ A+  Y    +W+ GYS+P +KVA +AA   + K    +ND ++  + 
Sbjct: 436 TQVGLKTKMTEVFARLIYRSSCSWMFGYSVPVAKVAVVAAIRTIQK---IQNDPESGGIR 492

Query: 453 VTLWSSQEMD 462
           V L  S E+D
Sbjct: 493 VQLIKSDELD 502

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  158 bits (399), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 119/416 (28%), Positives = 201/416 (48%), Gaps = 61/416 (14%)

Query: 95  VNEKGDNVIILGSTGLTGSQVLKGCM-APWTSGV---------------LYDLKLTKNIW 138
           + +  D+ +  GS+GL GS  LK  + A    G                L + +  K I+
Sbjct: 4   IQQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNKLIY 63

Query: 139 CFNRRLKTVDFSIS--------KLPPTWTAVVNYGGE------PHIIRKYDLKIKQHIT- 183
           C NR++   +  +         KL P      +Y  E      P + +  +  +  +++ 
Sbjct: 64  CINRKIGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSLVNNVSD 123

Query: 184 EIGKL--------DGLEFQWDQFDWELKLPTDEVKN--VTVN--VFQIIQNDSKKWDKTF 231
           E G L        + L++      ++++  ++  K   +T N  + QI   DS KW +  
Sbjct: 124 ESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSSKWCELL 183

Query: 232 SELFTG----NRKPLNDRIEVYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMD 287
            ++F+G      +   D     LP +D++ T+I TLG+ S   R+ K  R +VDY L   
Sbjct: 184 PDIFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGS---RQSKAKRHYVDYELTFK 240

Query: 288 MAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV-PGLTHLTILR 346
           +A+ F   + K L    VIVT+FNN+ +  L PYFRTK KLENDL + + P L  L +LR
Sbjct: 241 LAQSFNNCEGKRL----VIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLR 296

Query: 347 PGPLIGQHGKQIILAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVTELIA 406
           PGPL+G+HG+ +  +  +   + +L +   +K    + KL    + + +G   + +ELIA
Sbjct: 297 PGPLVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIA 356

Query: 407 KATYHLPGNWIVGYSIPSSKVARIAAKEAMTKRNLARNDSDALVVEVTLWSSQEMD 462
           +  Y  PG+W++GY IP++K A +AA +A  +       SD     V + +S++MD
Sbjct: 357 RTMYRKPGSWMLGYCIPATKAAYVAASKATDEA------SDEASDPVEIITSEQMD 406

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  156 bits (394), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 200/401 (49%), Gaps = 62/401 (15%)

Query: 94  KVNEKGDNVIILGSTGLTGSQVLKGCM---------------APWTSGVLYDLKLTKNIW 138
           ++N   D +++ GS+GL G   L+  +                   + +  D+ L K+++
Sbjct: 4   RINAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIKGDVVLNKHVF 63

Query: 139 CFNRR--------LKTVDFSISKLPPTWTAVVNY--GGEPHIIRK---------YDLK-- 177
           C NRR        +K++D+ I+    TW     Y      +  +K         YD    
Sbjct: 64  CINRRSITEEKSFMKSIDY-INMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAFEE 122

Query: 178 --IKQHITEIGKLDGLEFQWDQ--FDWELKLPTDEVKNVTV----NVFQIIQNDSKKWDK 229
             IK+   E GK D     ++Q  F + L   + + +   +     V Q+I   S+ W +
Sbjct: 123 GFIKKTTDENGK-DNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWSR 181

Query: 230 TFSELFTGNRK----PLNDRIEVY---LPSIDQVETLISTLGSSSWESRKMKTPRSFVDY 282
             S +F+G +K      N++  V    LP++  + T++ TLGS+S   R+ + P SFVDY
Sbjct: 182 LLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVDY 241

Query: 283 TLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPGL-TH 341
           +L   +A+ F      +  K +VI+TSFNN  L     YFR K KLENDL   +P     
Sbjct: 242 SLPFSLAQEFT----NTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKE 297

Query: 342 LTILRPGPLIGQHGKQIILAPQLPVGSGVLY--KCYAWKRSLLKAKLHWLSQVKDVGPSK 399
           L ILRPGP+ GQHG  I +  +L V   + +  K   + R LL  K  ++S+V+ +G   
Sbjct: 298 LIILRPGPMCGQHGNSIKV--ELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRT 355

Query: 400 KVTELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAMTKRN 440
           K++ELIA +TY +PG+ ++GYS+P SKV+ +A+  A+ +++
Sbjct: 356 KLSELIASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKS 396

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  155 bits (393), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 118/398 (29%), Positives = 196/398 (49%), Gaps = 60/398 (15%)

Query: 96  NEKGDNVIILGSTGLTGSQVLKGCM-APWTSGVLYDLK--------------LTKNIWCF 140
           N   D++++ GS+GL G   L+  +   +    + DL+              L K+I+C 
Sbjct: 6   NAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINENVVLNKHIFCI 65

Query: 141 NRR--------LKTVDFSISKLPPTWTAVVNY---GGEPHIIRK-----------YDLKI 178
           NR+        +KT+D+ ++     W     Y    GE    R+           ++  I
Sbjct: 66  NRKSVTEQKSFIKTIDY-VNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDFEEGI 124

Query: 179 KQHITEIGKLDGLEFQWD--QFDWELKLPT--DEVKNVTVN--VFQIIQNDSKKWDKTFS 232
            ++  +  K     F ++  QF + L      DE   +  N  V Q++   S  W K   
Sbjct: 125 IRNSMDKDKKGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWPKLLP 184

Query: 233 ELFTGNRKPLNDRIEV---------YLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYT 283
           E+F+G +K   +R +V          LP+++ + T++  LGSS+   RK + P SFVDY 
Sbjct: 185 EVFSGTQKL--ERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVDYH 242

Query: 284 LNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPG-LTHL 342
           L+ ++A+ F     K L    V++TSFNN  L     YFR K KLENDL   +P  L  L
Sbjct: 243 LSFNLAQEFTNTTDKKL----VVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298

Query: 343 TILRPGPLIGQHGKQIILAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVT 402
            ILRPGP+ GQHG  + +   +     +  + + + R +LK K   +S+V+ VG   +++
Sbjct: 299 IILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLS 358

Query: 403 ELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAMTKRN 440
           E+IA + Y +PG+ ++GYS+P SKV+ +A+  A+ K++
Sbjct: 359 EVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKKS 396

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  153 bits (386), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 114/392 (29%), Positives = 188/392 (47%), Gaps = 56/392 (14%)

Query: 100 DNVIILGSTGLTGSQVLKGCM---------------APWTSGVLYDLKLTKNIWCFNRR- 143
           D +++ GS+GL G   L+  +                     +  D+ L K+++C NRR 
Sbjct: 10  DYILLFGSSGLAGRGTLENLLDINFYIKNVSDLQDKLDSLKEIKEDVVLNKHVFCINRRN 69

Query: 144 -------LKTVDFSISKLPPTW--------TAVVNYGG------EPHIIRKYDLKIKQHI 182
                  LKT+D+ ++    TW        +   N  G      +      ++    +  
Sbjct: 70  VTEQKSFLKTIDY-VNMKSITWKGGRYYLRSRTANDNGRETSSTDTFFYDNFEEGFIRGA 128

Query: 183 TEIGKLDGLEFQWDQ--FDWELKLPTDEVKNVTV----NVFQIIQNDSKKWDKTFSELFT 236
              G+     F ++Q  F + L     + ++  +     V Q+I   S+ W +  S +F+
Sbjct: 129 AYEGQKGNFSFAYNQKQFSYSLHYACRKEESFGIKYNFTVTQLIIPPSESWPRLLSRIFS 188

Query: 237 GNRK----PLNDRIEVY---LPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMDMA 289
             +K     ++++  V    LPS+  + T++ TLGS+S   R+ + P SFVDY L   +A
Sbjct: 189 KEQKLEKFDIDNKTYVADKSLPSLRDIGTMVCTLGSTSARVRRTQVPNSFVDYHLVFSLA 248

Query: 290 KVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPG-LTHLTILRPG 348
           + FA    K L    V+VTSFNN  L     YFR K KLENDL   +P  L  L ILRPG
Sbjct: 249 QEFANTTNKRL----VVVTSFNNDLLMRTFEYFRIKAKLENDLEEALPNKLKELVILRPG 304

Query: 349 PLIGQHGKQIILAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVTELIAKA 408
           P+ GQHG  + +   +        +   + R +LK K  ++S+ + VG   K++ELIA +
Sbjct: 305 PMCGQHGDPVNVKLDVQENPTFSERILYYPRYVLKYKKQYISEARKVGLRTKLSELIASS 364

Query: 409 TYHLPGNWIVGYSIPSSKVARIAAKEAMTKRN 440
            Y +PG+ ++GYS+P SKV+ + + +A+ KR+
Sbjct: 365 IYRMPGSALLGYSVPVSKVSYVTSLKAIEKRS 396

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  149 bits (377), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 119/401 (29%), Positives = 194/401 (48%), Gaps = 65/401 (16%)

Query: 95  VNEKGDNVIILGSTGLTGSQVLKGCM---------------APWTSGVLYDLKLTKNIWC 139
           VN   D V++ GS+ L G  +L+  +                   S +  ++ L K+++C
Sbjct: 5   VNTFTDYVLLFGSSSLVGKGILENLLDINLYIKNVSDLQGKLDSLSEIKGNVVLNKHVFC 64

Query: 140 FNRR--------LKTVDFSISKLPPTWTAVVNY------------GGEPHIIRKYDLK-- 177
            NRR        +KT+D+ I+    TW     Y               P+     + +  
Sbjct: 65  VNRRCINEEKSFMKTIDY-INMRSVTWQGGRYYLRSRKEKDTEKVPSSPNTFCYDNFEEG 123

Query: 178 -IKQHITEIGKLDGLEFQWDQ--FDWELKLPTDEVKNVTV----NVFQIIQNDSKKWDKT 230
            IK    E GK DG  F ++Q  F + L     + K + +     V Q+I   S+ W K 
Sbjct: 124 FIKNTPEERGK-DGYSFVYNQKQFSYTLHYACGKEKGIEIICNFTVTQLIIPRSETWPKL 182

Query: 231 FSELFTGNRK----PLNDRIEV---YLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYT 283
              +F+G +K     ++++  V    LPS+  + T++ +LGS+S   R+ + P SF DY 
Sbjct: 183 LPRIFSGTQKLEKFDIDNKNYVPGRSLPSLCDISTMVCSLGSTSARVRRTQVPSSFADYY 242

Query: 284 LNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPG-LTHL 342
           L  ++A+ F     K L    V+ T+FNN  L     YFR K KLENDL   +P  L  L
Sbjct: 243 LPFNLAQEFTNTTNKRL----VVTTAFNNDFLSKTFEYFRIKAKLENDLDEALPNKLKEL 298

Query: 343 TILRPGPLIGQHGKQIILAPQLPVG---SGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSK 399
            ILRPGP+ GQHG  I     + +G   S  L K + +   LL  K  ++S+ + +G   
Sbjct: 299 VILRPGPMCGQHGNPI----NVELGKENSTFLEKIFYYPHYLLVYKKKYISEARRIGLRT 354

Query: 400 KVTELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAMTKRN 440
           K++E+IA + Y +PG+ ++GY++P SKV+ +A+  A+ +++
Sbjct: 355 KLSEIIASSIYRMPGSALLGYAVPVSKVSYVASLMAIERKS 395

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score =  138 bits (348), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 117/413 (28%), Positives = 176/413 (42%), Gaps = 77/413 (18%)

Query: 100 DNVIILGSTGLTGSQVLKGCMAPWT---------SGV--LY------------------- 129
           DNV+ILG+TGLTGS +L     PW          S V  LY                   
Sbjct: 81  DNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFVKKPKS 140

Query: 130 ----------DLKLTKNIWCFNRRLKTVD-FSISKLPPTWTAVVNY------GGEPHIIR 172
                      +++TKN++C  RR   V+   +  L  +W   V         G+  I R
Sbjct: 141 PLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGFDLICGKGGISR 200

Query: 173 KYDLKIKQHITEIG---KLDGLEFQWDQFDWELKLPTDEVKN-------------VTVNV 216
              L+    + E+       G E       +  KL  +  ++             + +NV
Sbjct: 201 DCTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENSRDPHGDTCGHALMVKLNINV 260

Query: 217 FQIIQNDSKKWDKTFSELFTGNRK------PLNDRIEVY----LPSIDQVETLISTLGSS 266
             +I  DS++W    +++F G +       P    +E       PS+  V TL+S LGS+
Sbjct: 261 ICVIDTDSQRWPALLTDVF-GEQPMKRGLIPQGQGLEGISHWEFPSLGDVGTLVSALGST 319

Query: 267 SWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQ 326
             + RK   PR +VDY LN+ +A+ F   + +   K +V+VTSFN+  L  +S YF+TK 
Sbjct: 320 RHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKL 379

Query: 327 KLENDLTYDVPGLTHLTILRPGPLIGQHGKQIILAP---QLPVGSGVLYKCYAWKRSLLK 383
           KLE DL   V G+ +L +LRPGPL+G H       P   +       L+     K+    
Sbjct: 380 KLEQDLYTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAALFHILVLKKRCFD 439

Query: 384 AKLHWLSQVKDVGPSKKVTELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAM 436
            K+  L  +  VG   K++EL A+  Y  P   +V     + KVA  AA  A+
Sbjct: 440 RKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKVAFFAASRAI 492

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score =  135 bits (339), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 105/387 (27%), Positives = 182/387 (47%), Gaps = 53/387 (13%)

Query: 101 NVIILGSTGLTGSQVLKGCMAPW---TSGV-------------LYDLKLTKNIWCFNRRL 144
           N+++ GSTGLTGS V +  + P     S V             L ++ +   ++CFNR++
Sbjct: 22  NILLFGSTGLTGSLVFEYLLDPCFYLNSAVELRELLLEAIEEGLENVTIKTCLYCFNRKI 81

Query: 145 -KTVDFSISKLPPTWTAVVNYGGEPHIIRK---YDLKIKQHI--TEIGKLDGL------- 191
            + +D  +            + G  +   K     L I Q I  +     DG        
Sbjct: 82  GEPLDKYLKSPSANSFGPFCFNGSQYHYNKGTCVPLDIDQDIETSNDATFDGFLYYKDKG 141

Query: 192 -----------EFQWDQFDWELKLPTDEVK----NVTVNVFQIIQNDSKKWDKTFSELFT 236
                      E+   ++ + L+  + E      N   N  Q+I  +S  W      +F+
Sbjct: 142 KNVTGKNPISGEYYGKEYMYYLEYMSAEGNLLKLNFIFNHIQLIIKNSFSWPSVIPIIFS 201

Query: 237 GNRKPLNDR----IEVYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVF 292
              + ++ R    ++ Y P +  ++T+IST+G+++  ++   T  + +DY LN+D+ K F
Sbjct: 202 DEVEAISFREKMPLKRYFPLLSDIKTMISTIGTTTNRNKISNTTYNDIDYQLNVDLVKAF 261

Query: 293 APDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV-PGLTHLTILRPGPLI 351
           +    KS+I    IVTSFNN  +  +SPYF+ K KLE+ L   + P L  LTILRPGPL+
Sbjct: 262 SNTDDKSVI----IVTSFNNTIISTVSPYFKIKMKLESTLANAITPPLKTLTILRPGPLV 317

Query: 352 GQHGKQIILAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVTELIAKATYH 411
           G+H         +   S +  +    K++ L+    ++  ++  G S K +E++A+  Y 
Sbjct: 318 GRHSDIYPTNDSILKNSSLFERALLHKKAFLQNMECFVDDIRTGGMSIKASEIVARTFYR 377

Query: 412 LPGNWIVGYSIPSSKVARIAAKEAMTK 438
           +PG+ ++GY IP+ KVA   +  A+ K
Sbjct: 378 IPGSKLLGYCIPAQKVAYAISIAAVDK 404

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score =  132 bits (332), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 103/388 (26%), Positives = 177/388 (45%), Gaps = 77/388 (19%)

Query: 100 DNVIILGSTGLTGSQVLKGCMAP----------------WTSGVLYDLKLTKNIWCFNRR 143
           D++++ GSTGL GS  L+  +                  + +  +    L K  +C NR+
Sbjct: 15  DHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDINHFTLNKFFYCVNRK 74

Query: 144 LKTVDFSISKLPPTWTAVVNYGGEPHIIRKYDLKIKQHIT---------------EIGKL 188
           L     S    P     +      P + R  D  +  + +                + + 
Sbjct: 75  LNNEKRS----PGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPSLGNNVFEE 130

Query: 189 DG--------------LEFQWDQFDWELKLPTDEVKNVTVN----VFQIIQNDSKKWDKT 230
           DG              L F+  +  ++L+  + ++KN+ +     + Q++  DS +W   
Sbjct: 131 DGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADL 190

Query: 231 FSELFTGNRKPL---NDRIEVYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMD 287
              +F+G  + +   ++     LP +DQV+T+I TLG +S  ++     R FV+Y L   
Sbjct: 191 LPSIFSGEVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQ 250

Query: 288 MAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV-PGLTHLTILR 346
           + + FA  + K L    VI+TSFNN  +  + PYF+ K +LENDL   V P L  L +LR
Sbjct: 251 IVQNFASCEDKRL----VIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLR 306

Query: 347 PGPLIGQHGK------QIILAPQLPVGSGVLYK--CYAWKRSLLKAKLHWLSQVKDVGPS 398
           PGP++G H        ++  +P L       YK  C+ +K+S +K       +++ +G  
Sbjct: 307 PGPIVGNHVNLNDRDLRLRYSPSL-CEQLKHYKEWCWEYKKSFVK-------EIRKIGFK 358

Query: 399 KKVTELIAKATYHLPGNWIVGYSIPSSK 426
            K +EL+AKA Y  PG+ ++GY +P+SK
Sbjct: 359 TKASELVAKAMYRKPGSSVLGYCVPASK 386

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score =  112 bits (280), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 132/255 (51%), Gaps = 24/255 (9%)

Query: 212 VTVNVFQIIQNDSKKWDKTF-SELFTGNRKPLNDRIEVYLPSIDQVETLISTLGSSSWES 270
           V V V  I + DS KW +     +F      +ND      PS D   ++IS LGS+S  S
Sbjct: 102 VNVEVTTIKEPDSTKWAQMIPHHIF------IND------PSADL--SVISCLGSTSARS 147

Query: 271 RKMKTPRSFVDYTLNMDMAK-VFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLE 329
           ++    R +VD  LN+D+ K +   D     +   +I+TSFNN A+  + PYF+ KQ+LE
Sbjct: 148 KRTGVARDWVDKILNLDILKAILNNDILSQKLSQYIIMTSFNNFAISRMFPYFKAKQELE 207

Query: 330 NDLTYDVPG-LTHLTILRPGPLIGQHGK-QIILAPQLPVGSGVLYKCYAWKRSLLKAKLH 387
            +  + +      + ILRPGPLIG+HG       P+L     +L+    +K+++    + 
Sbjct: 208 TNTQFLLQNHRASIVILRPGPLIGKHGSTSSFTVPEL--DDRLLHSILRYKKAIFHHYVR 265

Query: 388 WLSQVKDVGPSKKVTELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAMTKRNLARNDSD 447
            +++ KDVG + + +EL+A+ +Y++PG + VGY +     A +   E +    L      
Sbjct: 266 RMNEWKDVGIATRTSELVAQFSYNMPGAFFVGYPVKVLDCAHVIVTERVKHFKLPSLQPQ 325

Query: 448 ALVVEVTLWSSQEMD 462
               +VT +SSQ++D
Sbjct: 326 ----KVTYFSSQQID 336

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  111 bits (278), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 88/337 (26%), Positives = 160/337 (47%), Gaps = 37/337 (10%)

Query: 131 LKLTKNIWCFNRRLKTVD-FSISKLPPTWTAVVNYGGEPHIIRK------YDLKIKQHIT 183
           +K+ KNI+C NRR +T+D F+   L       + +    + + K      Y+     +  
Sbjct: 71  IKIVKNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRLDKTPGETSYESSYLTNEI 130

Query: 184 EIGKLD-GLEFQWDQFDWELKLPTDEVK-----------NVTVNVFQIIQNDSKKWDKTF 231
           E GK++   E  +    +EL+    ++               ++V+ II   S +W    
Sbjct: 131 ESGKINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIPTSNQWPTLL 190

Query: 232 SELFTGNRKPLNDRIE--------VYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYT 283
             +F  N   + +++E          LP +  + T+IS+LG +  +    +     +D+ 
Sbjct: 191 PRIF--NPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFD 248

Query: 284 LNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV-PGLTHL 342
           L + + + FA +  K L    V++T+FNN  +  +  YF  K K+E  L  ++ P L+ L
Sbjct: 249 LTLKLTQTFANNNNKKL----VVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQL 304

Query: 343 TILRPGPLIGQHGKQII---LAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSK 399
            ILRPGP++G      I     P L     ++ +    K+ LL  KL  L + +  G + 
Sbjct: 305 VILRPGPIVGVPMTDAINPEFNPILKKSDNLVEQSILLKKYLLDYKLATLKKYRSTGIAP 364

Query: 400 KVTELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAM 436
           ++T+++AK  Y  PG  ++GY IP++KVA++AA +A+
Sbjct: 365 RLTDILAKTMYRKPGTSVLGYCIPATKVAKVAALKAI 401

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score =  107 bits (267), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 132/252 (52%), Gaps = 28/252 (11%)

Query: 125 SGVLYDLKLTKNIWCFNRRLKTVDFSISKLPPTWTAVVNYGG---------EPHIIRKYD 175
           SGV YD+   K I+CFNR  + + +          +  ++GG         EP+   +  
Sbjct: 50  SGV-YDIAFDKIIYCFNRTPQNIRYKYHS-DFEKNSQFDFGGTKYTLSNNPEPNNSFESK 107

Query: 176 LKIKQHITEIGKLDGLEFQWDQFDWELKLPTDEVK--NVTVNVF--QIIQNDSKKWDKTF 231
            +++  I ++ +   +++Q   +  E     +E +  NVT NVF  QI+ N+S+KW    
Sbjct: 108 GQLQFAINDVEERIKIKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLL 167

Query: 232 SELFTGNR-----KPLNDRI--EVY-LPSIDQVETLISTLGSSSWESRKMKTPRSFVDYT 283
             LFTG       +   DR+  E++ L +I+ + T++ TLG+SS  ++K     + +DY 
Sbjct: 168 PILFTGENEIKIARKRKDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYD 227

Query: 284 LNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV-PGLTHL 342
           L  ++ + F   + K +I    IVTSFNN  +  + PYFRTK +LENDL   + P +  L
Sbjct: 228 LTYNLIRAFTTTENKKVI----IVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKEL 283

Query: 343 TILRPGPLIGQH 354
            ILRPGP+ G+H
Sbjct: 284 YILRPGPIKGKH 295

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 120/254 (47%), Gaps = 22/254 (8%)

Query: 193 FQWDQFDWELKLPT---DEVK-NVTVNVFQIIQNDSKKWDKTFSELFTGN-----RKPLN 243
           F   Q+D  L   +   D +K N  + ++ +   DS  W      LF  N      K L 
Sbjct: 217 FNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLVPNKGLI 276

Query: 244 DRIEVY---LPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSL 300
           + I++    LP + +V+ ++++LGS S  S K +T ++ +DY LN+ +   F     K +
Sbjct: 277 ENIDLTNEKLPLLSEVKVMLNSLGSRS-HSPKNETFKN-IDYKLNLSLINSFNNTSDKKV 334

Query: 301 IKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPG-LTHLTILRPGPLIGQ-HGKQI 358
           I    I+TS N       S Y   K  LE DL  ++   +  L ILRPGPL+G     ++
Sbjct: 335 I----IITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTKL 390

Query: 359 I--LAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVTELIAKATYHLPGNW 416
           I  L   L      L +   +KR     K+  L ++K  G     T ++AK  Y  PG  
Sbjct: 391 IPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPGTS 450

Query: 417 IVGYSIPSSKVARI 430
           ++GY+IP+SKVA +
Sbjct: 451 LLGYTIPASKVAEV 464

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 85/352 (24%), Positives = 133/352 (37%), Gaps = 109/352 (30%)

Query: 97  EKGDNVIILGSTGLTGSQVLKGCMA---------------------PWTSGV-LYDLKLT 134
           E+  N I  GSTG+TG   L   +                       W +     DL L 
Sbjct: 2   EQETNYIFFGSTGMTGFTTLTNLLNINSYLQAKDPQSAIDNLPQDFQWQACDDSLDLYLV 61

Query: 135 KNIWCFNRRLKTVDFSISKLPPTWTAVVNYGGEPHIIRKYDLK-------IKQHITEIGK 187
           KNI+C NRR       + +   +    +NY       + ++L+       +  +ITE  +
Sbjct: 62  KNIFCINRRFFDSPIYLDEKIISSNISINYKD-----KTFELQFQSNTNSVSNNITEQNE 116

Query: 188 L-------DGLEFQWDQFDWELK---------LPTDEV---------------------- 209
           L       D L +  D  + +L+         L TDEV                      
Sbjct: 117 LKLPLVSTDCLRYFIDTGNIQLETTPGKENQILTTDEVWYHFNQQLCQLNFKQINLNENE 176

Query: 210 ------------KNVTVNVFQIIQNDSKKWDKTFSELF------------TGNR--KPLN 243
                        N  +N++Q +   S  W +    +F            T N   +  N
Sbjct: 177 NDNDNVQEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTN 236

Query: 244 DRIEVYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSLIKH 303
           ++  + LP ++ ++ +I TLG++    +K       +D+ L   ++  F+      L K 
Sbjct: 237 EKSNIVLPKLEDIQVMICTLGTNLLCDQKK------IDFDLTFQLSNWFS----NRLGKK 286

Query: 304 MVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPG-LTHLTILRPGPLIGQH 354
           +VIVT+FNN  L     YF  K +LE  L YD+   L  L ILRPGPL+G H
Sbjct: 287 LVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTH 338

>ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar to
           uniprot|P40008 Saccharomyces cerevisiae YER004W FMP52
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 225

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 73/162 (45%), Gaps = 34/162 (20%)

Query: 196 DQFDWELKLPTDEVKNVTVNVFQIIQNDSKKWDKTFSELFTGNRKPLNDRIEVYLPSIDQ 255
           D+F     +   E+ +   NV QI++ DS KW + F E  TG                  
Sbjct: 24  DKFTEVFTITRRELPSDADNVKQIVETDSSKWAQLFPE--TG------------------ 63

Query: 256 VETLISTLGSSSWESRKMKTPRSF--VDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNL 313
           V+   S  G++   +    +  +F  +D+ LN+++AK      K      MV+V+S    
Sbjct: 64  VKFYFSAFGTTRAAA---GSAENFYKIDHDLNVELAKA----AKTKGCTTMVLVSSVGAN 116

Query: 314 ALGVLSPYFRTKQKLEND-LTYDVPGLTHLTILRPGPLIGQH 354
              +L PYF+ K ++E D L  D     H  ILRPGPL+G+ 
Sbjct: 117 ENSML-PYFKDKGEIERDILALD---FDHTIILRPGPLLGRQ 154

>Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADR005W
          Length = 224

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 79/173 (45%), Gaps = 28/173 (16%)

Query: 229 KTFSELFTGNRKPL-----------NDRIEVYLPSI-DQVETLISTLGSSSWESRKMKTP 276
           K FS +++ +R+ +           N+  E ++ SI D +  L S LG++   +  ++  
Sbjct: 25  KLFSNVYSISRREIPNCGDSVKSIINEDTETWIDSIPDGINVLFSALGTTKAAAGSIENQ 84

Query: 277 RSFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV 336
              +D+ LN+ +AK      K+   K +V+V+S        L PYF+ K +LE D+    
Sbjct: 85  YK-IDHGLNLAVAKA----AKEKGCKTLVLVSSLGASIESRL-PYFKMKGELERDVL--A 136

Query: 337 PGLTHLTILRPGPLIGQHGKQIILAPQLPVGSGVLYKCYAWKRSLLKAKLHWL 389
            G     +LRPG L+G+             G  ++ K  +W   + + KL +L
Sbjct: 137 LGFERTILLRPGVLLGERDSNYT-----GFGRSLITKLASW---IYRGKLQYL 181

>NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 61/149 (40%), Gaps = 36/149 (24%)

Query: 230 TFSELFTGNRKPLNDRIEVYLPSIDQVETLISTLGSSSWES----------RKMKTPRSF 279
            FS++FT  R+PL        P  D V + I    +S W              + T R  
Sbjct: 25  AFSKIFTLTRRPL--------PESDTVASQIVETDNSKWTGLIPDDTKFIFTALATTRGA 76

Query: 280 V---------DYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLEN 330
           V         D+ LN+D+AK  A  +K       V++ S +  +L     Y R K ++E 
Sbjct: 77  VGGFDNQYKIDHDLNVDLAK--AAKEKGC---STVVLVSSSGASLDSRFSYMRMKGEIER 131

Query: 331 D-LTYDVPGLTHLTILRPGPLIGQHGKQI 358
           D L  D     H  ILRPG L+G   K I
Sbjct: 132 DILALD---FDHTIILRPGILLGDRDKGI 157

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 62/136 (45%), Gaps = 28/136 (20%)

Query: 218 QIIQNDSKKWDKTFSELFTGNRKPLNDRIEVYLPSIDQVETLISTLGSSSWESRKMKTPR 277
           QI++ D+ KW   F                   P+ D+++ L++ L ++   +   +  +
Sbjct: 49  QIVEKDNSKWISHF-------------------PT-DKIDILMTGLATTKKAAGGAQ-QQ 87

Query: 278 SFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVP 337
            ++D+ LN+D    FA   K++     V+V+S    A    S +F  K K E +      
Sbjct: 88  YYIDHDLNID----FAKKAKENGCSTFVVVSSAGASAD---SRFFYLKMKGEIERDLKAI 140

Query: 338 GLTHLTILRPGPLIGQ 353
              HL ILRPGPL+G+
Sbjct: 141 DFDHLIILRPGPLLGE 156

>NDAI0E03640 Chr5 complement(784609..785286) [678 bp, 225 aa] {ON}
           Anc_7.148 YER004W
          Length = 225

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 82/186 (44%), Gaps = 41/186 (22%)

Query: 216 VFQIIQNDSKKW-----DKTFSELFTGNRKPLNDRIEVYLPSIDQVETLISTLGSSSWES 270
           + Q+++ D+ KW     DK  + LFT                     +L +T G++    
Sbjct: 45  ITQLVETDNSKWASMIPDKEINVLFT---------------------SLSTTRGAAGGFD 83

Query: 271 RKMKTPRSFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLEN 330
            + K     +D+ LN+++AK  A ++  S I   V+V+S    A   ++ Y R K ++E 
Sbjct: 84  EQYK-----IDHDLNIELAKA-AKEKGCSTI---VLVSSRGAHADSRMA-YTRMKGEIER 133

Query: 331 DLTYDVPGLTHLTILRPGPLIGQHGKQIILAPQLPVGSGVLYKCYAWKRSLLKAKLHWLS 390
           D+     G  H  ILRPG L+GQ            + S +    Y  KR+L K   H + 
Sbjct: 134 DII--ALGFDHTIILRPGILLGQRDSNGDSGFGGGIASMIGGFLYNHKRNLFKG--HSV- 188

Query: 391 QVKDVG 396
           + +DVG
Sbjct: 189 EAEDVG 194

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 65/143 (45%), Gaps = 22/143 (15%)

Query: 228 DKTFSELFTGNRKPLNDRIEVYLPSI-------------DQVETLISTLGSSSWESRKMK 274
           D +F+E+ T +RK LN   +  + S+             +  + L S L ++  E+ K  
Sbjct: 25  DPSFTEIATISRKALNGNYDGKVRSLILEDSSNWSAAVPENYDILFSGLATTRGEAGKEN 84

Query: 275 TPRSFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTY 334
             +  VD+ +N+ +A+      K+      V+V+S        +  Y +TK +LE D+  
Sbjct: 85  FYK--VDHDMNLQLAR----SAKEKGYSTYVVVSS-TGADENSMFYYMKTKGELERDIL- 136

Query: 335 DVPGLTHLTILRPGPLIGQHGKQ 357
              G     ILRPGPL+G+  K 
Sbjct: 137 -ALGFERTIILRPGPLLGERTKS 158

>TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.148
           YER004W
          Length = 224

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 12/94 (12%)

Query: 259 LISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVL 318
           L +T G++    ++ K     +D+ LN+++AKV     K+      V+V+S        +
Sbjct: 70  LATTRGAAGGFDKQYK-----IDHDLNIELAKV----AKEKGCSTFVLVSS-GGAKEDSM 119

Query: 319 SPYFRTKQKLENDLTYDVPGLTHLTILRPGPLIG 352
             Y + K ++E D+     G  H  ILRPGPL+G
Sbjct: 120 FAYMKMKGEIERDIL--ALGFDHTIILRPGPLLG 151

>TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON}
           Anc_7.148 YER004W possible pseudogene; truncated at 5'
           end
          Length = 161

 Score = 36.2 bits (82), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 280 VDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPGL 339
           +D+ LN+ +AK      K++     V+V+S    A    + Y + K ++E DL  +  G 
Sbjct: 20  IDHNLNIHLAK----KAKENGCSTFVLVSSSLANADSRFT-YLKMKGEIERDL--EAIGF 72

Query: 340 THLTILRPGPLIGQ 353
            HL ILRPG L+G+
Sbjct: 73  DHLIILRPGKLLGE 86

>Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..22242)
           [666 nt, 222 aa]
          Length = 221

 Score = 36.6 bits (83), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 61/136 (44%), Gaps = 29/136 (21%)

Query: 218 QIIQNDSKKWDKTFSELFTGNRKPLNDRIEVYLPSIDQVETLISTLGSSSWESRKMKTPR 277
           QI++ DS KW    SEL               +P  D  + L S L ++   +  +    
Sbjct: 45  QIVEKDSTKW----SEL---------------IP--DDTKYLFSGLATTRAAAGGLDNQY 83

Query: 278 SFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVP 337
             +DY LN+++AK      K+     +V+V+S        ++ Y + K ++E D+     
Sbjct: 84  K-IDYDLNIELAKA----AKEKGCSTLVLVSSAGANEHSWIA-YLKMKGEIERDMIK--L 135

Query: 338 GLTHLTILRPGPLIGQ 353
           G  H  ILRPG ++G+
Sbjct: 136 GFDHTIILRPGAILGE 151

>NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 7/78 (8%)

Query: 280 VDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPGL 339
           +D+ LN+++AK       K+     ++V S +  +L     Y R K ++E D+       
Sbjct: 86  IDHDLNLELAKA-----AKAKGCSTIVVVSSDRASLDSRFSYMRMKGEIERDIV--ALDF 138

Query: 340 THLTILRPGPLIGQHGKQ 357
            H  ILRPG L+G+   Q
Sbjct: 139 DHTIILRPGILLGERDPQ 156

>KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.148
           YER004W
          Length = 225

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 62/140 (44%), Gaps = 27/140 (19%)

Query: 219 IIQNDSKKWDKTFSELFTGNRKPLNDRIEVYLPSIDQVETLISTLGSSSWESRKMKTPRS 278
           I+  DS  W    S         L++ I+V   ++     +    G + ++ +       
Sbjct: 48  IVDKDSSNWSNIIS--------GLDENIDVLFTALATTRAV----GGTGYQYK------- 88

Query: 279 FVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPG 338
            +D+ LN+++AK  A ++  S I   VIVT+    A    S +F TK K E +      G
Sbjct: 89  -IDHDLNVELAKA-AREKGCSTI---VIVTAHGAHAD---SRFFYTKMKGEIERDISDLG 140

Query: 339 LTHLTILRPGPLIGQHGKQI 358
                ILRPG L+G+  +++
Sbjct: 141 FNRTIILRPGILLGERHERL 160

>KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 8/101 (7%)

Query: 256 VETLISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLAL 315
           ++ LI  LG++   +R     +  VD+ L +++A V     K+    H V+V S      
Sbjct: 69  LDVLICALGTT--RARSNAEEQYAVDHDLTLELATV----AKREKHAHTVVVVSSTGAHP 122

Query: 316 GVLSPYFRTKQKLENDLTYDVPGLTHLTILRPGPLIGQHGK 356
                Y R K  +E D+T       H  +LRPG L+G+  K
Sbjct: 123 ESRFFYARMKGDVERDITE--LQFNHTVLLRPGILLGERYK 161

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 280 VDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPGL 339
           +D+ LN+ +A+  A D+    I   V+V+S    A      Y + K ++E D+       
Sbjct: 89  IDHDLNLQLARA-AKDKGCETI---VLVSSAGAHADSRFG-YMKMKGEIERDVI--ALNF 141

Query: 340 THLTILRPGPLIG--QHGKQIILAPQLPVGSGV 370
            H  ILRPGPL+G  ++ KQ      L    GV
Sbjct: 142 KHTIILRPGPLLGERENSKQSGFGGNLAAALGV 174

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 7/74 (9%)

Query: 280 VDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPGL 339
           +D+ LNM +A+  A D+    I    ++ S     +     Y + K ++E D+       
Sbjct: 89  IDHDLNMQLARA-AKDRGCDTI----VLVSSAGAHVDSRFGYMKMKGEIERDII--ALNF 141

Query: 340 THLTILRPGPLIGQ 353
            H  ILRPGPL+G+
Sbjct: 142 KHTIILRPGPLLGK 155

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 7/77 (9%)

Query: 280 VDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPGL 339
           +D+ LN+ +A+      K+   + +V+V+S           Y + K ++E D+       
Sbjct: 89  IDHDLNLQLARA----AKEKGCETIVLVSSAGAHPDSRFG-YMKMKGEIERDVI--ALNF 141

Query: 340 THLTILRPGPLIGQHGK 356
            H  ILRPGPL+G+  K
Sbjct: 142 KHTIILRPGPLLGERTK 158

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 7/74 (9%)

Query: 280 VDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPGL 339
           +D+ LN+ +A+      K+   + +V+V+S           Y + K ++E D+       
Sbjct: 89  IDHDLNLQLAQA----AKEKGCETIVLVSSAGAHPDSRFG-YMKMKGEIERDVI--ALDF 141

Query: 340 THLTILRPGPLIGQ 353
            H+ ILRPGPL+G+
Sbjct: 142 KHIIILRPGPLLGE 155

>KAFR0I01130 Chr9 complement(218147..228016) [9870 bp, 3289 aa] {ON}
           Anc_5.576 YDR457W
          Length = 3289

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 62/121 (51%), Gaps = 11/121 (9%)

Query: 204 LPTDEVKNVTV-NVFQIIQNDSKKWDKTFSELFTGNRKPLN-------DRIEVYLPSIDQ 255
           +P D  ++ T+ ++F   +N   KW K     F+  +KP N         ++ +  S + 
Sbjct: 182 VPDDNGEHFTIADLFFDKKNIPSKWTKLKYAYFSSEKKPHNRDGNQQSSSMKKFCLSNED 241

Query: 256 VETLISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSL-IKHMVIVTSFNNLA 314
           + T   +L     +  ++    ++ DY+L + +AK F+ D  ++L +++++I T FN++A
Sbjct: 242 LRTF--SLQQLFDKGMEVLPSETWFDYSLQVTLAKAFSDDSYENLQLRNLIIRTKFNSVA 299

Query: 315 L 315
           L
Sbjct: 300 L 300

>Suva_7.567 Chr7 (986644..992544) [5901 bp, 1966 aa] {ON} YGR271W
           (REAL)
          Length = 1966

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 188 LDGLEFQWDQFDWELKLPTDEVKNVTVNVFQIIQNDSKKWDKTFSELFTGNRKPLNDRIE 247
           LD  + Q+ +FD ELK   ++ +N    +  ++  D   WD  F E    + K L  RI+
Sbjct: 29  LDKSKIQFPEFDNELKRSREDEQNKKTEL-TVLSQDRNDWDDIFDEFQDISFKQLQSRID 87

Query: 248 VY 249
            Y
Sbjct: 88  SY 89

>TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.148
           YER004W
          Length = 226

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 319 SPYFRTKQKLENDLTYDVPGLTHLTILRPGPLIGQHGKQ 357
           + Y + K ++E D+T    G  H  ILRPG L+G+   Q
Sbjct: 123 AGYLKMKGEIERDVTK--LGFDHTIILRPGVLLGERDSQ 159

>KLTH0C09636g Chr3 (800421..802229) [1809 bp, 602 aa] {ON} weakly
           similar to uniprot|P40960 Saccharomyces cerevisiae
           YDR488C PAC11 Dynein intermediate chain acts in the
           cytoplasmic dynein pathway forms cortical cytoplasmic
           microtubule capture site with Num1p null mutant is
           defective in nuclear migration essential in the absence
           of CIN8
          Length = 602

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 347 PGPLIGQHGKQIILAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVTEL 404
           P P + +  ++  L   LPV    LY C +    LL + + W   V DV   KKVT++
Sbjct: 445 PAPTVAEGLQETTLFHSLPVTG--LYTCRSAPNLLLSSSMDWECAVWDVINCKKVTQI 500

>Ecym_5177 Chr5 complement(368135..371491) [3357 bp, 1118 aa] {ON}
           similar to Ashbya gossypii AEL104W
          Length = 1118

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 57/119 (47%), Gaps = 13/119 (10%)

Query: 257 ETLISTLGSSSWESRKMKTPR-SFVDYTLNMD-------MAKVFAPDQKKSLIKHMVIVT 308
           E +++ + S+   +R + TPR S   YTL ++       +  ++ P ++  LIK   + +
Sbjct: 262 EEILNNMQSALLLTRTVATPRDSIKPYTLKLETTRFEKSLCSLYTPCEQ--LIKSTDVSS 319

Query: 309 SFNNLALGVLSPYFRTKQKLENDLTYDVPGLTHLTILRPGPL---IGQHGKQIILAPQL 364
           +      G+  P+  +  ++E+D+T D P     + L   P+   +G    ++ + PQ+
Sbjct: 320 NGFRTPNGIADPHRLSYNRVEDDVTLDFPNSAATSKLIESPIDLDLGTESVKVNIIPQV 378

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,815,982
Number of extensions: 2082099
Number of successful extensions: 5435
Number of sequences better than 10.0: 42
Number of HSP's gapped: 5526
Number of HSP's successfully gapped: 44
Length of query: 471
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 358
Effective length of database: 40,524,141
Effective search space: 14507642478
Effective search space used: 14507642478
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)