Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_81835.350ON26526512850.0
AGR350C5.350ON2612525884e-75
Kwal_34.159845.350ON2512575735e-73
SAKL0G08866g5.350ON2552615614e-71
KLTH0H14828g5.350ON2512575266e-66
ZYRO0D10142g5.350ON2552594781e-58
NDAI0C043105.350ON2592494651e-56
KAFR0C018605.350ON2592504632e-56
NCAS0F028605.350ON2532494581e-55
Kpol_339.115.350ON2582544546e-55
KLLA0B10153g5.350ON2672454416e-53
Suva_2.4885.350ON2742674279e-51
CAGL0H07117g5.350ON2602494251e-50
Skud_4.5855.350ON2742584209e-50
Smik_4.5785.350ON2742574209e-50
YDR319C5.350ON2742674201e-49
TBLA0A031105.350ON2752644148e-49
TDEL0E027705.350ON2582484076e-48
TPHA0E011305.350ON2772623852e-44
KNAG0C055105.350ON2642603442e-38
KAFR0A046406.117ON2371461181e-06
Skud_7.1466.117ON3161031182e-06
KNAG0F025106.117ON2461661111e-05
TBLA0F025006.117ON327101920.004
AAR165W6.117ON36242890.008
TPHA0J018106.117ON39047800.11
KLLA0F09526g6.117ON33737780.23
YGL126W (SCS3)6.117ON38036770.27
Smik_7.1456.117ON38036760.32
SAKL0A07062g6.117ON42937760.41
Kwal_14.17966.117ON36337740.57
TDEL0G035306.117ON36837711.6
KLTH0H06556g6.117ON363159702.1
Ecym_30686.117ON36732702.3
NCAS0D031606.117ON39049692.7
CAGL0I00330g6.117ON371149674.1
Kpol_461.26.117ON39735657.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_8183
         (265 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to...   499   0.0  
AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON} ...   231   4e-75
Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C...   225   5e-73
SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly ...   220   4e-71
KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa] ...   207   6e-66
ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {O...   188   1e-58
NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON...   183   1e-56
KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.35...   182   2e-56
NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON...   181   1e-55
Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON} ...   179   6e-55
KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {O...   174   6e-53
Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}...   169   9e-51
CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar...   168   1e-50
Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {O...   166   9e-50
Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {O...   166   9e-50
YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON} ...   166   1e-49
TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON...   164   8e-49
TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.35...   161   6e-48
TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.35...   152   2e-44
KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5....   137   2e-38
KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON...    50   1e-06
Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W (...    50   2e-06
KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON...    47   1e-05
TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.11...    40   0.004
AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic ho...    39   0.008
TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6....    35   0.11 
KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} simila...    35   0.23 
YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protei...    34   0.27 
Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa...    34   0.32 
SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {...    34   0.41 
Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {O...    33   0.57 
TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {O...    32   1.6  
KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {...    32   2.1  
Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}...    32   2.3  
NCAS0D03160 Chr4 complement(593886..595058) [1173 bp, 390 aa] {O...    31   2.7  
CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly s...    30   4.1  
Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON} co...    30   7.8  

>Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to
           Ashbya gossypii AGR350C
          Length = 265

 Score =  499 bits (1285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/265 (94%), Positives = 250/265 (94%)

Query: 1   MFEKISSNMNSFIVNQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYL 60
           MFEKISSNMNSFIVNQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYL
Sbjct: 1   MFEKISSNMNSFIVNQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYL 60

Query: 61  FVINGNNVWLVLYILMAGVQCYIRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKL 120
           FVINGNNVWLVLYILMAGVQCYIRTKE               RERYTIFLCLVKQFIVKL
Sbjct: 61  FVINGNNVWLVLYILMAGVQCYIRTKESDSLPLGGSVPGSSSRERYTIFLCLVKQFIVKL 120

Query: 121 ALKMVLLDRIFWLIDHVFIWTGGRCTVSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLS 180
           ALKMVLLDRIFWLIDHVFIWTGGRCTVSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLS
Sbjct: 121 ALKMVLLDRIFWLIDHVFIWTGGRCTVSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLS 180

Query: 181 LILWCELFSLEQYLSANEIRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGL 240
           LILWCELFSLEQYLSANEIRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGL
Sbjct: 181 LILWCELFSLEQYLSANEIRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGL 240

Query: 241 ILGYVCPVVMYAIIPYYPKLQRILY 265
           ILGYVCPVVMYAIIPYYPKLQRILY
Sbjct: 241 ILGYVCPVVMYAIIPYYPKLQRILY 265

>AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR319C
          Length = 261

 Score =  231 bits (588), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 111/252 (44%), Positives = 163/252 (64%), Gaps = 1/252 (0%)

Query: 4   KISSNMNSFIVNQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVI 63
           ++   M+ +I  +RY  +YP+L+ GG V++L+ G E +E  RK+WYLL  GN VN LFV 
Sbjct: 2   RLQGKMDEYISERRYCYLYPALLLGGEVIKLILGEETIEHDRKTWYLLNGGNFVNQLFVH 61

Query: 64  NGNNVWLVLYILMAGVQCYIRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLALK 123
           +G  +W +L  L+  +Q ++RT E               R    +   +  Q ++K+ L 
Sbjct: 62  HGVLLWTLLMGLVLALQYHVRTTEFDPLPLDARELGPVKRHPLKMLGSMAVQTVIKVLLV 121

Query: 124 MVLLDRIFWLIDHVFIWTGGRCTVSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLIL 183
           + +L  +FW +DH+F+WTGGRCTVSDTK S+ C RL G+WVGGFDISGHFC V NLSL+L
Sbjct: 122 VTVLQALFWFMDHLFVWTGGRCTVSDTKDSVACRRLGGEWVGGFDISGHFCLVMNLSLVL 181

Query: 184 WCELFSLEQYLSANEIRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLILG 243
           W EL  L++Y+ + EI+LRK   W +  +L AL  W+ +L +TA++YHT +EK+LG I G
Sbjct: 182 WLELTELQRYMHSQEIQLRK-FAWARTTVLGALGVWLALLAITAIYYHTFVEKLLGTIFG 240

Query: 244 YVCPVVMYAIIP 255
           Y   +V+Y ++P
Sbjct: 241 YSTSLVIYYVLP 252

>Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C -
           Hypothetical ORF [contig 272] FULL
          Length = 251

 Score =  225 bits (573), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 115/257 (44%), Positives = 165/257 (64%), Gaps = 6/257 (2%)

Query: 9   MNSFIVNQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNV 68
           M+ FI   ++ LVYPS++  G+++ LL  + RLE  R S+YLL+ GN+VN LF   GN  
Sbjct: 1   MDKFIEKAQFTLVYPSILAYGSLINLLVDASRLERQRSSYYLLSSGNIVNKLFAYRGNLT 60

Query: 69  WLVLYILMAGVQCYIRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLALKMVLLD 128
           W +L+ L+A  Q ++  ++                 R      L KQ+ VKL LK VLL 
Sbjct: 61  WTILFTLLAVFQVWLHAEQSDLLPRDARSVHRVGGVR------LAKQYTVKLILKNVLLY 114

Query: 129 RIFWLIDHVFIWTGGRCTVSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELF 188
             F  ID++F+WTGG C+ S T+S+  C +  G W  GFDISGHFCF+TN+SLILW EL 
Sbjct: 115 LAFLFIDNLFVWTGGSCSTSSTRSAERCRKEGGSWDNGFDISGHFCFLTNISLILWYELR 174

Query: 189 SLEQYLSANEIRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLILGYVCPV 248
           S+++ +S+++I   K  I +++  L+ L+TW FIL VTA++YHTLLEKVLGL +GY+CP 
Sbjct: 175 SIQKKISSDDISPTKTWIVLRWSTLIVLITWSFILSVTAVYYHTLLEKVLGLTMGYLCPT 234

Query: 249 VMYAIIPYYPKLQRILY 265
           +MY +IP +  L+ +LY
Sbjct: 235 IMYLVIPNHSGLRSLLY 251

>SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  220 bits (561), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 109/261 (41%), Positives = 170/261 (65%), Gaps = 10/261 (3%)

Query: 9   MNSFI----VNQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVIN 64
           MN+++    +++ ++  YP ++  G ++ LL  ++ L+  +  +YLL+  N++N +F   
Sbjct: 1   MNNYVEKTVLSRSFVWFYPLVLLLGLLVNLLVSAQELDRQKHEYYLLSSRNVINKVFAYQ 60

Query: 65  GNNVWLVLYILMAGVQCYIRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLALKM 124
           GN ++L+ +IL+A +Q +I +K                    T    L +Q+ +K  LK 
Sbjct: 61  GNQIFLITFILLAALQIHIHSKNQDLLPRNSSSSPR------TEAAGLARQYAIKFLLKQ 114

Query: 125 VLLDRIFWLIDHVFIWTGGRCTVSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILW 184
           +LL  +F++IDHVFIWTGG C++S T+S+  C  L G W GGFDISGHFCF+TN+SLILW
Sbjct: 115 LLLYVVFYIIDHVFIWTGGVCSISKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILW 174

Query: 185 CELFSLEQYLSANEIRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLILGY 244
            EL+  ++Y+S NE+R+ ++  WIKY+ L  LV W+F+L VTA +YHT+ EKVLGL++GY
Sbjct: 175 YELYHYQKYISDNELRVNRKFAWIKYLTLFVLVVWLFVLSVTATYYHTVGEKVLGLVMGY 234

Query: 245 VCPVVMYAIIPYYPKLQRILY 265
            CP VMY +IP   KL +++Y
Sbjct: 235 TCPTVMYILIPSTTKLNKLMY 255

>KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa]
           {ON} similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 251

 Score =  207 bits (526), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 160/257 (62%), Gaps = 6/257 (2%)

Query: 9   MNSFIVNQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNV 68
           M+ FI   R+  VYP ++  G V+ LLA    L+  + ++YLL+  N++N +F   GN +
Sbjct: 1   MDKFIERGRFAFVYPVVLICGLVVHLLANGSTLQHQKDTYYLLSPNNVINLVFAYKGNLI 60

Query: 69  WLVLYILMAGVQCYIRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLALKMVLLD 128
           W +L++ +A  Q  IR                    R      L K++ VK+ LK +LL 
Sbjct: 61  WTILFVSLAAYQIKIRVSRSDLLPRDARTTYPARWHR------LGKEYAVKIILKNLLLY 114

Query: 129 RIFWLIDHVFIWTGGRCTVSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELF 188
            IF++ID VF+WTGG C+ S TKS+  C +  GKW  GFDISGHFCF+TN+SLILW EL 
Sbjct: 115 VIFFVIDCVFVWTGGSCSSSATKSAERCRKEGGKWENGFDISGHFCFLTNVSLILWLELS 174

Query: 189 SLEQYLSANEIRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLILGYVCPV 248
           S+++YL+++E    K    + Y  +  LV W F+L VTA++YHT LEK+LGL++GY+CPV
Sbjct: 175 SIQKYLNSDERTPSKLWRVLLYSNVSVLVIWAFVLSVTAIYYHTTLEKILGLLMGYICPV 234

Query: 249 VMYAIIPYYPKLQRILY 265
           +MY ++P +  L+++LY
Sbjct: 235 IMYWLVPSHTALRQLLY 251

>ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  188 bits (478), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 107/259 (41%), Positives = 157/259 (60%), Gaps = 21/259 (8%)

Query: 16  QRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYIL 75
           ++  +VYP  +  G  +  L G ERLES RK  Y L   N +N +F   GN +W +L+  
Sbjct: 9   KKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCG 68

Query: 76  MAGVQCYIRTKEXXXXXXXXXXXXXXXRERYTI----FLCLVKQFIVKLALKMVLLDRIF 131
           +AG+Q Y++T                 R+  TI       L+K++ VK+ LK +LL  IF
Sbjct: 69  LAGLQVYMKTH----------VPDVIPRDARTIVRKPMTSLLKEYAVKIILKNLLLAIIF 118

Query: 132 WLIDHVFIWTGGRCTV-SDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSL 190
             ID++FI TGG C+  S T S+ +C +  G W GGFDISGHFCF+ ++S+ILW EL  L
Sbjct: 119 LFIDNIFILTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHL 178

Query: 191 EQYLSANEIRLRKRL-IWIKYMI---LLALVTWIFILWVTALFYHTLLEKVLGLILGYVC 246
           E +L   +  + KRL +W K +I   +  L TW FIL VT+++YHTLLEK+LG  +GY+C
Sbjct: 179 ESWLIEED--MVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYIC 236

Query: 247 PVVMYAIIPYYPKLQRILY 265
           P++MY +IP +  ++++LY
Sbjct: 237 PIIMYWLIPNHDIVRKVLY 255

>NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON}
           Anc_5.350 YDR319C
          Length = 259

 Score =  183 bits (465), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 152/249 (61%), Gaps = 8/249 (3%)

Query: 21  VYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGVQ 80
           +YP+++F G ++  L  +E L+S + ++Y+L   N+ N +   NGN VW +L+IL++ +Q
Sbjct: 14  IYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILFILLSVIQ 73

Query: 81  CYIRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLALKMVLLDRIFWLIDHVFIW 140
             IR +                + R+     L+KQ+++K  LK VLL  +F +ID +FI 
Sbjct: 74  --IRLQSTNINLLPRHVDSAASKRRHVN--SLIKQYVIKFVLKNVLLAFLFLIIDSLFIL 129

Query: 141 TGGRCT-VSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANEI 199
           TGG C  + D  S+  C    G+W GGFDISGHFCF+ N+SLILW EL  L + L   E 
Sbjct: 130 TGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFLINISLILWSELSLLNKVLEDREE 189

Query: 200 RLRKRLIWIKYMILL---ALVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMYAIIPY 256
              K   W++ +I++    L  W+ IL+VTA++YHTLLEK+LG ILG+VCP+VMY  IP 
Sbjct: 190 TFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFIPN 249

Query: 257 YPKLQRILY 265
             KL++ LY
Sbjct: 250 NVKLKQTLY 258

>KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.350
           YDR319C
          Length = 259

 Score =  182 bits (463), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 99/250 (39%), Positives = 148/250 (59%), Gaps = 9/250 (3%)

Query: 20  LVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGV 79
           L+YP ++F G  +  +   E     +   YLL   N++N +F  NGN VW +L+  +A +
Sbjct: 13  LIYPCILFLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASL 72

Query: 80  QCYIRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLALKMVLLDRIFWLIDHVFI 139
           Q YIR+                   R      L+K+++VK  LK+ +L   F +ID++FI
Sbjct: 73  QIYIRSHTFILLPHDIVDVDSKENVRAK----LLKEYMVKFLLKVFILFVCFLIIDNIFI 128

Query: 140 WTGGRCTVSD-TKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANE 198
            TGG C     T+S+ +C  L G W+GGFDISGHFCF+TN+SLILW EL    +Y    E
Sbjct: 129 LTGGSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEE 188

Query: 199 IRLRKRLIWIKYMILLALVT---WIFILWVTALFYHTLLEKVLGLILGYVCPVVMYAIIP 255
           ++ R    WIK  +++  V    W+F+L VT+++YHT+LEK+LG I+GY CP+VMY +IP
Sbjct: 189 LQSRINK-WIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIP 247

Query: 256 YYPKLQRILY 265
             P+++ +LY
Sbjct: 248 NQPRMKSLLY 257

>NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON}
           Anc_5.350 YDR319C
          Length = 253

 Score =  181 bits (458), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 104/249 (41%), Positives = 150/249 (60%), Gaps = 11/249 (4%)

Query: 20  LVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGV 79
           LVYP+++  G ++  +   E L+  +  +Y+L+  N++N +F  NGN +W +L+ +MA  
Sbjct: 12  LVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYF 71

Query: 80  QCYIRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLALKMVLLDRIFWLIDHVFI 139
           Q +IR +                 +R      L+KQ+IVK  LK +LL   F  ID +F+
Sbjct: 72  QVWIRIRTQDLLPRDAQIINRQRLQR------LIKQYIVKFVLKYLLLFITFLFIDGLFL 125

Query: 140 WTGGRCTVS-DTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANE 198
           +TGG+CT      S+ +C    G W GGFDISGHFCF+ N+SLILWCEL  LE+YL   E
Sbjct: 126 FTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEE 185

Query: 199 IRLRKRLIWIKYMILLA--LVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMYAIIPY 256
           + +    I   Y +LL   L  W+ +L VTA++YHTLLEK+LG +LGY CP++MY +IP 
Sbjct: 186 LEMET--IITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPN 243

Query: 257 YPKLQRILY 265
           + KL  ILY
Sbjct: 244 HYKLNHILY 252

>Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON}
           complement(17930..18706) [777 nt, 259 aa]
          Length = 258

 Score =  179 bits (454), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 104/254 (40%), Positives = 150/254 (59%), Gaps = 15/254 (5%)

Query: 20  LVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGV 79
           L+YP  V  G  +  + G  +LES R ++Y+L   N+VN LF  +GN VWLVL+I +  V
Sbjct: 11  LIYPFEVLIGWALSKIIGDLKLESQRNNFYILRSSNIVNELFAYHGNQVWLVLFIFLCLV 70

Query: 80  QCYIRTKEXXXXXXXXXX---XXXXXRERYTIFLCLVKQFIVKLALKMVLLDRIFWLIDH 136
           Q Y R+K                   R +      LVKQ+I KL LK ++L  +F +ID+
Sbjct: 71  QIYYRSKRFSLLISSESFNGRDQLIARGK-----PLVKQYICKLILKNLMLILVFSVIDN 125

Query: 137 VFIWTGGRCTV-SDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLS 195
           VFI++GG CT  S T+SS  C   +G W GGFDISGHFCF+  +S+ILW EL   ++++ 
Sbjct: 126 VFIFSGGECTSGSGTRSSQRCRHENGHWEGGFDISGHFCFLVTISMILWIELHQFKKHVD 185

Query: 196 ----ANEIRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMY 251
               + ++ L  ++I +   +   L  W+FIL++T+++YHT +EKVLG  +GY+ P VMY
Sbjct: 186 LEGLSGQLSLYSKIILMT--VFTVLCIWVFILFITSVYYHTFMEKVLGCAMGYITPYVMY 243

Query: 252 AIIPYYPKLQRILY 265
            IIP    L  ILY
Sbjct: 244 HIIPNNEFLYSILY 257

>KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C
          Length = 267

 Score =  174 bits (441), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 142/245 (57%), Gaps = 1/245 (0%)

Query: 21  VYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGVQ 80
           +YP+LV  G  + +L G + LE  RK WY +   N+VN+LF   G  ++ VL+ L+ G+Q
Sbjct: 21  IYPALVIFGYFISVLIGEDELERERKEWYWIGGRNVVNHLFAYKGIYIFDVLFGLLIGLQ 80

Query: 81  CYIRTK-EXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLALKMVLLDRIFWLIDHVFI 139
            Y+R K E                +       ++K + +K  L  ++L   F  IDH+F+
Sbjct: 81  VYVRMKHEESLLPTSNGEQDRNSPDLLKQVGKVLKVYSIKFVLVYLVLWACFLFIDHLFV 140

Query: 140 WTGGRCTVSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANEI 199
           WTGG C +SDTKS+ +C  L G WVGGFDISGHFCF+TN+SL LW EL  L QY + + I
Sbjct: 141 WTGGNCDLSDTKSAEKCRSLGGSWVGGFDISGHFCFLTNISLTLWQELKLLLQYANQHTI 200

Query: 200 RLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMYAIIPYYPK 259
                    ++++LL L  WI +L +T+++YHT  EKVLG   GY C +V+Y I+P    
Sbjct: 201 SWNSPSSKYQWIVLLVLCIWINVLTITSIYYHTFPEKVLGCAFGYSCLLVIYYILPRIKH 260

Query: 260 LQRIL 264
           + + L
Sbjct: 261 VNKFL 265

>Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  169 bits (427), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 97/267 (36%), Positives = 148/267 (55%), Gaps = 18/267 (6%)

Query: 15  NQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYI 74
           +++  LVYP  V  GAV+ +L   E L   +K++ LL   N++N +F    N +W + + 
Sbjct: 9   SRKAYLVYPIQVLVGAVISILVSEETLNHQKKTYTLLKSSNLLNIIFAYKANKIWPIFFF 68

Query: 75  LMAGVQCY-------------IRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLA 121
            +A +Q Y             I + +               ++R  +   +  Q+  K  
Sbjct: 69  SLALLQIYFHYLARLDVLPLPISSSDTGSTYLSYGNRRPLLKDR--VITTMAAQYACKFV 126

Query: 122 LKMVLLDRIFWLIDHVFIWTGGRCTV-SDTKSSMECYRLHGKWVGGFDISGHFCFVTNLS 180
           LK +LL   F  IDHVF+WTGG+C+  S T S+ +C    GKW GGFDISGHFCF+ N+S
Sbjct: 127 LKNLLLFLSFQFIDHVFVWTGGQCSSGSGTTSAEKCRLEKGKWYGGFDISGHFCFLVNIS 186

Query: 181 LILWCELFSLEQYLSANEIR--LRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVL 238
           +ILW EL    +++ A ++   + K +     +I + L+ WI ILWVTA++YHT+LEK+L
Sbjct: 187 MILWMELHLFSRFVQAEDMLWVVNKWVRACLVIISVVLLIWIGILWVTAIYYHTILEKML 246

Query: 239 GLILGYVCPVVMYAIIPYYPKLQRILY 265
           G ++GY+CPV +Y I+P    L   LY
Sbjct: 247 GCLMGYICPVFIYHILPRIELLHDYLY 273

>CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar to
           uniprot|Q06676 Saccharomyces cerevisiae YDR319c
          Length = 260

 Score =  168 bits (425), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 95/249 (38%), Positives = 143/249 (57%), Gaps = 7/249 (2%)

Query: 20  LVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGV 79
           L YP ++  G  + +L   E   + R ++YLL   N+ N +    GN VWL L++ +A V
Sbjct: 11  LAYPVILILGCFLSVLLSEEAKINQRANYYLLNSKNVFNQILAYKGNWVWLFLFMGVAAV 70

Query: 80  QCYIRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLALKMVLLDRIFWLIDHVFI 139
           Q  +RTK                + +    L ++K++  K  LK+ +LD IF +ID VFI
Sbjct: 71  QYNLRTKSQSLLPTDTRALVVSNKTK----LQIIKEYFCKYFLKLFILDVIFLVIDGVFI 126

Query: 140 WTGGRCTVSDTKSSME-CYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANE 198
            TGG CTV +   S E C  L GKW+GGFDISGHFCF+ N+S+ILW EL ++ +++   +
Sbjct: 127 MTGGSCTVPNRSISAELCKSLGGKWIGGFDISGHFCFLVNISMILWMELIAIAEHVCGYD 186

Query: 199 --IRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMYAIIPY 256
             I L      +  + ++ LV W+ +L VTA +YHT+ EK++G + GY+CP VMY +IP 
Sbjct: 187 TVISLSSLQKHVITVAVVVLVAWMGMLLVTATYYHTIAEKLIGCVFGYICPFVMYGLIPN 246

Query: 257 YPKLQRILY 265
              L ++ Y
Sbjct: 247 SHDLNKLFY 255

>Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  166 bits (420), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 143/258 (55%), Gaps = 20/258 (7%)

Query: 15  NQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYI 74
           +++  L+YP  V  GA++ +L  SE L   +K++ LL   N+ N LF    N +W  L+ 
Sbjct: 9   SRKAYLIYPFQVLVGAIISILVSSETLGHQKKTYALLKSSNLFNILFAYKANQLWPFLFF 68

Query: 75  LMAGVQCY-------------IRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLA 121
            +A +Q Y             I + E               ++R  +   +  Q+  K  
Sbjct: 69  SLAFLQIYFHYLARMDVLPLPISSSETGPTYSSYINRWPLLKDR--VIGIMFAQYACKFI 126

Query: 122 LKMVLLDRIFWLIDHVFIWTGGRCTV-SDTKSSMECYRLHGKWVGGFDISGHFCFVTNLS 180
           LK +LL   F  IDHVFIWTGG C+  S T S+ +C   +GKW GGFDISGHFCF+ N+S
Sbjct: 127 LKSLLLYVCFQFIDHVFIWTGGECSSGSGTTSAEKCRLENGKWQGGFDISGHFCFLVNIS 186

Query: 181 LILWCELFSLEQYLSANEIRLRKRLIWIKY---MILLALVTWIFILWVTALFYHTLLEKV 237
           +ILW EL    +++ A ++       W++    +I   LV WI ILWVTA++YHT+LEK+
Sbjct: 187 MILWMELHLFSKFVQAEDMFWVANK-WVRACLAVISSILVIWICILWVTAIYYHTVLEKI 245

Query: 238 LGLILGYVCPVVMYAIIP 255
           LG  +GY+CP+ +Y ++P
Sbjct: 246 LGCFMGYICPIFIYHVLP 263

>Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  166 bits (420), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 146/257 (56%), Gaps = 18/257 (7%)

Query: 15  NQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYI 74
           +++  L+YP  V  GA++ +L   + L+  +K+  LL   N+ N +F    N +W +L+ 
Sbjct: 9   SRKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFF 68

Query: 75  LMAGVQCY-------------IRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLA 121
            +A +Q Y             I + +               + R TI +  + Q+  K  
Sbjct: 69  SLAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIM--IAQYACKFI 126

Query: 122 LKMVLLDRIFWLIDHVFIWTGGRCTV-SDTKSSMECYRLHGKWVGGFDISGHFCFVTNLS 180
           LK +LL   F  IDHVFIWTGG C+  S T+S+ +C   +GKW GGFDISGHFCF+ N+S
Sbjct: 127 LKYMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNIS 186

Query: 181 LILWCELFSLEQYLSANEIR--LRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVL 238
           +ILW EL    +++ + ++   + K +     +I   L+ WI ILWVTA++YHT+LEK+L
Sbjct: 187 MILWMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKIL 246

Query: 239 GLILGYVCPVVMYAIIP 255
           G ++GY+CP+ +Y I+P
Sbjct: 247 GCLMGYICPIFIYHILP 263

>YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON}
           Putative protein of unknown function, identified as an
           ortholog of the highly conserved FIT family of proteins
           involved in triglyceride droplet biosynthesis; interacts
           with Sst2p and Hsp82p in high-throughput two-hybrid
           screens
          Length = 274

 Score =  166 bits (420), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 98/267 (36%), Positives = 147/267 (55%), Gaps = 18/267 (6%)

Query: 15  NQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYI 74
           +++  L+YP  VF GA++ ++  SE L   +++  LL   N+ N +F    N +W  L+ 
Sbjct: 9   SRKAYLIYPFQVFVGALLSIVVSSETLNHQKETCALLKSSNIFNVIFAYKANQLWPFLFF 68

Query: 75  LMAGVQCY-------------IRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLA 121
            +A +Q Y             I + E               + R  I   ++ Q+  K  
Sbjct: 69  SLAFLQIYFHYLARMDILPLPISSTETSSSYLTYTNHWPLLKNR--IISIMITQYACKFV 126

Query: 122 LKMVLLDRIFWLIDHVFIWTGGRCTV-SDTKSSMECYRLHGKWVGGFDISGHFCFVTNLS 180
           LK +LL   F  IDHVFIWTGG C+  S T S+ +C   +GKW GGFDISGHFCF+ ++S
Sbjct: 127 LKYLLLFLNFQFIDHVFIWTGGECSSGSKTTSAEKCRLENGKWDGGFDISGHFCFLVSIS 186

Query: 181 LILWCELFSLEQYLSANEI--RLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVL 238
           +ILW EL    +++ A ++   + K +     ++   LV WI ILWVTA++YHT+LEKVL
Sbjct: 187 MILWMELHLFSRFVQAEDMFWVVNKWVRACLAIVCAVLVIWICILWVTAIYYHTILEKVL 246

Query: 239 GLILGYVCPVVMYAIIPYYPKLQRILY 265
           G ++G++CPV +Y I+P    L   LY
Sbjct: 247 GCLMGFICPVFIYHILPKIGILHNYLY 273

>TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON}
           Anc_5.350 YDR319C
          Length = 275

 Score =  164 bits (414), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 95/264 (35%), Positives = 151/264 (57%), Gaps = 18/264 (6%)

Query: 19  ILVYPSLVFGGAVMRLLAGSERL-------------ESVRKSWYLLTEGNMVNYLFVING 65
           + +YPS++  G++   L G  +              E   K W L+   +  N LF  NG
Sbjct: 12  VCLYPSIMLFGSLTGSLGGYNKSNGNGHNDIDDLPSEPSDKFW-LIRSNSWFNQLFAYNG 70

Query: 66  NNVWLVLYILMAGVQCYIRTKEXXXXXXXXXXXXXXXRERYTI-FLCLVKQFIVKLALKM 124
           N V+L L++++  +Q Y   ++               ++  T  +L + K++I KL LK 
Sbjct: 71  NTVFLGLFLIIVSLQVYFSREDARLSLPIEIRTISRIKQFQTKHYLRIAKEYICKLILKY 130

Query: 125 VLLDRIFWLIDHVFIWTGGRCTV-SDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLIL 183
             L   F  IDH+F+ TGG CT  S T+ +M C   +G+WVGGFDISGHFCF+  LSLI+
Sbjct: 131 FFLYLEFLFIDHLFVLTGGYCTNGSGTRDAMICRSGNGEWVGGFDISGHFCFLVTLSLII 190

Query: 184 WCELFSLEQYLSANEIR--LRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLI 241
           W ELF LE+++ + +++  +   +I++ + I+  L+ WI +L VT+L+YHT +EK+LG I
Sbjct: 191 WLELFKLEEFIRSRDLKSNVTNEVIFMVFFIVSILILWIVMLCVTSLYYHTFVEKLLGCI 250

Query: 242 LGYVCPVVMYAIIPYYPKLQRILY 265
           +GY+CP+VMY ++P      R +Y
Sbjct: 251 MGYICPIVMYRVLPRNTIFTRYIY 274

>TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.350
           YDR319C
          Length = 258

 Score =  161 bits (407), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 140/248 (56%), Gaps = 9/248 (3%)

Query: 21  VYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGVQ 80
           +YP  +  G V+  + G +RLE  R+++YLL   N++N +F   GN VW V ++ +A VQ
Sbjct: 16  IYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLALVQ 75

Query: 81  CYIRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLALKMVLLDRIFWLIDHVFIW 140
            Y++ +                 +       L+KQ+  K+ LK VLL   F++ID +F+ 
Sbjct: 76  IYVKCRNHALLPRDARTNSSGPLKS------LLKQYTSKIILKNVLLAITFFIIDSIFVL 129

Query: 141 TGGRCTVSD-TKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANEI 199
           TGG C   D T+S+  C    G+W GGFDISGHFCF+ N+S+ILW EL     Y+    +
Sbjct: 130 TGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESV 189

Query: 200 RLRKRLIWIKYMILLA--LVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMYAIIPYY 257
                 +    +++ +  L  W+ +L VTA++YHT+LEKVLG  LGYVC +VMY +IP  
Sbjct: 190 VFPVSKVVNGVLVVSSGVLGIWVLMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPRS 249

Query: 258 PKLQRILY 265
            +   +LY
Sbjct: 250 RRFNGLLY 257

>TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.350
           YDR319C
          Length = 277

 Score =  152 bits (385), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 138/262 (52%), Gaps = 12/262 (4%)

Query: 12  FIVNQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLV 71
           F ++  YI V   L+FG   + L+ G+E LE  + S+Y L   N +N +F  NGN VW +
Sbjct: 19  FAISISYIFV---LLFG-EFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFL 74

Query: 72  LYILMAGVQCYIRTKEXXXXXXXXXXXXXXXRERYTIFLC-----LVKQFIVKLALKMVL 126
           L+ L+  +  +  T                   R   +       L KQ+  K  +K   
Sbjct: 75  LFCLVFYLHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSAS 134

Query: 127 LDRIFWLIDHVFIWTGGRCTV-SDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWC 185
           L  IF+ ID +F+ +GG C   S T  S  C    GKW GGFDISGHFCF+  +SLILWC
Sbjct: 135 LFVIFFAIDTLFVLSGGSCDDGSGTTFSETCRSNKGKWEGGFDISGHFCFLITISLILWC 194

Query: 186 ELFSLEQYLSAN--EIRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLILG 243
           EL+ L + + +   E+ L      +  +I+  ++ W  +LW+TA++YHT  EKVLG +LG
Sbjct: 195 ELYKLHKRMESESFEVELNVVFTVMIGLIVGVIMVWFGLLWITAIYYHTFFEKVLGCMLG 254

Query: 244 YVCPVVMYAIIPYYPKLQRILY 265
           +V P++MY  IP    L  +LY
Sbjct: 255 FVTPLLMYYTIPSNEFLNGLLY 276

>KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5.350
           YDR319C
          Length = 264

 Score =  137 bits (344), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 137/260 (52%), Gaps = 21/260 (8%)

Query: 19  ILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAG 78
           +L+YP ++  G ++ +L   +  + +++  Y     N++N +F   GN VW VL++ +A 
Sbjct: 12  VLLYPFVLSIGLILHVLVPEQVQDQLKQHVYFFNSKNVLNQVFAYKGNLVWTVLFLYIAV 71

Query: 79  VQCYIRTKEXXXXXXXXXXXXXXXRERYTIFLCLVKQFIVKLALKMVLLDRIFWLIDHVF 138
           +  +I+T                 +        +V+Q+  KL LK  LL   F +ID VF
Sbjct: 72  LSYFIKTMSRDPLEQRAGGRQVDWQ--------IVRQYCWKLLLKNGLLYLCFLVIDGVF 123

Query: 139 IWTGGRCT-----VSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQY 193
           I TGG CT     +   +S+  C    G+W  GFDISGHFCF+ N+SLILW EL  L+  
Sbjct: 124 IATGGVCTTMGGEMRKIRSAESCKWNGGQWENGFDISGHFCFLMNISLILWAELQLLQDA 183

Query: 194 LSANEIRLRKRLIWIKY--------MILLALVTWIFILWVTALFYHTLLEKVLGLILGYV 245
           +   E+   +  +WI Y         + + L  W+F+L+VTA FYHT  EK++G   GYV
Sbjct: 184 IRREELGEEELNLWICYKWLRHGLTAVKITLYIWLFLLFVTASFYHTSSEKLIGCAFGYV 243

Query: 246 CPVVMYAIIPYYPKLQRILY 265
           CP VMY +IP  P+L    Y
Sbjct: 244 CPFVMYHLIPTSPRLNEFFY 263

>KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON}
           Anc_6.117 YGL126W
          Length = 237

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 70/146 (47%), Gaps = 23/146 (15%)

Query: 133 LIDHVFIWTGGRCT-----VSDTKSSMECYRLHGKWVGGFDISGHFCF--------VTNL 179
           ++D +F+WTGG+C          KSS  C ++ G W+ G D SGH           +   
Sbjct: 91  IMDLIFVWTGGKCDGGSTSSKLLKSSKHCKKIGGNWINGHDPSGHIFLLSIMTTFMINEF 150

Query: 180 SLILWCELFSLEQYLSANEIRLRKRL-----IWIKYMILLALVTWIFILW----VTAL-F 229
           S I    +  L Q     +  L ++L     ++I    ++ ++++I + W    +T++ +
Sbjct: 151 SKIRRVSMTQLRQDFVETDWNLDRQLPVKIILFISNNPVIIMLSFILLWWHSLVITSINY 210

Query: 230 YHTLLEKVLGLILGYVCPVVMYAIIP 255
           YHTL E++ GL+  Y+    +Y  +P
Sbjct: 211 YHTLSEQLSGLLFAYIIMGPLYLFLP 236

>Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W
           (REAL)
          Length = 316

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 10/103 (9%)

Query: 152 SSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANEIRLRKRLIWIKYM 211
           +S +C R  G W GG D SGH    T + + L  EL    +   A+        ++ +  
Sbjct: 213 TSAQCRRFGGHWAGGHDPSGHVFLTTLMCMFLLGELRVFGRRALAH--------LYAQKW 264

Query: 212 ILLALVTWIFILWVTAL--FYHTLLEKVLGLILGYVCPVVMYA 252
            LL +VTW++ L +TA+   +HT+ E + GL+  Y+   V+YA
Sbjct: 265 HLLGMVTWLWQLLLTAVASHFHTVREHISGLLAAYLVTGVVYA 307

>KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON}
           Anc_6.117 YGL126W
          Length = 246

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 76/166 (45%), Gaps = 32/166 (19%)

Query: 107 TIFLCLVKQFIVKLALKMVLLDRIF----WLIDHVFIWTGGRC-----TVSDT---KSSM 154
           T  L L++++ +  A   V   +++     L+D VF+W+GG C     T   T    +S 
Sbjct: 77  TPLLPLLRRYTITTAAWYVFTQQLWLNVPPLMDLVFVWSGGSCLLDPATTPGTLWLSTSA 136

Query: 155 ECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANEIRLRKR---------- 204
            C R  G W GG D SGH   ++ + + L  EL +      ++  R R +          
Sbjct: 137 ACRRHGGLWQGGHDPSGHMFLLSLMLMFLLSELPA-----GSSGGRRRGKHAAFASAAAA 191

Query: 205 ---LIWIKYMIL-LALVT-WIFILWVTALFYHTLLEKVLGLILGYV 245
              ++W +  +L LAL   W + L VTA  +HTL E+  GL+   V
Sbjct: 192 ARFILWDEPGVLALALTACWTWALLVTAARFHTLPEQTSGLLAAVV 237

>TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.117
           YGL126W
          Length = 327

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 151 KSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANEIRLRKRLIWIKY 210
            SS +C ++ G W GG D SGH   +T + +       S + YL         RLI   +
Sbjct: 235 NSSQKCRKIGGAWSGGHDPSGHMFLLTLMIMTFLTISISKDNYLFV-------RLIAAMF 287

Query: 211 MILLALVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMY 251
            ++ +     +   VT   +HT  E++ G +  Y+ P  +Y
Sbjct: 288 GLMSS-----YSFMVTIFNFHTFAEQITGFMAAYI-PAGLY 322

>AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL126W (SCS3)
          Length = 362

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 146 TVSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCEL 187
           T S  +SS  C RL G W+GG D SGH   +T + + +  EL
Sbjct: 196 TASAIRSSHACSRLGGHWMGGHDPSGHVFLITLMCMFMLGEL 237

>TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6.117
           YGL126W
          Length = 390

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 153 SMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANEI 199
           S +C R  G WVGG D SGH   +T + +++  EL  + +    N I
Sbjct: 222 SSKCKRNGGHWVGGHDPSGHIFLLTLMMMMIIAELPKINRIRKQNMI 268

>KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} similar
           to uniprot|Q75EB2 Ashbya gossypii AAR165W AAR165Wp and
           weakly similar to YGL126W uniprot|P53012 Saccharomyces
           cerevisiae SCS3 Protein required for inositol
           prototrophy
          Length = 337

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%)

Query: 151 KSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCEL 187
           KSS  C    G WVGG D SGH   +T + ++++ EL
Sbjct: 173 KSSAGCSYAGGHWVGGHDPSGHIFLITLMLMLMFGEL 209

>YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protein
           required for inositol prototrophy, identified as an
           ortholog of the FIT family of proteins involved in
           triglyceride droplet biosynthesis; disputed role in the
           synthesis of inositol phospholipids from inositol
          Length = 380

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%)

Query: 152 SSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCEL 187
           +S +C R  G W GG D SGH    T + + L  EL
Sbjct: 215 TSAQCRRFGGHWAGGHDPSGHVFLATLMCMFLLGEL 250

>Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa]
           {ON} YGL126W (REAL)
          Length = 380

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%)

Query: 152 SSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCEL 187
           +S +C R  G W GG D SGH    T + + L  EL
Sbjct: 215 TSAQCRRFGGHWAGGHDPSGHVFLATLMCMFLLGEL 250

>SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {ON}
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126W SCS3 Protein required for inositol prototrophy
          Length = 429

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 151 KSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCEL 187
            SS +C  L G W GG D SGH   +T + + L  EL
Sbjct: 265 DSSQKCKSLGGHWSGGHDPSGHIFLITLMCMFLLGEL 301

>Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {ON}
           YGL126W (SCS3) - involved in inositol biosynthesis
           [contig 237] FULL
          Length = 363

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%)

Query: 151 KSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCEL 187
            SS  C  L G WVGG D SGH   +T + + L  EL
Sbjct: 201 NSSNLCRSLGGNWVGGHDPSGHIFLITLMCMFLLGEL 237

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 187 LFSLEQYLSANEIRLRKRLIWIKYMILLALVT--WIFILWVTALFYHTLLEKVLGLILGY 244
           LF  +Q L+     L K ++W   +ILL L T  W + L +T + +HTL E++ GL+  Y
Sbjct: 294 LFFAKQLLALAGATL-KFVVWRNPVILLVLFTFLWWWSLLITTIAFHTLWEQLSGLLCAY 352

Query: 245 VCPVVMY 251
           V    +Y
Sbjct: 353 VVAGFVY 359

>TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {ON}
           Anc_6.117 YGL126W
          Length = 368

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%)

Query: 151 KSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCEL 187
            SS  C  L G WVGG D SGH   +T + + L  EL
Sbjct: 200 NSSAVCRTLGGYWVGGHDPSGHIFLITLMIMYLLGEL 236

>KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 363

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 59/159 (37%), Gaps = 58/159 (36%)

Query: 151 KSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCEL----------------------- 187
            SS  C  + G W+GG D SGH   +T + + L  EL                       
Sbjct: 201 NSSNLCRSMGGYWIGGHDPSGHIFLITLMCMFLLGELQAIGKRALRVLKTHNKYWQQLRE 260

Query: 188 -----------FSLEQYLSANEIRLRKRL----------------------IWIKYMILL 214
                      ++L  +  A + +L K+L                      +W   ++LL
Sbjct: 261 HGTSVLTLGGLWNLVAHPPATKKQLFKQLGLIPLDISQHLTQLFGATAKFIVWENPVVLL 320

Query: 215 ALVT--WIFILWVTALFYHTLLEKVLGLILGYVCPVVMY 251
            L T  W + L +T + +HTL E++ GL+  Y+    +Y
Sbjct: 321 VLFTFLWWWSLLITTIAFHTLWEQLSGLLCAYIVAGFVY 359

>Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii AAR165W
          Length = 367

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 156 CYRLHGKWVGGFDISGHFCFVTNLSLILWCEL 187
           C +L G W GG D SGH   +T +++ L  EL
Sbjct: 208 CRKLGGYWTGGHDPSGHVFLITLMTMFLIGEL 239

>NCAS0D03160 Chr4 complement(593886..595058) [1173 bp, 390 aa] {ON}
           Anc_6.117 YGL126W
          Length = 390

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 205 LIWIKYMILLA--LVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMY 251
           +IW   +ILL   LV W++   +T L +HT+ E++ GL   Y+   ++Y
Sbjct: 338 IIWDNPIILLITLLVVWLWSFLITTLVFHTVSEQLSGLFFAYMVAGILY 386

>CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126w SCS3 inositol phospholipid synthesis protein
          Length = 371

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 59/149 (39%), Gaps = 41/149 (27%)

Query: 141 TGGRCTVSDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCE-----------LFS 189
           +G   T+ +   S  C    G W GG D SGH   +T + L L  E           +  
Sbjct: 223 SGANSTLDN---SFACRLNGGYWQGGHDPSGHIFLLTLMILFLVGESKQFIVGAVMRVVD 279

Query: 190 LEQYL---------------SANEIRLRKRL----------IWIKYMILLAL--VTWIFI 222
             +Y+               S  E R+RK +          +W   +ILL L    W++ 
Sbjct: 280 TRKYVMDKIKKICNEPMANASVYERRVRKLMRCLSFSASYILWENPVILLLLLLAIWVWN 339

Query: 223 LWVTALFYHTLLEKVLGLILGYVCPVVMY 251
             +T + +HTL E++ GL   YV   ++Y
Sbjct: 340 FVITVIVFHTLTEQLSGLFFAYVVGALLY 368

>Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON}
           complement(1735..2928) [1194 nt, 398 aa]
          Length = 397

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 153 SMECYRLHGKWVGGFDISGHFCFVTNLSLILWCEL 187
           S  C    G WVGG D SGH   +T + +++  E+
Sbjct: 230 SSNCRAHGGHWVGGHDPSGHMFILTLMIMLISSEI 264

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.333    0.146    0.475 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,000,333
Number of extensions: 918333
Number of successful extensions: 2624
Number of sequences better than 10.0: 46
Number of HSP's gapped: 2641
Number of HSP's successfully gapped: 57
Length of query: 265
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 157
Effective length of database: 41,097,471
Effective search space: 6452302947
Effective search space used: 6452302947
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 65 (29.6 bits)