Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_81815.352ON66166133970.0
AGR352C5.352ON6484877973e-96
SAKL0G08822g5.352ON5826777758e-94
NDAI0C043205.352ON7067377253e-85
Kwal_34.159775.352ON5976037174e-85
NCAS0F028705.352ON7003147244e-85
CAGL0H07095g5.352ON6615617111e-83
Skud_4.5865.352ON6425626802e-79
YDR320C (SWA2)5.352ON6683226804e-79
KLTH0H14872g5.352ON6235586774e-79
ZYRO0D10186g5.352ON6356916723e-78
Smik_4.5795.352ON6677186733e-78
Kpol_339.135.352ON6867206683e-77
TDEL0E027505.352ON5643296594e-77
Suva_2.4895.352ON6595506602e-76
KAFR0C018505.352ON6466976575e-76
TPHA0E011105.352ON6933456552e-75
KLLA0B10197g5.352ON6216986486e-75
KNAG0C055005.352ON5856796179e-71
TBLA0H019705.352ON8403086255e-70
NCAS0H008306.21ON338111830.20
NCAS0A00490singletonON620120820.30
Kpol_1028.516.328ON11760760.32
YCR060W (TAH1)6.328ON11163692.8
Skud_3.1356.328ON11868693.3
CAGL0K09240g6.328ON14251685.0
NCAS0G008105.617ON58466716.2
KAFR0J025706.328ON12163666.7
Ecym_20906.328ON17266686.7
KLLA0D11902g8.486ON28951697.5
NDAI0D008106.21ON34979698.2
KAFR0B048902.350ON22040688.3
ZYRO0D17666g6.380ON472134698.6
ZYRO0D16390g7.217ON39857698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_8181
         (661 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...  1313   0.0  
AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}...   311   3e-96
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...   303   8e-94
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...   283   3e-85
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...   280   4e-85
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...   283   4e-85
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...   278   1e-83
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...   266   2e-79
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...   266   4e-79
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...   265   4e-79
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...   263   3e-78
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...   263   3e-78
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...   261   3e-77
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...   258   4e-77
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...   258   2e-76
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...   257   5e-76
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...   256   2e-75
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...   254   6e-75
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...   242   9e-71
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...   245   5e-70
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    37   0.20 
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       36   0.30 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    34   0.32 
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    31   2.8  
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    31   3.3  
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    31   5.0  
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    32   6.2  
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    30   6.7  
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    31   6.7  
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    31   7.5  
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    31   8.2  
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    31   8.3  
ZYRO0D17666g Chr4 complement(1462228..1462836,1463330..1464139) ...    31   8.6  
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    31   8.9  

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score = 1313 bits (3397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/661 (96%), Positives = 638/661 (96%)

Query: 1   MGDPFATLLSNFKGEKKELVQSSPRNASLNAILCXXXXXXXXXXXALDKLQVQDTSKNAK 60
           MGDPFATLLSNFKGEKKELVQSSPRNASLNAILC           ALDKLQVQDTSKNAK
Sbjct: 1   MGDPFATLLSNFKGEKKELVQSSPRNASLNAILCESSSKSFESSSALDKLQVQDTSKNAK 60

Query: 61  TVQYDPENAFSERNSADDSLNELFCLRDSASPLPPPEKESIAFDFDTTVRDLNPANLNEA 120
           TVQYDPENAFSERNSADDSLNELFCLRDSASPLPPPEKESIAFDFDTTVRDLNPANLNEA
Sbjct: 61  TVQYDPENAFSERNSADDSLNELFCLRDSASPLPPPEKESIAFDFDTTVRDLNPANLNEA 120

Query: 121 MWGLEGPLLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNGKKFQQRNGFT 180
           MWGLEGPLLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNGKKFQQRNGFT
Sbjct: 121 MWGLEGPLLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNGKKFQQRNGFT 180

Query: 181 AGQRSDSDNDRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKTFENIGNRRSTPFEF 240
           AGQRSDSDNDRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKTFENIGNRRSTPFEF
Sbjct: 181 AGQRSDSDNDRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKTFENIGNRRSTPFEF 240

Query: 241 KLFSSENTNSRSHTNKYEPELSRDSSNSDYISKKFDGLSVDEDKGNPCLNKEENYADLLS 300
           KLFSSENTNSRSHTNKYEPELSRDSSNSDYISKKFDGLSVDEDKGNPCLNKEENYADLLS
Sbjct: 241 KLFSSENTNSRSHTNKYEPELSRDSSNSDYISKKFDGLSVDEDKGNPCLNKEENYADLLS 300

Query: 301 HAFLDTGDTEAKDRIWGQSQNVHSQESLYSAEDGKLIDFDTEEAPPPASKVSSHYVPISQ 360
           HAFLDTGDTEAKDRIWGQSQNVHSQESLYSAEDGKLIDFDTEEAPPPASKVSSHYVPISQ
Sbjct: 301 HAFLDTGDTEAKDRIWGQSQNVHSQESLYSAEDGKLIDFDTEEAPPPASKVSSHYVPISQ 360

Query: 361 IEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEH 420
           IEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEH
Sbjct: 361 IEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEH 420

Query: 421 TESLKNIEKACDLLDGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHYDEALAVY 480
           TESLKNIEKACDLLDGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHYDEALAVY
Sbjct: 421 TESLKNIEKACDLLDGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHYDEALAVY 480

Query: 481 RCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSIPERRIRS 540
           RCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSIPERRIRS
Sbjct: 481 RCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSIPERRIRS 540

Query: 541 QKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDXXXXXXXXXXXXTWTNWNH 600
           QKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETD            TWTNWNH
Sbjct: 541 QKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDLRHLLSRLSLVLTWTNWNH 600

Query: 601 IGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNVFKLNNDI 660
           IGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNVFKLNNDI
Sbjct: 601 IGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNVFKLNNDI 660

Query: 661 N 661
           N
Sbjct: 661 N 661

>AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR320C
           (SWA2)
          Length = 648

 Score =  311 bits (797), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 186/487 (38%), Positives = 271/487 (55%), Gaps = 51/487 (10%)

Query: 184 RSDSDNDRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKTFENIGNRRSTPFEFKLF 243
           R++S     ++  +      L+S ASNLF +GRD +E+++        + RST       
Sbjct: 204 RAESSETPQWSSLRSGHSNRLVSAASNLFNRGRDFIEDQLATHARTSASSRST------L 257

Query: 244 SSENTNSRSHTNKYEPELSRDSSNSDYISKKFDGLSVDEDKGNPCLNKEENYADLLSHAF 303
           S  N    +HT + +  +++ +  +  I  +     VD                 L   F
Sbjct: 258 SDSNERFSNHTQESDYSVNQTNDQAHLIHTQPTAAEVD-----------------LLEGF 300

Query: 304 LDTGDTEAKDRI---WGQSQNVHSQESLYSAEDGKLIDFDTEEAPPPASKVSSHYVPISQ 360
            DT   + +  +     Q+  V S+ESL        IDF +E   P  S    +YV I+ 
Sbjct: 301 ADTEVVQHQSTLEVPRMQAAGVKSEESL--------IDFSSE--GPSKSAAQLNYVSITP 350

Query: 361 IEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEH 420
           +E+SGY +FN    + ++ GDYH A Q Y+KSLNTLP+ HPLRI+A SNIITTQLKIGEH
Sbjct: 351 LELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEH 410

Query: 421 TESLKNIEKACDLLDGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHYDEALAVY 480
           TES+KNI  A +LL     D  IQ T+PP+TYKEFW KI++KKAEVLE  ++Y+ AL+VY
Sbjct: 411 TESMKNINSAVELLQDVPFDAQIQDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVY 470

Query: 481 RCLISKGVFDKKIIEGKTRCQK-----HSKITSEPATEDSALAPVQKD-KVPKSNNSSIP 534
           + LIS+G   K I+ GK RCQK        ++S P       A  Q D K P+   ++  
Sbjct: 471 QQLISRGYTPKLILNGKARCQKACNSQKGNVSSNPT------ATTQGDRKNPRKQTATA- 523

Query: 535 ERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDXXXXXXXXXXXXT 594
             + ++++ + L  +   +++ E ++F LHDKV S+I++W  GK TD             
Sbjct: 524 --KGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDLRHLLLGLPALLP 581

Query: 595 WTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNVF 654
           W N + + A+DLV+PK+VK+ Y+KA+SK HPDK+P TL+LE KM+AE +F  L  AW VF
Sbjct: 582 WLNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVF 641

Query: 655 KLNNDIN 661
           K  N ++
Sbjct: 642 KEENSLS 648

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 1  MGDPFATLLSNFKGEKKELVQSSPRNASLNAILC 34
          M DPFA LL+ FKG++K     + +N SLN +L 
Sbjct: 1  MSDPFANLLTKFKGKEKPADAQTSKNRSLNDLLA 34

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score =  303 bits (775), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 221/677 (32%), Positives = 335/677 (49%), Gaps = 116/677 (17%)

Query: 3   DPFATLLSNFKGEKKELVQSSPRNASLNAILCXXXXXXXXXXXALDKLQVQDTSKNAKTV 62
           DPFA LLS+FKGEK                                    Q +S  ++TV
Sbjct: 4   DPFADLLSSFKGEK------------------------------------QKSSTTSETV 27

Query: 63  QYDPENAFSERNSADDSLNELFCLRDS---ASPLPPPEKESIAFDFDTTVRDLNPANLNE 119
                               LF   D    +SP P    ++I  D D      N A    
Sbjct: 28  S-------------------LFDKHDGPSISSPAPSKPLQTINDDLDAAFDVFNSATNTP 68

Query: 120 AMWGLEGPLLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNGKKFQQRNGF 179
           A  G   P+++ V  ME   + + G+S E A   Y++G+ Y D   + +  +K + +   
Sbjct: 69  AKQG--SPVVDEVKDMEIARLMSLGVSLERALQYYERGILYDDV--LRRRHEKHEAKRQA 124

Query: 180 TAGQRS------DSDNDRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKTFENIGNR 233
            A  R       +  ++ + +   D+++++L S A+ LF KG+  +E ++ +  ++   +
Sbjct: 125 AAASRDFTKLFDNGSSNILGSDGSDDKQQDLFSMATGLFNKGKSFMEERLKQRQQHQHQQ 184

Query: 234 RSTPFEFKLFSSENTNSRSHT---NKYEPELSRDSSNSDYISKKFDGLSVDEDKGNPCLN 290
                 F+ F+ ++ +SR  +    KYE         S Y  K+       E +  P   
Sbjct: 185 DPA---FRSFA-DHISSRLESPTRAKYE--------RSQYTDKQVGS----ERRPEPA-- 226

Query: 291 KEENYADLLSHAFLDTGDTEAKDRIWGQSQNVHSQESLYSAEDGKLIDFDTEEAPPPASK 350
                            + E    I G       + S+ S +   L+DF+   +PP    
Sbjct: 227 --------------PVDEVEEPSVIEGDLLGGFDELSVSSPQHETLLDFEQAVSPPQLRS 272

Query: 351 VSSHY-VPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSN 409
            S+   + IS +E+SG+ EF   G + F +G+Y +A  +Y KSLNTLP GHPLRI++ SN
Sbjct: 273 SSARPPISISAMELSGFGEFKSKGGELFAHGNYSSALLEYEKSLNTLPSGHPLRIISLSN 332

Query: 410 IITTQLKIGEHTESLKNIEKACDLLDGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEY 469
           IITTQLK+GE + +L+NIE A  L+    L   I  +NPPK+Y+EFW KI  +KAE LE+
Sbjct: 333 IITTQLKLGESSSALQNIETALRLIGEDELQLTIPASNPPKSYREFWGKITMRKAEALEH 392

Query: 470 LEHYDEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDK----V 525
           +E+Y  AL  Y+ LI KG    K+++GK RCQ   K+ S P  + S + PV + K    V
Sbjct: 393 VENYVSALECYKALIDKGFVTSKVMDGKRRCQ---KVLSPPKPQ-SGIPPVARKKPSPNV 448

Query: 526 PKSNNSSIPERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDXXXX 585
             +++S++P+   RS   E++ +  +E ++LE +KF L DKV  +I+SW  GKE D    
Sbjct: 449 LDTSSSTLPK---RSDNLEKIQRINREAEQLENKKFLLRDKVDEQIKSWSQGKENDLRQL 505

Query: 586 XXXXXXXXTWTN-WNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIF 644
                   TW+N W  +  +DLV+PKKVKI Y+KAI+K HPDK+  +LD+E KMLAEDIF
Sbjct: 506 LADLPKVLTWSNDWKPVTTSDLVMPKKVKITYLKAIAKTHPDKLNDSLDVEHKMLAEDIF 565

Query: 645 SVLGNAWNVFKLNNDIN 661
           S+L  AW  FK  N+I+
Sbjct: 566 SILSKAWEAFKEENNIS 582

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score =  283 bits (725), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 239/737 (32%), Positives = 362/737 (49%), Gaps = 107/737 (14%)

Query: 1   MGDPFATLLSNFKGEK-------------KELVQSSPRNASLNAILCXXXXXXXXXXXAL 47
           M DPFA+LL++FK  +             K+L  ++P  +S+   L            AL
Sbjct: 1   MSDPFASLLTSFKNGQNTTNNNTTTDTDTKKLSATTPSQSSIQFNL-NKASTPSLDTFAL 59

Query: 48  DKL--QVQDTSKNAKTVQYDP--ENAFSERNSADDSLNELFCLRDSASPLPPPEKESI-- 101
             L    +D SK+   V   P  E+ FS+  ++++        ++  SP P P+K+ I  
Sbjct: 60  APLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQ-------KNITSP-PAPKKDDIDS 111

Query: 102 AFDFDTTVRDLNPANLNEAMWGL---------EGPLLEGVHGMESEPINARGISTEDANS 152
           AFD  T+     P    +   GL         E  +++ V  ME   + + G+S + AN 
Sbjct: 112 AFDIFTSTP---PLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANK 168

Query: 153 CYDQGLFYIDAQEVLQNGKKFQQRNGFTAGQRSDSDN--------DRVFTFRKDNEEE-- 202
            YD+G+ Y D     Q  KK +Q++        D +N        D  +  ++ NE +  
Sbjct: 169 YYDKGILYEDIIRK-QREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNN 227

Query: 203 --NLISFASNLFTKGRDLVE---------NKINKTFENIGNRRSTPFEFKLFSSENTNSR 251
             NL S A+++  KG++LV+         N++ K  E I N  + PF           SR
Sbjct: 228 TGNLFSMATDILYKGKELVDQLTAYPEENNRLYKYREPIDNEEN-PF-------LQEGSR 279

Query: 252 SHTNKYEPELS---------RDSSNSDYISK---KFD----GLSVDEDKGNPCLNKEENY 295
           S  +   P LS         + SS   Y+ +   K++     L  D D      +KE + 
Sbjct: 280 SPASARSPSLSGSHVASASAKPSSKPSYVERNSLKYEDNNTTLIDDFDYKLTINSKEPSM 339

Query: 296 ADLLSHAFL-DTGDTEAKDRIW---GQSQNVHSQESLYSAEDGKLIDFDTEEAPPPASKV 351
           A  +  +   DT +T   + +    G S       S  S               P  + +
Sbjct: 340 AKNIPPSITPDTTETNNNNALLDFDGLSTVTAPGSSNISVNKKNTSSSSATSPSPSPASI 399

Query: 352 SSHYVPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNII 411
           +   VPIS IE+SG+ EF   G + F+NGDY +A Q+Y KSLNTLP  HPLRI++YSNII
Sbjct: 400 TIATVPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNII 459

Query: 412 TTQLKIGEHTESLKNIEKACDLLD----GSSLDGIIQGTNPPKTYKEFWNKIISKKAEVL 467
            TQLKIGE+++S+++ + A  L       S+ + II  + P +++K+ W+K+I ++AE  
Sbjct: 460 ATQLKIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESY 519

Query: 468 EYLEHYDEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPK 527
           E+LE+Y  AL  Y+ LI  G  + KI++GK RCQ   KI + P        P Q  K P 
Sbjct: 520 EHLENYKLALDSYQKLIENGFTNSKIMDGKRRCQ---KILNPP-------PPPQTSKSPT 569

Query: 528 SNNSSI---PERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDXXX 584
               SI    E+   +   + L  +  + +E+E QK  L+DKV SKI +W   K+TD   
Sbjct: 570 PTPVSILKHKEKDTTTASVQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRH 629

Query: 585 XXXXXXXXXTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIF 644
                    TW +W  I   DLV+PKKVKI Y+KAI+K HPDK+P +LDLE+KM+AE++F
Sbjct: 630 LLSNLSTVLTWCDWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVF 689

Query: 645 SVLGNAWNVFKLNNDIN 661
           S+L  AW+ FKL+N++N
Sbjct: 690 SILSLAWDKFKLDNNMN 706

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score =  280 bits (717), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 194/603 (32%), Positives = 301/603 (49%), Gaps = 63/603 (10%)

Query: 73  RNSADDSLNELFCLRDSASPLPPPEKE-SIAFD-FDTTVRDLNPANLNEAMWGLE-GPLL 129
           RN  D  L+E+F     A+  P  + E  +AFD FD       PA L +     E  PL+
Sbjct: 44  RNGTD--LDEIFGFEKQANSAPAVKDEFDLAFDAFDA------PAKLPQNHMDPEPQPLV 95

Query: 130 EGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNGKKFQQRNGFTAGQRSDSDN 189
           + +  ME   + + G+S   A S Y++GL Y D  E     +K QQR    A Q++ SD 
Sbjct: 96  DEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLE-----RKRQQRTREEAPQKT-SDE 149

Query: 190 DRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKTFENIGNRRSTPFEFKLFSSENTN 249
            R FT      E +L+S AS+   +GR  +++K+ +   + G +      +  + S    
Sbjct: 150 GR-FT---QGSEPDLLSVASSWLNRGRTFLDSKLKQIQNDNGTQ-----SYSDYISSRME 200

Query: 250 SRSHTNKYEPELSRDSSNSDYISKKFDGLSVDEDKGNPCLNKEENYADLLSHAFLDTGDT 309
           S +HT       S   +N D  S  F  LS+               AD  + + +    +
Sbjct: 201 SSAHTGSRLRPTSDIPTNIDR-SISFQDLSL---------------ADQPNESSVPAQVS 244

Query: 310 EAKDRIWGQSQNVHSQESLYSAEDGK---LIDFDTEEAPPPASKVSSHYVPISQIEMSGY 366
                I     N+     +   E+     L+DFD        S   +  + +S +E   Y
Sbjct: 245 PMNSEILPPLVNIGDDVPVSGPEEASADLLVDFDAPSGHDAVSSPVAASIAMSALEFHSY 304

Query: 367 QEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTESLKN 426
           QEF   G   F  GDYH A Q + KS+N+LP  HPLR ++ SN+I  +LK+GE+ +++++
Sbjct: 305 QEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIED 364

Query: 427 IEKACDLLDGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHYDEALAVYRCLISK 486
              A  L+  + LD +I  ++PPKT+KE W KI+  KAE  E++E YD+AL  Y+ LI +
Sbjct: 365 SSVALKLISCAKLDDVIPASDPPKTFKEIWCKIVGNKAEAYEHIEDYDKALKEYQLLIKR 424

Query: 487 GVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSIPER--------RI 538
           G   +K++EG+ RCQK      EP         VQ+ K P S + S+  +        ++
Sbjct: 425 GAASRKVMEGRRRCQK----IVEPEKF------VQRSKTPLSTSPSVSRKDVAVAATSQV 474

Query: 539 RSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDXXXXXXXXXXXXTWTNW 598
            S+K E +    ++ KELE+QKF LHDKV  +++ W    E D             W +W
Sbjct: 475 PSEKLERVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDDLRELLSRFHLIVDWVDW 534

Query: 599 NHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNVFKLNN 658
            ++   DLV+PK+VKI+Y+KA++K HPDK+  +  LE KM+AE++F +L  AW +FK  N
Sbjct: 535 KNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAENVFVILSKAWELFKEQN 594

Query: 659 DIN 661
            ++
Sbjct: 595 KLS 597

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score =  283 bits (724), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 207/314 (65%), Gaps = 14/314 (4%)

Query: 356 VPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQL 415
           +PIS IE+SGY EF   G QYF+NGDY ++ Q+Y KSLNTLPV HPLRI+AYSNII ++L
Sbjct: 393 IPISHIELSGYAEFRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASEL 452

Query: 416 KIGEHTESLKNIEKACDLL--DGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHY 473
           KIGE+++SLKN   A ++   D +    +IQ ++P +TYK+ W K+  ++AE LE++E +
Sbjct: 453 KIGEYSKSLKNSSSALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESF 512

Query: 474 DEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSI 533
             AL+ Y+ LI KG  + KI++GK RCQK    T  P  +   ++       PK + S +
Sbjct: 513 KAALSSYQELIEKGFANDKIMDGKRRCQKVLNPTPPPVVKTPRIS------TPKQSPSPV 566

Query: 534 PERRIRSQK------AEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDXXXXXX 587
           P +   + K       E L K+    +E+EKQK  L+DKV +K+++W + K+TD      
Sbjct: 567 PRKATSNSKDAVYESVERLKKENATSQEVEKQKLALYDKVFAKVETWKNRKDTDIRHLLA 626

Query: 588 XXXXXXTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVL 647
                 TW +W  + A+DLV+PKKVKI YMKA++K HPDKVP +L+LE+KM+AE++FSVL
Sbjct: 627 NLSIVLTWCDWKPVAASDLVMPKKVKITYMKAVAKTHPDKVPESLELENKMIAENVFSVL 686

Query: 648 GNAWNVFKLNNDIN 661
             AW+ FK+ N+++
Sbjct: 687 SVAWDKFKIENNMS 700

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score =  278 bits (711), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 191/561 (34%), Positives = 307/561 (54%), Gaps = 56/561 (9%)

Query: 128 LLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNGKKFQQRNGFTAGQRSDS 187
           +++ V  ME   + + G++ + A+S Y++G+ + D   VL+  +K +  NG+   QRS+ 
Sbjct: 130 VIDEVRDMELAKLMSLGLNIDKASSYYERGITFED---VLRK-RKQKASNGYQ--QRSNI 183

Query: 188 DNDR-------VFTFRKDNEEENLISFASNLFTKGRDLVENKINKTFENIGNRRSTPFE- 239
           D  +       +F  R    E    S  S +  KG++LV N+++ T+    N R   F+ 
Sbjct: 184 DRKQGGGEIRNIFDTRGSGSE----SLFSGILNKGKELV-NQLS-TYTEEENERMNKFKG 237

Query: 240 FKLFSSENTNSRSHTNKYEPELSRDSSNSDYISKKFDGLSVDEDKGNPCLNKEENYADLL 299
           ++ +S   T            L +++S    +  +     + +    P   K  +    +
Sbjct: 238 YEEYSMSETY-----------LEKENSMDPGVFSRSSQEKIPQRAARPSHEKSNSSRSKI 286

Query: 300 SHAFLDTGDTEAKDRIWG---QSQNVHSQESLYSAE---DGKLIDFDTE-EAPPPA---- 348
           +        TEA  + +    QS  + S++S   +    +G L+DFD +  A  P     
Sbjct: 287 NKRMT----TEAPHKPFNDDDQSSLIESKDSSRESSMPGEGTLLDFDNDNHASSPVVNTS 342

Query: 349 --SKVSSHYVPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVA 406
             + VS   +PIS IE+SGY EF   G  YF+NGDY +A ++Y KSLNTLP+ HPLRI+A
Sbjct: 343 NQNTVSITQIPISHIEISGYNEFKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIA 402

Query: 407 YSNIITTQLKIGEHTESLKNIEKACDLL--DGSSLDGIIQGTNPPKTYKEFWNKIISKKA 464
           YSNII +++KIG+H++S+ + ++A  LL  + S     IQ ++P ++Y + W KII ++A
Sbjct: 403 YSNIIASRIKIGQHSQSVVDAQEAMKLLPEEKSLWTAAIQNSDPVRSYNDIWPKIILRQA 462

Query: 465 EVLEYLEHYDEALAVYRCLISKGVFDKKIIEGKTRCQKH----SKITSEPATEDSALAPV 520
           E  E +E Y  AL  Y+ L+ K +F +K+I GK RCQ      SK  S P ++ +  AP 
Sbjct: 463 ESYEAIEKYKLALDAYQTLLEKNLFSEKVIAGKRRCQHALGLDSKPKSNPPSKSATPAPA 522

Query: 521 QKDKVPKSNNSSIPERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKET 580
            + + P  N  +    + +S  AE+L K+ + + +LE QK  L+DKV   I SW +GK+ 
Sbjct: 523 PR-RAPTVNRQTEVVNK-KSVNAEKLKKENERLAKLEDQKVALYDKVEGIINSWKNGKQD 580

Query: 581 DXXXXXXXXXXXXTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLA 640
           D            TWT W  + +++LV+P+KVKI YMKA++K+HPDK+PS+L LE +M+A
Sbjct: 581 DIRYLLSNLQAVITWTQWKPVQSSELVLPRKVKITYMKAVAKLHPDKLPSSLTLEQQMIA 640

Query: 641 EDIFSVLGNAWNVFKLNNDIN 661
           E +FS L ++W  FK +NDIN
Sbjct: 641 ESVFSTLSDSWENFKKSNDIN 661

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score =  266 bits (680), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 200/562 (35%), Positives = 283/562 (50%), Gaps = 88/562 (15%)

Query: 132 VHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNGKKFQQRNGFTAGQRSDSDNDR 191
           V  ME   + + G+S + A   Y+  + Y    E+L++ +K + R+     + +D    +
Sbjct: 137 VKDMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQK-KHRDRIAREKSNDIKIKK 195

Query: 192 VFTFR-KDNEEENLISFASNLFTKGRDLVENKINKTFENIGNRRSTPFEFKLFSSENTNS 250
              F   D++  NL+S A++ F KG++L++              S P E      EN   
Sbjct: 196 PGLFNNTDSDNNNLLSIATDFFNKGKELMDQ-----------WTSFPPE------ENNRL 238

Query: 251 RSHTNKYEPELSRDSSNSDYISKKFDGLSVDEDKGNPCLNKEENY-ADLLSHAFLDTGDT 309
           +SH N        D SN DY       LS++E   NPC +  +N   DLL+       D 
Sbjct: 239 KSHLNL------EDESN-DY------DLSLEE---NPCNSGGDNLDEDLLT-------DF 275

Query: 310 EAKDRIWGQ-SQNVHSQESLY-------------SAEDGKLIDFDTEEAPPP-------- 347
           EAK  I  + S+NV S  S               S+ D  L+DF  E             
Sbjct: 276 EAKIDITKRASKNVASSPSPSFDIPIDEDSGKKESSMDDSLLDFSPENFTKSDSTENNTL 335

Query: 348 --ASKVSSHYVPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIV 405
              S  +   VPIS IE+SGY EF   G   F+NGDY N+ Q+Y K+LN+LP  HPLRI+
Sbjct: 336 FGESSNAVSVVPISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRII 395

Query: 406 AYSNIITTQLKIGEHTESLKNIEKACDLLD--GSSLDGIIQGTNPPKTYKEFWNKIISKK 463
             SNII +QLK+GE+++S+ N + A  L     +S +  I  ++P +++ + W KI+ ++
Sbjct: 396 GLSNIIASQLKVGEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRR 455

Query: 464 AEVLEYLEHYDEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKD 523
           AE  E+LE +  AL  Y+ LIS+  FD KI++GK RCQ      S P    S   PV+K 
Sbjct: 456 AESFEHLESFKNALETYQELISRNFFDDKIMQGKRRCQN---FISPPLVRKST--PVKKT 510

Query: 524 ----KVPKSNNSSIPERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKE 579
               K P  + S  P            I  + + +ELE  K  L+DKV  KI +W  GKE
Sbjct: 511 TPTLKKPAPDPSPAPID----------IPSKVKEQELENAKLALYDKVFGKIGTWKGGKE 560

Query: 580 TDXXXXXXXXXXXXTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKML 639
            D            TW NW  +   DLV+PKKVKI YMKA++K HPDK+P +L LE+KM+
Sbjct: 561 DDIRHLLSNLSQLLTWCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMI 620

Query: 640 AEDIFSVLGNAWNVFKLNNDIN 661
           AE+IFS L  AW+ FK  NDIN
Sbjct: 621 AENIFSTLSIAWDKFKQQNDIN 642

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score =  266 bits (680), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 191/322 (59%), Gaps = 33/322 (10%)

Query: 356 VPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQL 415
           +PIS IE+SGY EF   G   F+NGDY N+ Q+Y KSLNTLP+ HPLRI+A SNII +QL
Sbjct: 364 IPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQL 423

Query: 416 KIGEHTESLKNIEKACDLLDGSSLD--GIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHY 473
           KIGE+++S++N   A +L   S       I  ++P +++ + W KI+ ++AE  E+LE +
Sbjct: 424 KIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESF 483

Query: 474 DEALAVYRCLISKGVFDKKIIEGKTRCQ--------------KHSKITSEPATEDSALAP 519
            +AL  Y+ LI K  FD KI++GK RCQ              K    T+ PAT+   L  
Sbjct: 484 KKALETYQELIKKNFFDDKIMQGKRRCQDFINPPPVKKSMPVKKKTTTTSPATKKQNL-- 541

Query: 520 VQKDKVPKSNNSSIPERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKE 579
                   S+NS I      S  +   IKKR    ELE  K  L+DKV  KI SW DGK+
Sbjct: 542 -----TASSSNSPI------SVDSTSEIKKR----ELENAKLALYDKVFEKISSWKDGKD 586

Query: 580 TDXXXXXXXXXXXXTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKML 639
            D            TW NW  +   DLV+PK+VKI YMKA++K HPDK+P +L LE+KM+
Sbjct: 587 DDIRHLLANLSSLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMI 646

Query: 640 AEDIFSVLGNAWNVFKLNNDIN 661
           AE+IFS L  AW+ FKL NDIN
Sbjct: 647 AENIFSTLSIAWDKFKLQNDIN 668

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score =  265 bits (677), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 176/558 (31%), Positives = 282/558 (50%), Gaps = 55/558 (9%)

Query: 127 PLLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNGKKFQQRNGFTAGQRSD 186
           P+++ V  ME   + + G+  + A   Y++G+ Y   ++V+   K+   R          
Sbjct: 98  PVVDEVKDMEIARLMSLGLDWDKAAEYYERGILY---EQVVDRQKRRTARTERPLRTSPQ 154

Query: 187 SDNDRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKTFENIGNRRSTPFEFKLFSSE 246
           S   R        EE +L S ASN   KGR  +++K+ +      +R           S+
Sbjct: 155 SSQLR-------EEESDLFSVASNWLNKGRTFLDSKLKQVQTEYSDRSF---------SD 198

Query: 247 NTNSRSHTNKYEPELSRDSS-----NSDY----ISKKFDGLSVDED-----KGNPCLNKE 292
             +SRS +N   P L    S     +SD     ++ +F  L ++E+     + N  +   
Sbjct: 199 YISSRSGSNASPPWLKESGSYHLQVSSDRGKQKVTTQFKDLKIEEETHFGPRANSPVPST 258

Query: 293 ENYADLLSHAFLDTGDTEAKDRIWGQSQNVHSQESLYSAEDGKLIDFDTEEAPP-PASKV 351
           ++ A  ++ A          D+          Q+      +  LIDF   EAP    S V
Sbjct: 259 KSPAVSVASASHPVYSETPGDKSEAPPNPSPVQD------NDLLIDF---EAPALKTSNV 309

Query: 352 SSHYVP-ISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNI 410
            + Y P ++++E   ++EF   G   FR GDYH A Q Y KSLN+LP+ HPLR+V++SNI
Sbjct: 310 PATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNI 369

Query: 411 ITTQLKIGEHTESLKNIEKACDLLDGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYL 470
           I  +LK+GE+ E+L +   A  L+   S++  I   NPPKTYKEFW+KI++ KA   E +
Sbjct: 370 IICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERV 429

Query: 471 EHYDEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNN 530
           E+Y++AL  Y+ LI  GV   K++E + +CQK   +  +P +    +A   +  +PK+  
Sbjct: 430 ENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVS----VARKSETSIPKAAV 485

Query: 531 SSIPERR---IRSQKAEELIKKRQEM----KELEKQKFRLHDKVHSKIQSWIDGKETDXX 583
           +  P  R   +  +   E + + Q++    K+LE Q+F LHD+V S IQ W +G + +  
Sbjct: 486 TKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLR 545

Query: 584 XXXXXXXXXXTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDI 643
                      W NW  +   DLV+PKK K+IY+KA++K HPDK+  +  L+ KM+AE++
Sbjct: 546 ELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENV 605

Query: 644 FSVLGNAWNVFKLNNDIN 661
           F VL  AW  FK  N ++
Sbjct: 606 FIVLSKAWETFKEKNQLS 623

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score =  263 bits (672), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 208/691 (30%), Positives = 322/691 (46%), Gaps = 86/691 (12%)

Query: 1   MGDPFATLLSNFKGEKKELVQSSPRNASLNAILCXXXXXXXXXXXALDKLQVQDTSKNAK 60
           MGDPFA LL+ FKG      +S P+N     +                     +T + + 
Sbjct: 1   MGDPFADLLTQFKGG-----ESKPQNQGNKPLAAQYSEN--------------NTRETSS 41

Query: 61  TVQYDPENAFSERN-SADDSLNELFCLRDSASPL------PPPEKESIAFDFDTTVRDLN 113
           ++   PE   +  N   DD   +LF ++ + +         P       FD    +  + 
Sbjct: 42  SLSLQPEPVTTASNYKIDDDFEQLFGIKSNTNTNNSDVNNRPNTTNQNEFDSAIDLLQIT 101

Query: 114 PANLNEAMWGLEGPLLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNGKKF 173
           P    ++       L++ V  ME   + + G S + AN+ Y+QG+ Y D  E  +  KK 
Sbjct: 102 PEKQRQSAEREPEQLVDEVRDMEVAKLMSLGYSIDGANTSYEQGMLYDDVIEE-RKKKKL 160

Query: 174 QQRNGFTAGQRSDSDNDRVFTFRKDNEEEN--LISFASNLFTKGRDLVENKINKTFENIG 231
            +R        ++ + +   T   ++ + N  L S AS +F KG+ +V++     F +  
Sbjct: 161 HRRELQRLMAETNWERETPETNNDESGKNNVDLFSIASGIFNKGKKIVDHL--SLFPDEE 218

Query: 232 NRRSTPFEFKLFSSENTNSRSHTNKYEPELSRDSSNSDYISKKFDGLSVDEDKGN----- 286
           N      +   + SE    R     +EPEL R        + +  G    E +       
Sbjct: 219 N------DLLPYRSERLKQR---QTFEPELPRRPRKDPTPNPRTQGTPQVEYESTLQYQQ 269

Query: 287 PCLNKEENYADLLSHAFLDTGDTEAKDRIWGQSQNVHSQESLYSAEDGKLIDFDTEEAPP 346
           P +  +E   DLL       GD +  D++  +SQ   S  +  S  +  L+DFD   A  
Sbjct: 270 PTIQAQE--GDLL-------GDFQ--DKLSLRSQGNKSTSASQSPSNETLLDFDAPSANS 318

Query: 347 PASKVSSHY-------VPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVG 399
            ++ VS          VPI++IE+SGY EF     + F+ GDY  A Q+Y KS NTLP G
Sbjct: 319 TSASVSVSRQGSVVPTVPITEIELSGYNEFKDRAGELFKTGDYVAALQEYEKSANTLPHG 378

Query: 400 HPLRIVAYSNIITTQLKIGEHTESLKNIEKACDLL--DGSSLDGIIQGTNPPKTYKEFWN 457
           HPLRI++YSN++ +QLK G++ ESL     A  L   D +    +IQ + P KTY++ W 
Sbjct: 379 HPLRIISYSNLMASQLKTGQYKESLHVASMALKLFPEDTTQWTQLIQNSEPSKTYRDMWP 438

Query: 458 KIISKKAEVLEYLEHYDEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSAL 517
           KI+ ++AE  E+ E++ EA   Y+ LI K     KI++GK RCQK              L
Sbjct: 439 KIVQRRAEAFEHSENFQEAFNAYQSLIEKNFCTNKIMDGKRRCQK-------------VL 485

Query: 518 APVQKDKVPKSNNSSIPERRIRSQKAEELIKKRQEMKELEK-------QKFRLHDKVHSK 570
            P +K KV +   +S          +++  K  Q++KE  +       Q+  L+D+V+ +
Sbjct: 486 NP-EKPKVVQKKPASSKSPSPSPNHSDKKYKNLQKVKEDNRKQAEEDTQRHALYDRVYDQ 544

Query: 571 IQSWIDGKETDXXXXXXXXXXXXTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPS 630
           I+ W  GK  D            TW +W  +   DLV+PKKVKI Y++A++K HPDK+  
Sbjct: 545 IKLWESGKANDIRHLLSNLQTVLTWVDWKPVSPADLVMPKKVKITYLRAVAKTHPDKISD 604

Query: 631 TLDLESKMLAEDIFSVLGNAWNVFKLNNDIN 661
           +L L+ KM+AE +FS L +AW  FK  NDIN
Sbjct: 605 SLPLDKKMIAESVFSSLSSAWEKFKSENDIN 635

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score =  263 bits (673), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 223/718 (31%), Positives = 332/718 (46%), Gaps = 108/718 (15%)

Query: 1   MGDPFATLLSNFKGE------KKELVQSSPR------------------NASLNAILCXX 36
           M DPFA LL++FK +      KKE ++SS                    N SL++I    
Sbjct: 1   MSDPFAHLLTSFKNKDSAAESKKETLRSSNSPSLPDSVVADISKTDKTINDSLHSISASP 60

Query: 37  XXXXXXXXXALDKLQVQDTSKNAKTVQYDPENAFSERNSADDSLNELFCLRDSASPLPPP 96
                    ++  L   + + +A +    P       +  DD  NELF    +A      
Sbjct: 61  LIPSSKVGFSVPPLVSSNNTISANSTNSSPRPPL---DHIDDDFNELFGNGTTA------ 111

Query: 97  EKESIAFDFDTTVRDLNPANLNEAMWGLEGPLLEGVHGMESEPINARGISTEDANSCYDQ 156
                A D    V D    N        +  L++ V  ME   + + G+S E A   Y+ 
Sbjct: 112 -----ATDTLQKVNDDYCRNNEGRKSNGDEALVDEVKDMEIARLMSLGLSIEKATKFYND 166

Query: 157 GLFYIDAQEVLQ-NGKKFQQRN-----GFTAGQRSDSDNDRVFTFRKDNEEENLISFASN 210
            + Y    +VL+ N KK + R      G    +RS+  N+        +E  NL S A+N
Sbjct: 167 DITYERYLKVLKSNQKKSKDRTARESPGDVNFERSELSNNF------GSENNNLFSIATN 220

Query: 211 LFTKGRDLVENKINKTFENIGNRRSTPFEFKLFSSENTNSRSHTNKYEPELSRDSSNSDY 270
            F KG++LV+              S P E     + + N R+ +  Y+  L  D      
Sbjct: 221 FFNKGKELVDQ-----------WTSFPPEENDRLNNHPNLRNKSEDYDSPLEND------ 263

Query: 271 ISKKFDGLSVDEDKGNPCLNKEENY-ADLLSHAFLDTGDTEAKDRIWGQ----------- 318
               ++G S+++DK    L  E N   DLL+       D E K  I  +           
Sbjct: 264 ---PYNGFSIEDDKSEKGLLSENNLDEDLLT-------DFETKIEITKRTVSDVDPSPSP 313

Query: 319 SQNVHSQESLYSAE---DGKLIDFDTEEAPPPASKVSSHY----------VPISQIEMSG 365
           S  +  +E+    E   +  L+DF         S  S+            +PIS IE+SG
Sbjct: 314 SSGILIEENPLRKEPLVENNLLDFSEGNVTKSNSSESNSLFNGNRNPNSAIPISDIELSG 373

Query: 366 YQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTESLK 425
           Y EF   G  +F+NGDY N+ Q+Y KSLN+LP  HPLRI+A SNII +QLK+GE+++S++
Sbjct: 374 YNEFKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIE 433

Query: 426 NIEKACDLLDGSSLD--GIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHYDEALAVYRCL 483
           N   A  L   +  +   +I  ++P +++ + W KI+ ++AE  E+LE +  AL  Y+ L
Sbjct: 434 NSSMALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNALETYQEL 493

Query: 484 ISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSIPERRIRSQKA 543
           I+K  FD+KI++GK RCQ    I   P  + S +      + P   ++        S   
Sbjct: 494 INKNFFDEKIMQGKRRCQNF--INPPPVKKFSPVKKATSTQSPTEKSTPTSSSSTSSNSP 551

Query: 544 EELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDXXXXXXXXXXXXTWTNWNHIGA 603
           +   K +++  ELE  K  L+DKV  +I SW + K  D            TW NW  I  
Sbjct: 552 DTTSKIKKQ--ELENAKLALYDKVFERISSWKNDKGDDIRHLLANLSGLLTWCNWKDIPM 609

Query: 604 NDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNVFKLNNDIN 661
            DLV+PK+VKI YMKA++K HPDK+P +L LE+KM+AE++FS L  AW+ FK  NDIN
Sbjct: 610 QDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENVFSSLSIAWDKFKQQNDIN 667

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score =  261 bits (668), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 216/720 (30%), Positives = 342/720 (47%), Gaps = 93/720 (12%)

Query: 1   MGDPFATLLSNFKGEKKELVQSSPRNASLNAILCXXXXXXXXXXXALDKLQVQDTSKNAK 60
           M DPFA LLS+FK       + + +  ++                  + L  Q    N  
Sbjct: 1   MADPFADLLSSFKSGSTTKNEQADKKVNI------------ATKPMAELLTAQKPVNNVT 48

Query: 61  TVQYDPENAFS-ERNSADDSLNELFCLRDSASPLPPPEKESIAFDFDTT-----VRDLNP 114
            +    EN  S   N   D + +LF L   + P+   +  + +   +T+     + DL+ 
Sbjct: 49  LI----ENEVSISSNGIHDDIADLFGLSSESKPINASKPINASKPINTSKPSEGIDDLDA 104

Query: 115 A------NLNEAMWG--------LEGPLLEGVHGMESEPINARGISTEDANSCYDQGLFY 160
           A      +  E++ G        ++  +++ V  ME   + + G+  ++A + YD G+ Y
Sbjct: 105 AMNFFNDSPQESLRGSTVTTSPEVQDIVVDEVKDMEIAKLMSLGLDIDEATTHYDNGILY 164

Query: 161 IDAQEVLQNGKKFQQRNGFTAGQRSDSD-ND-RVFTFRKDNEEENLISFASNLFTKGRDL 218
               E L +  K +  N     QR+DS  ND R    RK        +F + LF KG+ L
Sbjct: 165 ----ETLVS--KIRTSNSRITAQRNDSGRNDIRAEPMRKPRTSNGSFTF-TGLFDKGKQL 217

Query: 219 VENKINKTFENIGNRRSTPFEFKLFSSENT------------NSRSHTNKYEPELSR--- 263
           V+      +    +R      FK+  S NT            N  +  ++Y+   S+   
Sbjct: 218 VDQWT--VYHEEDDRLFRNTNFKVDPSTNTYQPSGDYDTSDENPFNQQSRYDIASSKTTS 275

Query: 264 -DSSNSDYISKKFDGLSVDED------KGNPCLNKEENYADLLSHAFL------DTGDTE 310
            DS   +Y  KK    S++        K  P  N+  N  DLL+  F+      +   T 
Sbjct: 276 TDSQTRNYHDKK---TSINNKAHERIAKETPINNQPANL-DLLNDDFISIKLSSENVSTN 331

Query: 311 AKDRIWGQSQNVHSQESLYSA-------EDGKLIDFDTEEAPPPASKVSSHYVPISQIEM 363
             +    +S+   S++++           +  L+DFD+      +   S   VPIS+IE+
Sbjct: 332 LTNLEQAKSKQATSKQAISKPIVNVAPKANNTLLDFDSPTTAVHSPAASLPKVPISEIEL 391

Query: 364 SGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTES 423
            GY+EF   G + F+ GDY  A + Y KSLNTLP+ HPLRI+A SNI+ +  K GE+ +S
Sbjct: 392 LGYKEFKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKS 451

Query: 424 LKNIEKACDLLDG--SSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHYDEALAVYR 481
           ++    A +   G     +  IQ + P +TYK+ W KI+ K+AE  E++E Y+ AL  Y+
Sbjct: 452 IEISTSALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENALETYQ 511

Query: 482 CLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSIPERRIRSQ 541
            +I K  F+ K++ GK RCQ H     +P   +S+  P Q +  PK  ++    +    +
Sbjct: 512 QMIEKNFFNDKVMSGKRRCQ-HVINPVKPTKSNSSALPRQTNTKPKKESN----QNKAYE 566

Query: 542 KAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDXXXXXXXXXXXXTWTNWNHI 601
             E+L +K +   E+E Q+  L+D V ++I  W   K+ D            TW NWN +
Sbjct: 567 NVEKLKQKNKLEAEIESQRLALYDSVEAQINKWKANKDDDIRHLLSNLQLILTWGNWNPV 626

Query: 602 GANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNVFKLNNDIN 661
             +DLV+PKKVKI YMKA+++ HPDK+PS L+LE KM+AE+IFSVL  AW  FK +N++N
Sbjct: 627 PPSDLVMPKKVKITYMKAVARTHPDKIPSDLELEKKMIAENIFSVLSKAWEKFKKDNNMN 686

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score =  258 bits (659), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 140/329 (42%), Positives = 199/329 (60%), Gaps = 12/329 (3%)

Query: 336 LIDFDTEEAPPPASKVSSHYVPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNT 395
           L+DFD     PP    +   VPIS +E+SGY+E+   G ++F+ GDY +A Q+Y KSLN+
Sbjct: 245 LLDFDN--GTPPERIKTITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNS 302

Query: 396 LPVGHPLRIVAYSNIITTQLKIGEHTESLKNIEKACDLL--DGSSLDGIIQGTNPPKTYK 453
           LP  H LRIVAYSN+     K+GE+   L +IE A ++   D +  D  IQ + P +T+K
Sbjct: 303 LPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFK 362

Query: 454 EFWNKIISKKAEVLEYLEHYDEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATE 513
           E W KI++++AE  E++E+Y+ AL  Y+ LI K  F+ KI+ GK RCQK    T EP   
Sbjct: 363 EMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPT-EPKAT 421

Query: 514 DSALAPVQKDKVPKSNNSSIPERRIRSQKAEELIKKRQEMKEL-EKQKFRLHDKVHSKIQ 572
               +P     VPK +  +   ++ ++    E +K+  +  EL E +K  L+D V  +I+
Sbjct: 422 SPNRSPT---PVPKVSEDT---KQPKTYANVERVKQENQRNELQEAEKAALYDTVFQQIE 475

Query: 573 SWIDGKETDXXXXXXXXXXXXTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTL 632
           SW  GK  D            TW +W  +  +DLV+PKKVKI YMKA++K HPDK+PS+L
Sbjct: 476 SWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSL 535

Query: 633 DLESKMLAEDIFSVLGNAWNVFKLNNDIN 661
           +LE +M+AED+FS L  AW  FKL NDIN
Sbjct: 536 ELEKRMIAEDVFSSLSVAWEKFKLANDIN 564

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score =  258 bits (660), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 179/550 (32%), Positives = 270/550 (49%), Gaps = 37/550 (6%)

Query: 125 EGPLLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQ-NGKKFQQRNGFTAGQ 183
           +G L++ V  ME   + + G+S E A   Y+  + Y    E+ +   KK + R       
Sbjct: 134 DGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPT 193

Query: 184 RSDSDNDRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKTFENIGNRRSTPFEFKLF 243
            S S N  +F         NL S A++ F KG++LV+     +F    N R + +     
Sbjct: 194 GSSSKNASLFN-NASPNNNNLFSMATDFFNKGKELVDQWT--SFPPEANDRLSNY----- 245

Query: 244 SSENTNSRSHTNKYEPELSRDSSNSDYISKKFDGLSVDEDKGNPCLNKEENYADLLSHAF 303
                N     + YE  L  DS +     +K D    ++D        ++   D  +   
Sbjct: 246 ----VNVEDKLDHYELPLENDSYDGSLPQRKED----EKDLLGGNDLDDDLLTDFETKID 297

Query: 304 LDTGDTEAKDRIWGQSQNVHSQESLYSAE---DGKLIDFDTEEAPPPASKVSSH------ 354
           +   D +           +  +++L   E   +  L+DF T+      +   S       
Sbjct: 298 ITKKDAKDTTPSPSPPPGILVEDALRKEEPQREDNLLDFSTDNISSTNNSAISREDGNTN 357

Query: 355 -YVPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITT 413
              PIS IE+SGY EF   G   F+NGDY N+ Q+Y KSLN+LP+ HPLRI+A SNII +
Sbjct: 358 PVAPISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIAS 417

Query: 414 QLKIGEHTESLKNIEKACDLLDG--SSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLE 471
           QLKIGE+++S++N + A  L     SS +  I  ++P ++Y + W KI+ ++AE  E+LE
Sbjct: 418 QLKIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLE 477

Query: 472 HYDEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNS 531
            +  AL  Y+ L+++  FD KI++GK RCQ    +   PA + S +        P    +
Sbjct: 478 SFKNALETYQELVTRNFFDDKIMQGKRRCQDF--VNPAPARKPSPVKKTTPTPAPMKKPT 535

Query: 532 SIPERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDXXXXXXXXXX 591
           S P        +      R + +ELE  K  L+D V  KI  W  GK+ D          
Sbjct: 536 STPSPAPVDNAS------RVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSG 589

Query: 592 XXTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAW 651
             TW NW  +   +LV+PKKVKI YMKA++K HPDK+P +L LE+KM+AE++F+ L  AW
Sbjct: 590 LLTWCNWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAW 649

Query: 652 NVFKLNNDIN 661
           + FK  NDIN
Sbjct: 650 DKFKQQNDIN 659

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score =  257 bits (657), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 221/697 (31%), Positives = 334/697 (47%), Gaps = 87/697 (12%)

Query: 1   MGDPFATLLSNFK--GEKKELVQSSPRNASLNAILCXXXXXXXXXXXALDKLQVQDTSKN 58
           M DPFA LL +FK  G+K ++ + +P     N +              L   ++   +  
Sbjct: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDV------SSISLNSTLQPKKLNGINTK 54

Query: 59  AKTVQYDPENAFSERNSAD--------DSLNELFCLRDSASPLPPPEKESIAFDFDTTVR 110
             T+  +    F+  +S +        D   ELF    S +    PE  +   +F  TV 
Sbjct: 55  VSTLSTNSVPTFANVSSLNSLQTTPIHDDFEELFGSSTSNNFSVSPEPTN---NF-KTVT 110

Query: 111 DLNPANLNEAMWGLEGPLLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNG 170
           D+ P    EA    +  +++ V  ME   + + G+S E ANS Y +G+ Y    + L+  
Sbjct: 111 DV-PNVTYEAK---QDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLER- 165

Query: 171 KKFQQRNGF---TAGQRSDSDNDRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKTF 227
           +++  R G    T G  ++ D+         +E  NL S AS LF           NK  
Sbjct: 166 RRYGSRKGRDTPTFGGNTNKDDKAYAKLFDSSENTNLFSMASGLF-----------NKGK 214

Query: 228 ENIGNRRSTPFEFKLFSSENTNSRSHTNK---YEPELSRDSSNSDYISKKFDGLSVDEDK 284
           E I    + P E    S     S   + K     P +  D  + D IS+       D DK
Sbjct: 215 EFIDQMTAYPEETDRLSRYRDISEISSMKPLRKSPGIV-DGFDMDRISQH-----QDTDK 268

Query: 285 GNPCLNKEENYADLLSHAFLDTGDTEAKDRIWGQSQNVHSQESLYSAEDGKLIDFDTEEA 344
           G     + +  +   SH  LD      K      ++   S+ES+       L+D D +++
Sbjct: 269 GKAPTREVQQESPPPSHDLLDNFQNNLK---LDDNKEELSKESV-------LLDIDNDDS 318

Query: 345 PPPASKVSSH-----------------YVPISQIEMSGYQEFNINGKQYFRNGDYHNAHQ 387
               SK  +                   +PIS IE+SGY E+N  G  +F+NGDY +A +
Sbjct: 319 TLLKSKSLTSDSLLFQDENVLENSNIPKIPISSIELSGYNEYNSRGSSFFKNGDYISALE 378

Query: 388 QYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTESLKNIEKACDLLDGSSL--DGIIQG 445
           +Y KSLNTLP  HPLRI+AYSNI   +LKIGE++  +K  +KA  L    +L  + IIQ 
Sbjct: 379 EYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKLFPKENLKWNLIIQD 438

Query: 446 TNPPKTYKEFWNKIISKKAEVLEYLEHYDEALAVYRCLISKGVFDKKIIEGKTRCQKHSK 505
           + P K+YK+ W+K++ +KAE LE+LE+++ A   Y  LI   VF  KI++GK RCQK   
Sbjct: 439 SEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVFSDKIMDGKRRCQK--- 495

Query: 506 ITSEPATEDSALAPVQKDKVPKSNNSSIPERRIRSQKAEELIKKRQEMKELEK-QKFRLH 564
                   +  +A   + K   S  +++P    +  ++ E IK++   +E  + +K +L+
Sbjct: 496 ------VLNPEIAKKTQQKPSSSKPAAVPTPSTQKYESVERIKEQNRQEEENEAEKLKLY 549

Query: 565 DKVHSKIQSWIDGKETDXXXXXXXXXXXXTWTNWNHIGANDLVIPKKVKIIYMKAISKVH 624
           D V +KI +W   K  D            TWT W  I  NDLV+PKKVK+ Y+KAI+K H
Sbjct: 550 DIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKVTYLKAIAKTH 609

Query: 625 PDKVPSTLDLESKMLAEDIFSVLGNAWNVFKLNNDIN 661
           PDK+ S+L+LESKM+AE+ FS L  AW+ FK  N++N
Sbjct: 610 PDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score =  256 bits (655), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 143/345 (41%), Positives = 206/345 (59%), Gaps = 24/345 (6%)

Query: 332 EDGKLIDFDTEEAPPPAS-KVSSH------YVPISQIEMSGYQEFNINGKQYFRNGDYHN 384
           +D  L+DF  E+   PA+  +SS        + I+QIE+SGY EF   G +YF+ GDY +
Sbjct: 356 QDNTLLDFGNEDLSSPANVSISSSGQECIPVISINQIELSGYNEFKDRGTEYFKKGDYVS 415

Query: 385 AHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTESLKNIEKACDLLDGSS--LDGI 442
           A +QY KSLN+L   HPLRI+A SN++ + LK G++T  +     A DL    S   D +
Sbjct: 416 ATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITISTSALDLFPKESKLWDNV 475

Query: 443 IQGTNPPKTYKEFWNKIISKKAEVLEYLEHYDEALAVYRCLISKGVFDKKIIEGKTRCQK 502
           IQ + P KTYKE W+K+++++AE  E++E+Y +A   Y+ LI   +F++KI+ GK RCQK
Sbjct: 476 IQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIENNIFNEKIMAGKLRCQK 535

Query: 503 ------HSK-ITSEPATEDSALAPVQKDKVPKSNNSSIPERRIRSQKAEELIKKRQEMKE 555
                 H+K +    AT         K+ V   + SS   ++I+ Q       KR E  E
Sbjct: 536 VLNPETHNKPLKKLVATTAETKTSQTKNIVNTQSTSSGNLKKIQEQN------KRTEKYE 589

Query: 556 LEKQKFRLHDKVHSKIQSWIDGKETDXXXXXXXXXXXXTWTNWNHIGANDLVIPKKVKII 615
            EK+   L+D V  K+ +WI GK+ D            TWT WN + ++DLV+PKKVKI 
Sbjct: 590 EEKEA--LYDVVEQKVNAWIAGKDDDIRHLLSRLQRIITWTQWNEVASSDLVMPKKVKIT 647

Query: 616 YMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNVFKLNNDI 660
           Y+KA++K HPDK+PS LD ES+MLAE+IFS+L   W  FK++N+I
Sbjct: 648 YLKAVAKTHPDKLPSNLDTESRMLAENIFSILSKNWEKFKVDNNI 692

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score =  254 bits (648), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 215/698 (30%), Positives = 340/698 (48%), Gaps = 115/698 (16%)

Query: 1   MGDPFATLLSNFKGEKKELVQSSP--RNASLNAILCXXXXXXXXXXXALDKLQVQDTSKN 58
           M DPFA LLS+FKG       +S   +NASLN +L            AL     + +  N
Sbjct: 1   MSDPFADLLSSFKGVNSSTGNNSSANKNASLNDLLSSHS--------ALTSPLSRKSPSN 52

Query: 59  AKTVQYDPEN-AFSERNSADDSLNELFCLRDSASPL---PPPEKESIAF---DFDTTVRD 111
             +    PE+ + +   ++ D  ++L       +PL   P     S A    DFD     
Sbjct: 53  VPS--KTPESISITSMTASQDFFDDLLAAPSQVTPLRESPSQVAPSTATEKDDFDLAFES 110

Query: 112 LN-----------PANLNEAMWGLEGPLLEGVHGMESEPINARGISTEDANSCYDQGLFY 160
            N           P  + E       PL++ V  ME   + + G+S + A   YD+G+ Y
Sbjct: 111 FNSTPHVDLVQPQPDPIPEPQ-----PLVDEVKDMEIARLMSLGLSFDKAVHYYDKGIMY 165

Query: 161 IDAQEVLQNGKKFQQRNGFTAGQRSDSDNDRVFTFRKDNEEEN------LISFASNLFTK 214
              +E++++ KK +Q        RS+ +ND  F  ++  ++E+       IS ASNLF  
Sbjct: 166 ---EELIESQKKRKQ-------SRSNVNND--FGQQQLRKQESRDSSPAFISVASNLFNM 213

Query: 215 GRDLVENKINKTFE----NIGNRRSTPFEFKLFSS-ENTNSRSHTNKYEPELSRDSSNSD 269
           G++ +E+K+  T +    N   R     +  L       +SR H+ +++ E +    + +
Sbjct: 214 GKEFIEDKLKPTLQPQYANSSQRSQFSDDIPLRRDYTRPHSRPHSMQFQSERTSPQPSPE 273

Query: 270 YISKKFDGLSVDEDKGNPCLNKEENYADLLSHAFLDTGDTEAKDRIWGQSQNVHSQESLY 329
             S     LS++     P     EN          DT              +V +QE+  
Sbjct: 274 LPS--IHQLSINNASSAPPPVSVENQ---------DTA-------------SVINQET-- 307

Query: 330 SAEDGKLIDFDTEEAPPPASKVSSHYVPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQY 389
                 L+DF    A P  S    H   IS  E++ + EF  NG +YF +GDYHNA  ++
Sbjct: 308 ------LVDFG---AAPQTSASPQHR--ISDFELTSFNEFKNNGVKYFSSGDYHNALLEF 356

Query: 390 IKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTESLKNIEKACDLLD-GSSLDGIIQGTNP 448
            KS NTLP  HPLRI++ SNI++ QLK+GE++++L++++ A DL D   +   II+ + P
Sbjct: 357 EKSFNTLPFKHPLRIISLSNIVSCQLKLGENSKALESVKLALDLSDLAPNASDIIEHSVP 416

Query: 449 PKTYKEFWNKIISKKAEVLEYLEHYDEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITS 508
            +T+K+  NKI  K AE+ E+LE+Y++AL++Y  LIS G+ ++K+++GK RC+K      
Sbjct: 417 ERTFKQMINKIQLKHAEIQEHLENYEKALSLYANLISNGITEQKVMDGKRRCEKIVNPEK 476

Query: 509 -EPATEDSALAPVQKDKVPKSNNSSIPERRIRSQKAEELIKKR-----QEMKELEKQKFR 562
            +PA E             K ++ +IP R   S  A+ +   R     ++ +E E+++ R
Sbjct: 477 FKPAKE-------------KISSPTIPVRSKTSISADTVAVNRVKEENKKQEEEEEERLR 523

Query: 563 LHDKVHSKIQSWIDGKETDXXXXXXXXXXXXTWTNWNHIGANDLVIPKKVKIIYMKAISK 622
           L DKV  KI  W    E D             W +W  +   DLV+ KKVKI Y+KAI+K
Sbjct: 524 LRDKVDEKISEWTKNNENDLRYLLANLEPLLWWASWKEVSPQDLVMTKKVKICYLKAIAK 583

Query: 623 VHPDKVPSTLDLESKMLAEDIFSVLGNAWNVFKLNNDI 660
            HPDK+P+   LE+ M+AE+++++L  AW  FK  N+I
Sbjct: 584 THPDKIPADASLETIMIAENVYTILNKAWEYFKSQNNI 621

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score =  242 bits (617), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 200/679 (29%), Positives = 316/679 (46%), Gaps = 112/679 (16%)

Query: 1   MGDPFATLLSNFKGEKKELVQSS-------------PRNASLNAILCXXXXXXXXXXXAL 47
           M DPFA+LL++FK   K+    S             P  AS +A+               
Sbjct: 1   MADPFASLLTSFKESSKKPAAKSESPEPVTVKGGGEPATASTHAVFME------------ 48

Query: 48  DKLQVQDTSKNAKTVQYDPENAFSERNSADDSLNELFCLRDSASPLPPPE-KESIAFDFD 106
               +  +     + Q  P  +       DD  +++F L +S    P  E KE      D
Sbjct: 49  ---PLIPSGGGQGSFQQKPAGS-------DDKFDDVFDLFNSE---PAAEVKEPDRVPSD 95

Query: 107 TTVRDLNPANLNEAMWGLEGPLLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEV 166
            +V + N A ++E            V  ME   I + G   + A   YD G+ Y    E+
Sbjct: 96  ESVHE-NVAVVDE------------VRDMEVAKIMSLGFGIDKAVEFYDSGVLY---DEL 139

Query: 167 LQNGKKFQQRNGFTAGQRSDSDNDRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKT 226
           ++   +   R+  T        + R  T    +   +  S A  L  KG+D V++ +   
Sbjct: 140 VERRDRRHIRHTHT------RHSVREVTEVPKHTGNSFFSAAVGLLNKGKDFVDH-LTAY 192

Query: 227 FENIGNRRSTPFEFKLFSSENTNSRSHTNKYEP-ELSRDSSNSDYISKKFDGLSVDEDKG 285
            +  G+R         +  E+ ++ +H   + P E  +D    D+ SK    +S+  DK 
Sbjct: 193 PDEEGDR------LARYRQEHADA-AHFGDFTPGEREQDLLIDDFESK----VSI-TDKH 240

Query: 286 NPCLNKEENYADLLSHAFLDTGDTEAKDRIWGQSQNVHSQESLYSAEDGKLIDFDTEEAP 345
           NP L      A       LD G+ ++     G   +V++  S+              E P
Sbjct: 241 NPPL------AQTPDETLLDFGEDDSSKS--GSRTHVNNSPSI--------------ELP 278

Query: 346 PPASKVSSHYVPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIV 405
                     VPIS +E+SGY EF   G + F+ GDY  A  +Y KSLNTLP  HPLRI+
Sbjct: 279 ---------IVPISTMELSGYNEFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRII 329

Query: 406 AYSNIITTQLKIGEHTESLKNIEKACDLL--DGSSLDGIIQGTNPPKTYKEFWNKIISKK 463
           A SN++   LKIGE+T+ LK    A +L+  D S+   +IQ + P +TY++ W+K++ + 
Sbjct: 330 AMSNMMLPYLKIGEYTKCLKLAPLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRL 389

Query: 464 AEVLEYLEHYDEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKD 523
           AE  E+ E+Y  A   Y+ L++ G+ ++K+++GK RCQK   + + P+  +    P    
Sbjct: 390 AEAQEHAENYTGAFDNYQLLVANGITNEKVMDGKRRCQK---VLNPPSKVERKGTPTPTP 446

Query: 524 KVPKSNNSSIPE-RRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDX 582
           +V     +  P   +   + AE + +   + ++ E  K   +D V +K+ +W   KE D 
Sbjct: 447 QVVTPARTPDPATSKTVYENAERVKRANAKSEQEEAAKMEFYDVVETKVNNWKGDKEGDI 506

Query: 583 XXXXXXXXXXXTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAED 642
                      TW  WN +   DLV+PK+VKI Y+KAI+K+HPDK+P+ L LE +M+A+ 
Sbjct: 507 RYLLSHLTEIVTWVEWNSVSQADLVMPKRVKITYLKAIAKIHPDKIPADLPLEYRMIADT 566

Query: 643 IFSVLGNAWNVFKLNNDIN 661
           +FSVL NAW  FKL+N+IN
Sbjct: 567 VFSVLNNAWEKFKLDNNIN 585

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score =  245 bits (625), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 191/308 (62%), Gaps = 6/308 (1%)

Query: 356 VPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQL 415
           VPIS IE+SGY EF  NG ++F+ GDY +A  +Y KSLNTLP  HPLR+++YSNI+  QL
Sbjct: 536 VPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQL 595

Query: 416 KIGEHTESLKNIEKACDLL--DGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHY 473
           K+GE+++S+K+ + A +L   +       IQ ++P KTYKE W KI+ +KAE  E++E Y
Sbjct: 596 KVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655

Query: 474 DEALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSI 533
             A   Y+ L+ K VF+ KI+ GK RCQK     +      +  + +   K   ++ SSI
Sbjct: 656 QIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSRISSAKQSTASTSSI 715

Query: 534 PERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDXXXXXXXXXXXX 593
              +      E L + R++ +E E+++ RL D V++KIQ W + KE D            
Sbjct: 716 NVNK----NVERLKETRKKEREEEEERLRLLDSVNAKIQKWTNNKEDDIRYLLSNVHIVL 771

Query: 594 TWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNV 653
           TW+NW  I A+DLV+PKKVK+ YMKA++K HPDK+   L +E+KM+AE IFS+L  AW  
Sbjct: 772 TWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEK 831

Query: 654 FKLNNDIN 661
           FK  N +N
Sbjct: 832 FKTANKMN 839

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 1  MGDPFATLLSNFKGEKKELVQSS-PRNASLNAI 32
          M DPFA LLS+FKG+      +S  +NASL+ +
Sbjct: 1  MSDPFANLLSSFKGDTPNSTSASISKNASLDVL 33

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 50/111 (45%), Gaps = 10/111 (9%)

Query: 356 VPISQIEMSGYQE-FNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQ 414
           +P+   E+    E F + G +     DY  A ++Y +++ TLP      ++ Y+N     
Sbjct: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAY 143

Query: 415 LKIGEHTESLKNIEKACDLLDG-----SSLDGIIQGTNPPKTYKEFWNKII 460
             + E+  ++K+ EKA ++        S L       N P+   E++ K++
Sbjct: 144 SSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVL 194

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 59/120 (49%), Gaps = 13/120 (10%)

Query: 298 LLSHAFLDTGDTEAKDRIWGQSQNVHSQESLYSAEDGKLIDFDTEEAPPPAS-KVSSHYV 356
           +L+ +++  G+  A  RIW        + ++ + E G +++ + E     AS +V    V
Sbjct: 367 VLAKSYIRMGN--AYHRIWDH------EHAITAYEYGLMLNGNEEHKKKLASLRVEFEKV 418

Query: 357 PISQ-IEMSGYQEFNINGKQYFRNGDYHNAHQQY---IKSLNTLPVGHPLRIVAYSNIIT 412
              + I++  ++E  I GKQ+F N +Y  A + Y   IK+  T PVG   R   +  ++T
Sbjct: 419 KKGEFIDLQKFEEARIEGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLT 478

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 366 YQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTESLK 425
           ++E+   G  YF++G+Y  A + Y K +       P   + YSN   + +K+ ++TE+L+
Sbjct: 3   FEEYKTTGNTYFKDGNYLKAVEYYKKCIEV----EPENPIGYSNSAMSLIKLTKYTEALE 58

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 31.2 bits (69), Expect = 2.8,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 4/63 (6%)

Query: 363 MSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTE 422
           MS +++    G   F+ G Y  A   Y    + L    P   V YSN     +K+GE+T+
Sbjct: 1   MSQFEKQKEQGNSLFKQGLYREAVHCY----DQLITAQPQNPVGYSNKAMALIKLGEYTQ 56

Query: 423 SLK 425
           +++
Sbjct: 57  AIQ 59

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 31.2 bits (69), Expect = 3.3,   Method: Composition-based stats.
 Identities = 17/68 (25%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 363 MSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTE 422
           M+ +++    G   F+ G Y  A    + S + L    P   V YSN     +K+GEH +
Sbjct: 5   MTSFEKDKQQGNALFKQGLYLEA----VDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQ 60

Query: 423 SLKNIEKA 430
           +++  ++ 
Sbjct: 61  AIQACQQG 68

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 4/51 (7%)

Query: 366 YQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLK 416
           +Q F   G ++F+ G+Y  A +QY K ++  P       V YSN+    LK
Sbjct: 35  FQHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTN----AVGYSNLAMAYLK 81

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 4/66 (6%)

Query: 367 QEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTESLKN 426
           +E  + GK+YF   D+ NA + Y + +   P         YSN      K+    E++K+
Sbjct: 391 EEARLEGKEYFTKSDWPNAVKAYTEMIKRAPED----ARGYSNRAAALAKLMSFPEAIKD 446

Query: 427 IEKACD 432
            EKA +
Sbjct: 447 CEKAIE 452

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query: 366 YQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTESLK 425
           +  F   G QYF+ G+Y +A + Y K +      +P   + YSN     +K  ++ E+++
Sbjct: 3   FDHFKTEGNQYFKEGNYASAIKSYEKCIEI----NPENPIGYSNKAMALIKANKNQEAVR 58

Query: 426 NIE 428
             +
Sbjct: 59  TCQ 61

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 367 QEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEHTESLKN 426
           ++  + G  +F+NGDY  A   Y K+   L   +P   + +SN+ T  +K+    E++  
Sbjct: 42  EDLKVKGNTFFKNGDYETAILYYEKAC-ALDSSNP---IYFSNMATALIKLERWQEAV-- 95

Query: 427 IEKACD 432
              ACD
Sbjct: 96  --NACD 99

>KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some
           similarities with uniprot|Q12041 Saccharomyces
           cerevisiae YDR253C MET32 and some similarities with
           uniprot|Q03081 Saccharomyces cerevisiae YPL038W MET31
           Zinc- finger DNA-binding proteins
          Length = 289

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 11/51 (21%), Positives = 27/51 (52%)

Query: 511 ATEDSALAPVQKDKVPKSNNSSIPERRIRSQKAEELIKKRQEMKELEKQKF 561
            + D+A+ P  +D    SNN+ + ++R   +K   + ++  +++  E+Q  
Sbjct: 177 GSSDTAIVPYDRDSTDGSNNADLDDKRFPCEKCHMVFRRSSDLRRHERQHL 227

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 356 VPISQIEMSGYQE-FNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQ 414
           +P+   E+    E F + G +     D+H A ++Y +++  LP       + Y+N     
Sbjct: 90  IPVEDAEIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPT----NAIYYANRAAAH 145

Query: 415 LKIGEHTESLKNIEKACDL 433
             + E  E++K+ E A  +
Sbjct: 146 SSLKEFEEAIKDAESAIKI 164

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {ON}
           Anc_2.350 YMR161W
          Length = 220

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%)

Query: 611 KVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNA 650
           ++K  Y K   K+HPDK P     E+  L    F VLGN+
Sbjct: 37  EIKKAYRKLAIKLHPDKNPHPKAAEAFKLINRAFEVLGNS 76

>ZYRO0D17666g Chr4 complement(1462228..1462836,1463330..1464139)
           [1419 bp, 472 aa] {ON} similar to gnl|GLV|DEHA0E02046g
           Debaryomyces hansenii DEHA0E02046g and some similarites
           with YNR053C uniprot|P53742 Saccharomyces cerevisiae
           YNR053C NOG2 Putative GTPase that associates with
           pre-60S ribosomal subunits in the nucleolus and is
           required for their nuclear export and maturation
          Length = 472

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 61/134 (45%), Gaps = 18/134 (13%)

Query: 427 IEKACDLLDGSSLDGIIQGTNPPKTYKEFWN--KIISKKAEVLEYLEHYDEALA-----V 479
           I K+ DL D +  D  +Q        + ++N  ++IS+ A     L+H+ +AL       
Sbjct: 55  IVKSADLQDKTIPDARVQPD------RRWFNSTRVISQDA-----LQHFRDALGETQKDS 103

Query: 480 YRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSIPERRIR 539
           Y+ L+ +      ++E K R +  +    E  +   A  P  + K P+   SS+ E    
Sbjct: 104 YQVLLKRNKLPMSLLEEKDRTESPTANILETESYSQAFGPNAQRKKPRIAASSLEEVAQM 163

Query: 540 SQKAEELIKKRQEM 553
           +QK  E  +++QE+
Sbjct: 164 TQKDNEAYEEKQEL 177

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
           {ON} similar to uniprot|P39101 YER048C Saccharomyces
           cerevisiae CAJ1 Nuclear type II J heat shock protein of
           the E. coli dnaJ family
          Length = 398

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 6/57 (10%)

Query: 598 WNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNVF 654
           ++ +G +    P ++K  Y +   + HPDK P   + E+K      F  +G A+ V 
Sbjct: 8   YDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEAENK------FQAVGEAYQVL 58

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,614,808
Number of extensions: 3600998
Number of successful extensions: 13596
Number of sequences better than 10.0: 175
Number of HSP's gapped: 14171
Number of HSP's successfully gapped: 179
Length of query: 661
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 545
Effective length of database: 40,180,143
Effective search space: 21898177935
Effective search space used: 21898177935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)