Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_8180na 1ON1741749231e-129
AGR353Cna 1ON1771684561e-57
KLLA0B10219gna 1ON1791031243e-08
SAKL0H23122g4.147aON2151761061e-05
TDEL0D030404.147aON9458922e-04
ZYRO0G11176g4.147aON10566915e-04
NDAI0D01780singletonON10668830.006
TDEL0D04740na 2ON56986810.036
Suva_10.92na 3ON9968740.079
YLR012Cna 3ON9981740.081
Skud_12.80na 3ON11079720.22
Kpol_YGOB_111764.147aON9985700.28
Smik_12.75na 3ON9968680.55
KAFR0F003102.55ON336119681.8
CAGL0B02629g8.484ON82583672.3
Skud_5.2017.275ON56077654.9
Kwal_23.59627.275ON55277645.3
TBLA0B073605.90ON93046637.4
CAGL0G04873g4.219ON136989638.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_8180
         (174 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_8180 Chr8 (376511..377035) [525 bp, 174 aa] {ON} similar to...   360   e-129
AGR353C Chr7 complement(1385949..1386482) [534 bp, 177 aa] {ON} ...   180   1e-57
KLLA0B10219g Chr2 complement(893941..894480) [540 bp, 179 aa] {O...    52   3e-08
SAKL0H23122g Chr8 (2004664..2005311) [648 bp, 215 aa] {ON} no si...    45   1e-05
TDEL0D03040 Chr4 complement(572078..572362) [285 bp, 94 aa] {ON}       40   2e-04
ZYRO0G11176g Chr7 (895757..896074) [318 bp, 105 aa] {ON} some si...    40   5e-04
NDAI0D01780 Chr4 complement(414158..414478) [321 bp, 106 aa] {ON}      37   0.006
TDEL0D04740 Chr4 (869648..871357) [1710 bp, 569 aa] {ON}               36   0.036
Suva_10.92 Chr10 complement(176142..176441) [300 bp, 99 aa] {ON}...    33   0.079
YLR012C Chr12 complement(169982..170281) [300 bp, 99 aa] {ON} Pu...    33   0.081
Skud_12.80 Chr12 complement(161864..162196) [333 bp, 110 aa] {ON...    32   0.22 
Kpol_YGOB_11176 s1025 complement(64556..64855) [300 bp, 99 aa] {...    32   0.28 
Smik_12.75 Chr12 complement(156916..157215) [300 bp, 99 aa] {ON}...    31   0.55 
KAFR0F00310 Chr6 complement(78200..79210) [1011 bp, 336 aa] {ON}...    31   1.8  
CAGL0B02629g Chr2 (250886..253363) [2478 bp, 825 aa] {ON} simila...    30   2.3  
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    30   4.9  
Kwal_23.5962 s23 complement(1391198..1392856) [1659 bp, 552 aa] ...    29   5.3  
TBLA0B07360 Chr2 (1752395..1755187) [2793 bp, 930 aa] {ON} Anc_5...    29   7.4  
CAGL0G04873g Chr7 complement(464641..468750) [4110 bp, 1369 aa] ...    29   8.8  

>Ecym_8180 Chr8 (376511..377035) [525 bp, 174 aa] {ON} similar to
           Ashbya gossypii AGR353C
          Length = 174

 Score =  360 bits (923), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 174/174 (100%), Positives = 174/174 (100%)

Query: 1   MSERNINRTYWSDEWFLLPESIKPKELKSFLTDSDKIGSFSFMWFTVFIISLLAYMIFSF 60
           MSERNINRTYWSDEWFLLPESIKPKELKSFLTDSDKIGSFSFMWFTVFIISLLAYMIFSF
Sbjct: 1   MSERNINRTYWSDEWFLLPESIKPKELKSFLTDSDKIGSFSFMWFTVFIISLLAYMIFSF 60

Query: 61  VYEYSYAMKKRIQRRHEEALISQKPIWISICDYHTKLSPAAQDAYLEYSQRMFEQLRGRL 120
           VYEYSYAMKKRIQRRHEEALISQKPIWISICDYHTKLSPAAQDAYLEYSQRMFEQLRGRL
Sbjct: 61  VYEYSYAMKKRIQRRHEEALISQKPIWISICDYHTKLSPAAQDAYLEYSQRMFEQLRGRL 120

Query: 121 EVEKAQSTAIQNAKTKAEEELNGLKRLTAWACKRAHFSKWKFKEQRHIILEDMV 174
           EVEKAQSTAIQNAKTKAEEELNGLKRLTAWACKRAHFSKWKFKEQRHIILEDMV
Sbjct: 121 EVEKAQSTAIQNAKTKAEEELNGLKRLTAWACKRAHFSKWKFKEQRHIILEDMV 174

>AGR353C Chr7 complement(1385949..1386482) [534 bp, 177 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YLR012C
          Length = 177

 Score =  180 bits (456), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 82/168 (48%), Positives = 119/168 (70%)

Query: 7   NRTYWSDEWFLLPESIKPKELKSFLTDSDKIGSFSFMWFTVFIISLLAYMIFSFVYEYSY 66
           N+T W +E F+ P S++  +L+SF++D+D++GSF FM F  FI+ LL YM+ + +Y+  Y
Sbjct: 10  NQTRWLNEGFMFPTSLRMSDLRSFISDTDRMGSFCFMCFMCFILMLLMYMVLASMYDCGY 69

Query: 67  AMKKRIQRRHEEALISQKPIWISICDYHTKLSPAAQDAYLEYSQRMFEQLRGRLEVEKAQ 126
           A+++R+++ +  A+  Q PIW+SI DYHTKL+P+ Q+AYLEYSQRMFEQ R RLE EK  
Sbjct: 70  ALRRRLEKENAAAVACQTPIWLSIYDYHTKLTPSQQNAYLEYSQRMFEQERHRLESEKEL 129

Query: 127 STAIQNAKTKAEEELNGLKRLTAWACKRAHFSKWKFKEQRHIILEDMV 174
           S   + A+ KA +EL+ LKR+T W C +A + KW  + QR I   DMV
Sbjct: 130 SRTKEEAREKAHQELDWLKRITTWTCTKARYVKWSRRLQRSISSADMV 177

>KLLA0B10219g Chr2 complement(893941..894480) [540 bp, 179 aa] {ON}
           conserved hypothetical protein
          Length = 179

 Score = 52.4 bits (124), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 9/103 (8%)

Query: 13  DEWFLLPESIKPKELKSFLTDSDKIGSFSFMWFTVFIISLLAYMIFSFVYEYSYAMKKRI 72
           D     P+S +P  +  +  D + +G F F+    F+++L+   + SF++   Y      
Sbjct: 5   DNELRFPDSTQPHAIAKWFHDPENVGGFIFL---CFVVTLVLIAVVSFIFGIYYFFNPYT 61

Query: 73  QRRHEEALISQKPIWISICDYHTKLSPAAQDAYLEYSQRMFEQ 115
                    + K +WISI DY  KL+P  QD Y++ +  ++E+
Sbjct: 62  PPP------TPKSLWISIADYQDKLTPEQQDQYIQQACDLYEK 98

>SAKL0H23122g Chr8 (2004664..2005311) [648 bp, 215 aa] {ON} no
           similarity
          Length = 215

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 84/176 (47%), Gaps = 16/176 (9%)

Query: 7   NRTYWSDEWFLLP---ESIKPKELKSFLTDSDKIGSFSFMWFTVFIISLLAYMIFSFVYE 63
            R+ + D+   LP    S+  K+L     D    GS  F  FT+ I+ LL  ++   +Y+
Sbjct: 44  TRSKFRDDCDPLPPLSSSMSWKKLGQCFKDPQIQGSLVFTTFTILILVLLFLLVGMALYQ 103

Query: 64  YSYAMKKRIQRRHEEALISQKPIWISICDYHTKLSPAAQDAYLEYSQRMFEQLRGRLEVE 123
           +   + K ++ ++   L  Q+   + I ++   L P  QDAYL++      +L   LE +
Sbjct: 104 W-LTLSKYVRDKYSRRLKEQESRALCILEFEA-LPPEKQDAYLDWC---CAELEKALEED 158

Query: 124 KAQSTAIQ------NAKTKAEEELNGLKRLTAWACKRAHFSKWKFKEQRHIILEDM 173
           K     +Q        K +  EE+N L ++T+W   RA+F    ++E++H   EDM
Sbjct: 159 KRSVVEVQTHCVPGGCKERVFEEVNWLNKMTSWLFPRAYFP--SYREKKHFCDEDM 212

>TDEL0D03040 Chr4 complement(572078..572362) [285 bp, 94 aa] {ON} 
          Length = 94

 Score = 40.0 bits (92), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 94  HTKLSPAAQDAYLEYSQRMFEQLRGRLEVEKAQSTAIQNAKTKAEEELNGLKRLTAWA 151
           +++L PA Q+ YL++ Q  FE  R  +  E+ Q      A  KA+EE++ L+R+T W+
Sbjct: 11  YSRLPPAVQEQYLDWCQNQFENEREMILFER-QGGVQGLASRKAQEEVDWLQRITVWS 67

>ZYRO0G11176g Chr7 (895757..896074) [318 bp, 105 aa] {ON} some
           similarities with uniprot|Q07927 Saccharomyces
           cerevisiae YLR012C Hypothetical ORF
          Length = 105

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 94  HTKLSPAAQDAYLEYSQRMFEQLRGRLEVEKAQSTAIQNAKTKAEEELNGLKRLTAWACK 153
           +  L P  QD YL+++Q  +E+   +L+ E+ Q      AK KAE+E+  L+R+T W+  
Sbjct: 22  YKSLPPEIQDEYLDWAQEQWEKQWAQLQFER-QGGVSGIAKKKAEQEVQWLERVTTWSYL 80

Query: 154 RAHFSK 159
            A+  +
Sbjct: 81  HAYIPR 86

>NDAI0D01780 Chr4 complement(414158..414478) [321 bp, 106 aa] {ON} 
          Length = 106

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 94  HTKLSPAAQDAYLEYSQRMFEQLRGRLEVEKAQSTAIQNAKTKAEEELNGLKRLTAWACK 153
           ++K  P   +AYL Y++++FE+   R+E EKA       A+TKA  EL   +R T  +  
Sbjct: 22  YSKFPPEKYNAYLLYNRKLFEEETARIEFEKAGGIPGL-ARTKALRELRYFERCTHGSFC 80

Query: 154 RAHFSKWK 161
             + S  K
Sbjct: 81  PVYISPLK 88

>TDEL0D04740 Chr4 (869648..871357) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 35.8 bits (81), Expect = 0.036,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 4/86 (4%)

Query: 1   MSERNINRTYWSDEWFLLPESIKPK-ELKSFLTDSDKIGSFSFMWFTVFIISLLAYMIFS 59
           M E   N  YW DEW +    +  K E+ SF ++S+K  + +F   T   I ++ ++IF+
Sbjct: 330 MPENKANPFYWFDEWLVKTNRVTLKPEILSFTSESNK-PTLTFTDGTQ--IKVVDHVIFA 386

Query: 60  FVYEYSYAMKKRIQRRHEEALISQKP 85
             Y YSY    ++     +  ++  P
Sbjct: 387 TGYLYSYPFMSQVLMEQRKIFVTPDP 412

>Suva_10.92 Chr10 complement(176142..176441) [300 bp, 99 aa] {ON}
           YLR012C (REAL)
          Length = 99

 Score = 33.1 bits (74), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 94  HTKLSPAAQDAYLEYSQRMFEQLRGRLEVEKAQSTAIQNAKTKAEEELNGLKRLTAWACK 153
           + +L P  Q+ YL   Q+ FE+   R+  E+ Q      A+  A+EE+    R+T W+  
Sbjct: 14  YLQLQPDQQEKYLALCQKDFERETERIAFER-QGGVPGIARKVAQEEVAWFDRVTTWSYM 72

Query: 154 RAHFSKWK 161
            A+  K++
Sbjct: 73  NAYIPKYR 80

>YLR012C Chr12 complement(169982..170281) [300 bp, 99 aa] {ON}
           Putative protein of unknown function; YLR012C is not an
           essential gene
          Length = 99

 Score = 33.1 bits (74), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 94  HTKLSPAAQDAYLEYSQRMFEQLRGRLEVEKAQSTAIQNAKTKAEEELNGLKRLTAWACK 153
           + +L P  Q+ YL   Q+ FEQ   R+  ++ Q      A+  A+EE+    R+T W+  
Sbjct: 14  YLQLQPEQQEKYLALCQKDFEQETERIAFDR-QGGVPGIARKFAQEEVAWFDRVTTWSYM 72

Query: 154 RAHFSKWKFKEQRHIILEDMV 174
            A+     ++ +R+++  DM+
Sbjct: 73  NAYIP--SYRRRRNLLKIDML 91

>Skud_12.80 Chr12 complement(161864..162196) [333 bp, 110 aa] {ON}
           YLR012C (REAL)
          Length = 110

 Score = 32.3 bits (72), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 96  KLSPAAQDAYLEYSQRMFEQLRGRLEVEKAQSTAIQNAKTKAEEELNGLKRLTAWACKRA 155
           +L P  Q+ YL   Q+ FE+   R+  E+ Q      AK  A+ E+    R+T W+   A
Sbjct: 27  QLQPDQQEKYLTLCQKDFERETERIAFER-QGGVPGIAKKVAQNEVAWFDRITTWSYMNA 85

Query: 156 HFSKWKFKEQRHIILEDMV 174
           +  K+  K  R++   DM 
Sbjct: 86  YIPKYSRK--RNLFKIDMT 102

>Kpol_YGOB_11176 s1025 complement(64556..64855) [300 bp, 99 aa] {ON}
           ANNOTATED BY YGOB - Search-DOGS addition
          Length = 99

 Score = 31.6 bits (70), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 9/85 (10%)

Query: 94  HTKLSPAAQDAYLEYSQRMFEQLRGRLEVEKAQSTA---IQN-AKTKAEEELNGLKRLTA 149
           + +LS + Q  YL++ Q  F+     LEV++A+ +     +N A+ +A  ++  L+ +T 
Sbjct: 18  YERLSESDQTQYLDWCQFQFD-----LEVKRARESVEGYFENLAREEAMHQVMALECITV 72

Query: 150 WACKRAHFSKWKFKEQRHIILEDMV 174
                  FS+   K QR I LEDM+
Sbjct: 73  INFPACRFSQVSTKPQRFIRLEDML 97

>Smik_12.75 Chr12 complement(156916..157215) [300 bp, 99 aa] {ON}
           YLR012C (REAL)
          Length = 99

 Score = 30.8 bits (68), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 94  HTKLSPAAQDAYLEYSQRMFEQLRGRLEVEKAQSTAIQNAKTKAEEELNGLKRLTAWACK 153
           + +L P  Q+ YL   Q  FE+   R+  E+ Q      AK  A+EE+    R+T W+  
Sbjct: 14  YLQLQPEQQEKYLALCQEDFERETERIAFER-QGGIPGIAKKLAQEEVAWFDRVTTWSYM 72

Query: 154 RAHFSKWK 161
            A+   ++
Sbjct: 73  NAYIPSYR 80

>KAFR0F00310 Chr6 complement(78200..79210) [1011 bp, 336 aa] {ON}
           Anc_2.55 YDL222C
          Length = 336

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 52/119 (43%), Gaps = 15/119 (12%)

Query: 34  SDKIGS--FSFMWFTVFIISLLAYMIFSFVYEYSYAMKKRIQRRHEEALISQKPIWISIC 91
           S K+G+  F+F+W TVF+  LL   I+S     ++  KK  Q    E   +  P      
Sbjct: 181 SAKLGAKNFAFIWTTVFL--LLLNTIWSTFVSATHKGKKYSQYEEPEVYNTYPPASGDTT 238

Query: 92  DYH--------TKLSPAAQDAYLEYSQRMFEQLRGRLEVEKAQSTAIQNAKTKAEEELN 142
            Y         T ++PA Q+   + +QR+ +Q+    +   A+  A+       ++ +N
Sbjct: 239 QYFKQAYARGATDVTPAPQNVPQQGAQRVAQQVP---QTTYARGEAVPATAGTTQKPIN 294

>CAGL0B02629g Chr2 (250886..253363) [2478 bp, 825 aa] {ON} similar
           to uniprot|P37304 Saccharomyces cerevisiae YDR251w PAM1
           and similar to uniprot|Q03088 Saccharomyces cerevisiae
           YPL032c SVL3
          Length = 825

 Score = 30.4 bits (67), Expect = 2.3,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 6/83 (7%)

Query: 63  EYSYAMKKRIQRRHEEALISQKPIWISICDYHTKLSPAAQDAYLEYSQRMFEQLRGRLEV 122
           E+ Y M ++ Q      L + K IW    D + K S   Q    E  Q++ E+L  +   
Sbjct: 341 EFLYTMIRQYQ-----ILNAGKSIWFQRSDTNQKSSQNEQ-LLEEKLQKLNEELAYQQNY 394

Query: 123 EKAQSTAIQNAKTKAEEELNGLK 145
            K  ST +   + K ++ELN LK
Sbjct: 395 AKELSTKLDQDEKKHQDELNALK 417

>Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON}
           YER082C (REAL)
          Length = 560

 Score = 29.6 bits (65), Expect = 4.9,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 35/77 (45%), Gaps = 15/77 (19%)

Query: 58  FSFVYEYS----YAMKKRIQRRHEEALISQKPIWISICDYHTKLSPAAQDAYLEYSQRMF 113
           ++F+Y+Y     + +K+ I+ RH E L            YH  L+ A +  +L+Y     
Sbjct: 179 YTFIYDYEGTELHRLKQHIEARHLEFL-----------PYHFLLASAGETGWLKYHDVST 227

Query: 114 EQLRGRLEVEKAQSTAI 130
            QL   L  +   +TA+
Sbjct: 228 GQLISELRTKAGPTTAM 244

>Kwal_23.5962 s23 complement(1391198..1392856) [1659 bp, 552 aa]
           {ON} YER082C (KRE31) - Hypothetical ORF [contig 12] FULL
          Length = 552

 Score = 29.3 bits (64), Expect = 5.3,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 36/77 (46%), Gaps = 15/77 (19%)

Query: 58  FSFVYEYS----YAMKKRIQRRHEEALISQKPIWISICDYHTKLSPAAQDAYLEYSQRMF 113
           ++F+Y+Y     + +K+ I+ +H + L            YH  L+ A Q  +L+Y     
Sbjct: 172 YTFIYDYEGTELHRLKQHIEVKHMQFL-----------PYHYLLATAGQSGWLKYQDVST 220

Query: 114 EQLRGRLEVEKAQSTAI 130
            QL+  +  +   +TA+
Sbjct: 221 GQLQAEIRTKLGPTTAM 237

>TBLA0B07360 Chr2 (1752395..1755187) [2793 bp, 930 aa] {ON} Anc_5.90
           YGR237C
          Length = 930

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 123 EKAQSTAIQNAKTKAEEELNGLKRLTAWACKRAHFSKWKFKEQRHI 168
           EK  S A  N +T  E +LN + RL +  CK  + S   + +   +
Sbjct: 664 EKLFSVASTNTQTNLEAKLNAIDRLISKTCKNPYISASYYDDNDSV 709

>CAGL0G04873g Chr7 complement(464641..468750) [4110 bp, 1369 aa]
           {ON} similar to uniprot|P51862 Saccharomyces cerevisiae
           YLR371w ROM2 GDP/GTP exchange factor for RHO1P
          Length = 1369

 Score = 28.9 bits (63), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

Query: 77  EEALISQKP-IWISICDYHTKLSPAAQDAYLEYSQRMFEQLRGRLEVEKAQSTAIQNAKT 135
           EEA I QK    I+   +H K SP       ++  +  E+LR         ++A+QN + 
Sbjct: 151 EEAAIGQKAGFGITPAMHHAKSSPHLNHQKHQFGSKHQEKLRAANSNNSTGNSAVQNRER 210

Query: 136 KAEEELNGLKRLTAWACKRAHFSKWKFKE 164
           +A ++ +  +   A   K+A FS    K 
Sbjct: 211 EARKKPSLPQLALAGLKKQASFSNISNKN 239

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.133    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,513,186
Number of extensions: 655125
Number of successful extensions: 2248
Number of sequences better than 10.0: 31
Number of HSP's gapped: 2277
Number of HSP's successfully gapped: 31
Length of query: 174
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 72
Effective length of database: 41,785,467
Effective search space: 3008553624
Effective search space used: 3008553624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 62 (28.5 bits)