Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_81795.353ON58583053e-38
KLTH0H14894g5.353ON59582811e-34
TDEL0E027405.353ON58582774e-34
SAKL0G08800g5.353ON59562775e-34
TPHA0D020805.353ON59582767e-34
Kwal_34.159765.353ON59582767e-34
NCAS0H016305.353ON58582741e-33
Kpol_1051.65.353ON58582713e-33
YHR072W-A (NOP10)5.353ON58582699e-33
Smik_8.1495.353ON58582672e-32
Suva_15.2635.353ON58582653e-32
Skud_8.1325.353ON58582621e-31
TBLA0H019605.353ON58582611e-31
KNAG0C054905.353ON56562551e-30
AGR354W5.353ON69562561e-30
ZYRO0D10208g5.353ON64562551e-30
KAFR0C018405.353ON58582541e-30
CAGL0J10802g5.353ON57562523e-30
KLLA0C16753g5.353ON57572514e-30
KAFR0C030408.135ON46844630.49
KAFR0J029503.578ON119238592.1
NCAS0A034205.668ON42138572.9
TBLA0B045908.543ON151857556.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_8179
         (58 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON} s...   122   3e-38
KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly...   112   1e-34
TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}...   111   4e-34
SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON...   111   5e-34
TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353...   110   7e-34
Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON...   110   7e-34
NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}...   110   1e-33
Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON} (11927..12...   108   3e-33
YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}  NOP10Const...   108   9e-33
Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A ...   107   2e-32
Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-...   106   3e-32
Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A ...   105   1e-31
TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}...   105   1e-31
KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa] {O...   102   1e-30
AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic ho...   103   1e-30
ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly s...   102   1e-30
KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}...   102   1e-30
CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa] ...   101   3e-30
KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly...   101   4e-30
KAFR0C03040 Chr3 complement(608258..609664) [1407 bp, 468 aa] {O...    29   0.49 
KAFR0J02950 Chr10 (559600..559642,559721..563256) [3579 bp, 1192...    27   2.1  
NCAS0A03420 Chr1 complement(676473..677738) [1266 bp, 421 aa] {O...    27   2.9  
TBLA0B04590 Chr2 (1061040..1065596) [4557 bp, 1518 aa] {ON} Anc_...    26   6.4  

>Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON}
          similar to Ashbya gossypii AGR354W
          Length = 58

 Score =  122 bits (305), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 58/58 (100%), Positives = 58/58 (100%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ
Sbjct: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58

>KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA
          Length = 59

 Score =  112 bits (281), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLM+TLGPDGKRIYTLKK TEDGEITK AHPARFSPDDKYSRQRVTLKKR+NM+P Q
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58

>TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  111 bits (277), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 56/58 (96%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLM+TLGPDGKR+YTLKK TE+GEITK AHPARFSPDDKYSRQRVTLKKR+N+LPT+
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58

>SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON}
          highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072W-A NOP10 Constituent of small
          nucleolar ribonucleoprotein particles containing
          H/ACA-type snoRNAs, which are required for
          pseudouridylation and processing of pre-18S rRNA
          Length = 59

 Score =  111 bits (277), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 52/56 (92%), Positives = 54/56 (96%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLP 56
          MHLM+TLGPDGKRIYTLKK TE+GEITK AHPARFSPDDKYSRQRVTLKKRFNMLP
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTEEGEITKSAHPARFSPDDKYSRQRVTLKKRFNMLP 56

>TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353
          YHR072W-A
          Length = 59

 Score =  110 bits (276), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 54/58 (93%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLMFTLGPDGKRIYTLKK TE GEITK AHPARFSPDDKYSRQRVTLKKRF++LP Q
Sbjct: 1  MHLMFTLGPDGKRIYTLKKETEQGEITKSAHPARFSPDDKYSRQRVTLKKRFSLLPNQ 58

>Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON}
          YHR072W-A (NOP10) - Component of H/ACA-box snoRNPs
          [contig 272] FULL
          Length = 59

 Score =  110 bits (276), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 54/58 (93%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLM+TLGPDGKRIYTLKK TE GEITK AHPARFSPDDKYSRQRVTLKKR+NM+P Q
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTESGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58

>NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  110 bits (274), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 54/58 (93%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLM+TLG DGKRIYTLKK TEDGEITK AHPARFSPDDKYSRQRVTLKKR+ +LPTQ
Sbjct: 1  MHLMYTLGQDGKRIYTLKKVTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPTQ 58

>Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON}
          (11927..12103) [177 nt, 59 aa]
          Length = 58

 Score =  108 bits (271), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 55/58 (94%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLM+TLGPDGKR+YTLKK TE+GEITK AHPARFSPDDK+SRQRVTLKKRF +LPTQ
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKHSRQRVTLKKRFGLLPTQ 58

>YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}
          NOP10Constituent of small nucleolar ribonucleoprotein
          particles containing H/ACA-type snoRNAs, which are
          required for pseudouridylation and processing of
          pre-18S rRNA
          Length = 58

 Score =  108 bits (269), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLM+TLGPDGKRIYTLKK TE GEITK AHPARFSPDDKYSRQRVTLKKRF ++P Q
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  107 bits (267), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLM+TLGPDGKRIYTLKK TE GEITK AHPARFSPDDKYSRQRVTLKKRF ++P Q
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  106 bits (265), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 53/58 (91%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLM+TLGPDGKRIYTLKK TE GEITK AHPARFSPDDKYSRQRVTLKKRF ++P Q
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  105 bits (262), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (89%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLM+TLGPDGKRIYTL K TE GEITK AHPARFSPDDKYSRQRVTLKKRF ++P Q
Sbjct: 1  MHLMYTLGPDGKRIYTLDKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  105 bits (261), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 48/58 (82%), Positives = 52/58 (89%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLM+TL  DGKR+YTLKK TE GEITK AHPARFSPDDKYSRQRVTLKKR+N+LP Q
Sbjct: 1  MHLMYTLSQDGKRVYTLKKETESGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPGQ 58

>KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa]
          {ON} Anc_5.353 YHR072W-A
          Length = 56

 Score =  102 bits (255), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 49/56 (87%), Positives = 51/56 (91%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLP 56
          MHLM+TL  +GKRIYTLKKAT DGEITK AHPARFSPDDKYSRQRVTLKKRF MLP
Sbjct: 1  MHLMYTLDNEGKRIYTLKKATADGEITKSAHPARFSPDDKYSRQRVTLKKRFGMLP 56

>AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YHR072W-A (NOP10)
          Length = 69

 Score =  103 bits (256), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 47/56 (83%), Positives = 52/56 (92%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLP 56
          MHLM+TLGPDGKR+YTL+K T  GEITK AHPARFSPDDKYSRQRVTLK+RF+MLP
Sbjct: 13 MHLMYTLGPDGKRVYTLEKVTPSGEITKSAHPARFSPDDKYSRQRVTLKRRFDMLP 68

>ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10
          Length = 64

 Score =  102 bits (255), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (92%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLP 56
          MHLM+TLGPDGKR YTL+K TE+GEITK AHPARFSPDDKYSRQRVTLK+R+ +LP
Sbjct: 1  MHLMYTLGPDGKRAYTLQKVTEEGEITKSAHPARFSPDDKYSRQRVTLKRRYGLLP 56

>KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  102 bits (254), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 52/58 (89%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58
          MHLM+TL  DGKR+YTLKK TE+GEITK AHPARFSPDDKYSRQRVTLKKR+ +LP Q
Sbjct: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58

>CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa]
          {ON} highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072wa NOP10
          Length = 57

 Score =  101 bits (252), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (92%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLP 56
          MHLM+TL  +GKR+YTLKK TE+GEITK AHPARFSPDDKYSRQRVTLKKR+N+LP
Sbjct: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56

>KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA,
          Length = 57

 Score =  101 bits (251), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 50/57 (87%)

Query: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPT 57
          MHLM+TL   GKRIYTLKK TED EITK AHPARFSPDDKYSRQRVTLKKR+N+LP 
Sbjct: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57

>KAFR0C03040 Chr3 complement(608258..609664) [1407 bp, 468 aa] {ON}
           Anc_8.135 YGL176C
          Length = 468

 Score = 28.9 bits (63), Expect = 0.49,   Method: Composition-based stats.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 5/44 (11%)

Query: 4   MFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVT 47
           +F+  PDGK I   KK T D EI      + F+ DDK S+  +T
Sbjct: 347 LFSTSPDGKYICYGKKYTRDFEIF-----SIFNVDDKSSQDMIT 385

>KAFR0J02950 Chr10 (559600..559642,559721..563256) [3579 bp, 1192
           aa] {ON} Anc_3.578 YGL251C
          Length = 1192

 Score = 27.3 bits (59), Expect = 2.1,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 23  DGEITKPAHPARFSPDD---KYSRQRVTLKKRFNMLPT 57
           D + T+ +H  +F  DD     S++R+T+KK+  + PT
Sbjct: 74  DQDDTQISHDVQFKNDDFINNNSKRRLTIKKKHELTPT 111

>NCAS0A03420 Chr1 complement(676473..677738) [1266 bp, 421 aa] {ON}
           Anc_5.668 YKR077W
          Length = 421

 Score = 26.6 bits (57), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 11  GKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTL 48
            K+ Y LKK   +  ITKP H A   P     R+R ++
Sbjct: 151 NKKSYNLKKNGTNDSITKPVHIANRKPIINVKRRRSSV 188

>TBLA0B04590 Chr2 (1061040..1065596) [4557 bp, 1518 aa] {ON}
           Anc_8.543 YPL075W
          Length = 1518

 Score = 25.8 bits (55), Expect = 6.4,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 5/57 (8%)

Query: 6   TLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTL-----KKRFNMLPT 57
           T+   G  I  L    ED     P  P R   DDK +  +  L     K   NM+PT
Sbjct: 928 TIPSTGNGILLLSPINEDDRNLGPPSPKRIRLDDKQTTSQTALNALLKKSNDNMMPT 984

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,513,668
Number of extensions: 202416
Number of successful extensions: 532
Number of sequences better than 10.0: 23
Number of HSP's gapped: 532
Number of HSP's successfully gapped: 23
Length of query: 58
Length of database: 53,481,399
Length adjustment: 31
Effective length of query: 27
Effective length of database: 49,926,753
Effective search space: 1348022331
Effective search space used: 1348022331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)