Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_7258na 1ON63863830560.0
AGL069Cna 1ON59462319930.0
KLTH0D06710gna 1ON61156616540.0
Kwal_26.7984na 1ON61254716540.0
Suva_15.426singletonON5405525271e-58
Kwal_33.15241na 2ON5805454316e-45
Skud_14.391na 3ON5845574254e-44
Suva_14.414na 3ON5825494211e-43
KLLA0D12606gsingletonON5935554202e-43
TDEL0H00160singletonON5755564122e-42
YNR055C (HOL1)na 3ON5865684033e-41
Smik_14.389na 3ON5865673963e-40
ZYRO0E02288gsingletonON5455293926e-40
KLLA0E09637gna 2ON5855503938e-40
SAKL0G12232gna 4ON5965553939e-40
SAKL0G12254gna 2ON5815403734e-37
KLTH0B02816gna 2ON5835503707e-37
KLTH0E00132gsingletonON5825473682e-36
KLTH0A00440gsingletonON5825473682e-36
Ecym_2679singletonON5695373653e-36
Ecym_5082na 4ON5745433592e-35
SAKL0D02508gsingletonON5795693592e-35
ADR336Cna 2ON5685353512e-34
ADR337Cna 4ON5705423494e-34
TDEL0D038003.245ON6405733265e-31
KLLA0B06798g3.245ON6635553213e-30
ZYRO0A03564g3.245ON6845823124e-29
Ecym_45063.245ON6485182742e-24
ACL172C3.245ON6315572705e-24
NCAS0B020108.570ON5304702535e-22
ZYRO0F14652g8.570ON5665162448e-21
Kpol_1048.458.570ON6484282431e-20
KAFR0I007108.570ON5754772402e-20
Kwal_33.150205.180ON5975162393e-20
TPHA0I017608.570ON6535442377e-20
Suva_4.4318.570ON5724482332e-19
TPHA0E032005.180ON6265592305e-19
Kwal_27.121738.570ON5674462261e-18
CAGL0M06281g8.570ON5425322199e-18
KLTH0E13222g8.570ON5664452181e-17
SAKL0D04070g3.245ON6672092144e-17
YNL065W (AQR1)2.242ON5865282144e-17
AGR195W8.570ON6194972082e-16
Skud_2.3068.570ON5724632072e-16
YBR180W (DTR1)8.570ON5724302072e-16
Kpol_1017.33.503ON6215552063e-16
Skud_14.2672.242ON5624842055e-16
ADL258W2.242ON5344961992e-15
ZYRO0F08228gsingletonON6492262002e-15
KLTH0G09372g2.242ON5514371974e-15
ZYRO0G15422gsingletonON5424901931e-14
SAKL0H09328g8.570ON5962001931e-14
KNAG0A035408.570ON5384161921e-14
TPHA0F012902.242ON5624971912e-14
TDEL0A051308.570ON5993951912e-14
Smik_2.3208.570ON5724481894e-14
KAFR0C020303.503ON6245311885e-14
ZYRO0F04642gsingletonON5495791885e-14
ZYRO0F02178gsingletonON5954581886e-14
Skud_8.1075.284ON5224441867e-14
NDAI0C056708.570ON5004701868e-14
Skud_2.121na 5ON5464231868e-14
TBLA0B044808.570ON6084601869e-14
Kpol_1051.155.284ON5014161851e-13
KNAG0I019102.242ON5985141841e-13
TDEL0D057103.503ON6165181842e-13
ZYRO0G19646g3.503ON5945521842e-13
Kwal_47.189193.503ON6405191832e-13
CAGL0J00363g5.284ON4984561804e-13
ZYRO0E10230gsingletonON5585481804e-13
Suva_15.2365.284ON5144151796e-13
KLLA0E24113g8.570ON5754311796e-13
Kwal_23.48242.242ON5534371796e-13
CAGL0H06017gsingletonON5575451796e-13
Smik_8.1175.284ON5144151787e-13
KLTH0C08074g3.245ON6422731798e-13
TDEL0D06570singletonON5664161788e-13
SAKL0E08756g2.242ON5654341771e-12
SAKL0G13376g5.180ON6214961771e-12
NCAS0A065805.284ON5284661761e-12
Smik_2.1613.245ON6891941771e-12
Smik_14.2622.242ON5614841761e-12
TBLA0E02520singletonON5635411752e-12
NCAS0G029902.242ON5811671752e-12
Skud_16.4503.503ON6225601752e-12
NCAS0F036203.503ON6345031752e-12
NCAS0E007503.503ON6205041752e-12
Kwal_56.229493.245ON6422741743e-12
KLTH0B03894g5.180ON6061911743e-12
Suva_4.2753.245ON6831941743e-12
KLTH0G02266g3.503ON6445191724e-12
KLLA0E03829g3.503ON6095251724e-12
TDEL0D06500na 6ON5425531724e-12
YBR043C (QDR3)3.245ON6892081725e-12
YPR156C (TPO3)3.503ON6225641707e-12
CAGL0J09944g2.242ON5924431708e-12
Skud_2.1553.245ON6881941708e-12
KAFR0K00100singletonON5295521699e-12
KNAG0B007303.503ON6225661691e-11
Skud_7.4483.503ON6115291662e-11
TDEL0F016704.30ON5824451663e-11
KAFR0J004805.284ON5004411653e-11
Suva_16.4843.503ON6225621663e-11
KAFR0I014004.30ON5894721635e-11
Smik_16.4083.503ON6225611636e-11
Ecym_62298.723ON5675741627e-11
TBLA0D029003.503ON6915461611e-10
KLLA0F18106g4.30ON5895301601e-10
KAFR0K00150singletonON5305451601e-10
Suva_8.420na 7ON5465181601e-10
Suva_7.4253.503ON6135291601e-10
TBLA0A08510singletonON6335181592e-10
ZYRO0A13618gsingletonON5294751592e-10
YBR008C (FLR1)na 5ON5484291582e-10
ZYRO0B16808g5.720ON5295141573e-10
Smik_6.2333.503ON6145281573e-10
Skud_15.531na 7ON5395541563e-10
TDEL0C045902.242ON5295011555e-10
Suva_14.2762.242ON5621581555e-10
AER339C8.723ON5735641555e-10
SAKL0F02442g3.503ON6105581546e-10
YGR138C (TPO2)3.503ON6145311547e-10
NDAI0D010202.242ON5925211511e-09
TPHA0D033103.503ON6135231512e-09
TPHA0B037705.284ON5201571483e-09
Kpol_2002.865.180ON6361921493e-09
KNAG0B049005.284ON5164531483e-09
NCAS0C057804.30ON5674701483e-09
KNAG0F03480singletonON5485201474e-09
NDAI0I027703.503ON6265071484e-09
Ecym_70638.570ON6201991475e-09
Kpol_1057.25singletonON5482301459e-09
TPHA0O02010singletonON5622301449e-09
CAGL0E03674g4.30ON5774751449e-09
TPHA0A00130singletonON5672301422e-08
Kpol_358.7singletonON4552281412e-08
TPHA0G014308.723ON6371911422e-08
ZYRO0D00286gsingletonON5082631412e-08
Kpol_1018.195singletonON5482301413e-08
TDEL0E044805.180ON6161921403e-08
TBLA0A04260singletonON5672251394e-08
KAFR0B00180singletonON5305531394e-08
Kwal_55.195905.720ON5334591394e-08
ZYRO0E09988gsingletonON5485561394e-08
ZYRO0G16302g5.284ON5474581376e-08
NDAI0D048404.30ON6394461386e-08
KAFR0J009302.242ON5661661377e-08
TBLA0A08520singletonON6324761377e-08
Suva_10.434.30ON5874701377e-08
CAGL0H06039gna 7ON5894301378e-08
CAGL0L10912g8.723ON6511921369e-08
Skud_3.178singletonON3892321341e-07
Kpol_1044.214.30ON5874711351e-07
Kpol_1018.193singletonON5484301351e-07
Kpol_1039.192.242ON5731671351e-07
NDAI0D016805.284ON5162171342e-07
ZYRO0E09966gsingletonON5615591342e-07
TPHA0K021604.30ON6085141342e-07
NDAI0A07730singletonON5554851332e-07
Smik_2.128na 5ON5472121332e-07
TBLA0C07220singletonON6122471332e-07
Skud_15.4388.723ON6595741332e-07
Smik_15.4558.723ON6591911332e-07
TDEL0A066708.723ON6251921332e-07
AFR322C3.503ON5923951323e-07
KLTH0E00528g5.720ON5524361313e-07
KAFR0F043904.30ON5674481314e-07
ZYRO0E09900gna 6ON5395591314e-07
Kwal_26.89858.723ON5801421314e-07
KLTH0D12320g8.723ON5881911314e-07
TPHA0I03320singletonON5625211305e-07
Smik_12.274.30ON5874461305e-07
TBLA0A103505.284ON5212331296e-07
Kpol_413.28.723ON6671911306e-07
KLTH0E06138g4.30ON6144721297e-07
CAGL0I10384g3.503ON6302341297e-07
Skud_12.384.30ON5874461297e-07
KNAG0G028308.723ON6771911289e-07
Kwal_55.206864.30ON6135201271e-06
KLLA0F03311g2.242ON5421701271e-06
ZYRO0E09922gsingletonON5635541271e-06
KLTH0G06754g5.284ON4801811261e-06
Skud_9.482.241ON5991211261e-06
Suva_9.702.242ON5651341262e-06
NDAI0B037702.242ON5711411243e-06
TBLA0E037902.241ON5502351233e-06
Suva_8.3228.723ON6521911243e-06
KAFR0E00140singletonON4384671224e-06
NCAS0A031205.720ON5442481224e-06
NCAS0B004908.723ON6642201234e-06
TDEL0C045802.241ON5571301216e-06
TDEL0F039908.272ON6311191217e-06
YHR048W (YHK8)5.284ON5141481208e-06
KNAG0I030804.30ON5924701199e-06
ZYRO0E10054gsingletonON6285381191e-05
YIL121W (QDR2)2.241ON5421341191e-05
ZYRO0A01474g2.242ON5383331181e-05
CAGL0G08624g2.242ON5832481172e-05
Kwal_23.4803singletonON5414291162e-05
KNAG0E01160singletonON5721301162e-05
TBLA0B035508.723ON2171801122e-05
SAKL0G10758g5.284ON5331351153e-05
Smik_9.492.242ON5421341135e-05
Smik_9.482.241ON5911341136e-05
KLTH0H09856gsingletonON5494351126e-05
YLL028W (TPO1)4.30ON5864461127e-05
YIL120W (QDR1)2.242ON5631691127e-05
Kpol_1003.112.241ON5811431118e-05
Kwal_23.48142.241ON5291171111e-04
YOR273C (TPO4)8.723ON6592371111e-04
SAKL0H25498g4.30ON6025201101e-04
TBLA0E02500singletonON5764321082e-04
TPHA0F003304.30ON5841911082e-04
SAKL0B12628gsingletonON5372111072e-04
SAKL0A08228gsingletonON5691311073e-04
TBLA0E015104.30ON6711851083e-04
KAFR0A041208.723ON5915591073e-04
TBLA0D011608.723ON6421911073e-04
NCAS0C036002.242ON5721401064e-04
ZYRO0F02090gsingletonON6012221064e-04
SAKL0H05412g8.723ON5802071064e-04
Ecym_42988.272ON6781141064e-04
KAFR0D05140singletonON5741991055e-04
TBLA0G025502.242ON6131291055e-04
ZYRO0C01430g8.272ON5901641046e-04
KLTH0G09350g2.241ON5631211047e-04
Suva_9.712.241ON5611671047e-04
Kpol_543.448.272ON6431321030.001
KLLA0A04631g8.272ON5791301010.001
Kwal_56.237548.272ON5891721000.002
KLTH0C10120gsingletonON6511441000.002
NCAS0B064802.241ON5871411000.002
KNAG0E01170singletonON573130990.002
TBLA0E038002.242ON608155990.003
TBLA0F030408.272ON906133990.003
TPHA0A017508.272ON636141980.003
ZYRO0D11088g5.469ON538129980.003
CAGL0G03927g4.30ON567469980.004
KAFR0J016202.242ON570130970.004
CAGL0B02079gna 8ON624145960.006
Kpol_478.34.30ON580137960.006
ZYRO0B00990g4.30ON592229950.007
YPR198W (SGE1)singletonON543163940.011
KLLA0D19941gsingletonON611121940.011
KLLA0E09879gsingletonON630118940.012
TDEL0G03260singletonON612148930.012
Skud_4.3798.272ON759131920.021
NDAI0A043605.469ON544130910.022
SAKL0C05588gsingletonON677120910.024
SAKL0E08778g2.241ON600129910.027
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_7258
         (638 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}...  1181   0.0  
AGL069C Chr7 complement(578235..580019) [1785 bp, 594 aa] {ON} N...   772   0.0  
KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {...   641   0.0  
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...   641   0.0  
Suva_15.426 Chr15 complement(752324..753946) [1623 bp, 540 aa] {...   207   1e-58
Kwal_33.15241 s33 complement(1027827..1029569) [1743 bp, 580 aa]...   170   6e-45
Skud_14.391 Chr14 complement(696469..698223) [1755 bp, 584 aa] {...   168   4e-44
Suva_14.414 Chr14 complement(713179..714927) [1749 bp, 582 aa] {...   166   1e-43
KLLA0D12606g Chr4 complement(1068516..1070297) [1782 bp, 593 aa]...   166   2e-43
TDEL0H00160 Chr8 complement(16735..18462) [1728 bp, 575 aa] {ON}      163   2e-42
YNR055C Chr14 complement(728426..730186) [1761 bp, 586 aa] {ON} ...   159   3e-41
Smik_14.389 Chr14 complement(685196..686956) [1761 bp, 586 aa] {...   157   3e-40
ZYRO0E02288g Chr5 complement(171852..173489) [1638 bp, 545 aa] {...   155   6e-40
KLLA0E09637g Chr5 (853845..855602) [1758 bp, 585 aa] {ON} highly...   155   8e-40
SAKL0G12232g Chr7 (1042473..1044263) [1791 bp, 596 aa] {ON} high...   155   9e-40
SAKL0G12254g Chr7 (1044636..1046381) [1746 bp, 581 aa] {ON} high...   148   4e-37
KLTH0B02816g Chr2 (219220..220971) [1752 bp, 583 aa] {ON} highly...   147   7e-37
KLTH0E00132g Chr5 (3262..5010) [1749 bp, 582 aa] {ON} weakly sim...   146   2e-36
KLTH0A00440g Chr1 (37100..38848) [1749 bp, 582 aa] {ON} weakly s...   146   2e-36
Ecym_2679 Chr2 complement(1313694..1315403) [1710 bp, 569 aa] {O...   145   3e-36
Ecym_5082 Chr5 (178458..180182) [1725 bp, 574 aa] {ON} similar t...   142   2e-35
SAKL0D02508g Chr4 (197981..199720) [1740 bp, 579 aa] {ON} simila...   142   2e-35
ADR336C Chr4 complement(1299394..1301100) [1707 bp, 568 aa] {ON}...   139   2e-34
ADR337C Chr4 complement(1301383..1303095) [1713 bp, 570 aa] {ON}...   139   4e-34
TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.2...   130   5e-31
KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} simila...   128   3e-30
ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} simila...   124   4e-29
Ecym_4506 Chr4 complement(1013521..1015467) [1947 bp, 648 aa] {O...   110   2e-24
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...   108   5e-24
NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570    102   5e-22
ZYRO0F14652g Chr6 complement(1207106..1208806) [1701 bp, 566 aa]...    99   8e-21
Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON} (1178...    98   1e-20
KAFR0I00710 Chr9 (139612..141339) [1728 bp, 575 aa] {ON} Anc_8.5...    97   2e-20
Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138...    97   3e-20
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    96   7e-20
Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W ...    94   2e-19
TPHA0E03200 Chr5 complement(677352..679232) [1881 bp, 626 aa] {O...    93   5e-19
Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]...    92   1e-18
CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} simil...    89   9e-18
KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]...    89   1e-17
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    87   4e-17
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    87   4e-17
AGR195W Chr7 (1120597..1122456) [1860 bp, 619 aa] {ON} Syntenic ...    85   2e-16
Skud_2.306 Chr2 (557166..558884) [1719 bp, 572 aa] {ON} YBR180W ...    84   2e-16
YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putati...    84   2e-16
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    84   3e-16
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    84   5e-16
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    81   2e-15
ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} simila...    82   2e-15
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    80   4e-15
ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} simi...    79   1e-14
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    79   1e-14
KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.5...    79   1e-14
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    78   2e-14
TDEL0A05130 Chr1 complement(910315..912114) [1800 bp, 599 aa] {O...    78   2e-14
Smik_2.320 Chr2 (575945..577663) [1719 bp, 572 aa] {ON} YBR180W ...    77   4e-14
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    77   5e-14
ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} simila...    77   5e-14
ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} simila...    77   6e-14
Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W ...    76   7e-14
NDAI0C05670 Chr3 complement(1310115..1311617) [1503 bp, 500 aa] ...    76   8e-14
Skud_2.121 Chr2 complement(233273..234913) [1641 bp, 546 aa] {ON...    76   8e-14
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    76   9e-14
Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON} (29969....    76   1e-13
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    75   1e-13
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    75   2e-13
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    75   2e-13
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    75   2e-13
CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly ...    74   4e-13
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    74   4e-13
Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048...    74   6e-13
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    74   6e-13
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    74   6e-13
CAGL0H06017g Chr8 complement(588556..590229) [1674 bp, 557 aa] {...    74   6e-13
Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W ...    73   7e-13
KLTH0C08074g Chr3 (688367..690295) [1929 bp, 642 aa] {ON} simila...    74   8e-13
TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa] ...    73   8e-13
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    73   1e-12
SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]...    73   1e-12
NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON} Anc_5...    72   1e-12
Smik_2.161 Chr2 complement(302754..304823) [2070 bp, 689 aa] {ON...    73   1e-12
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    72   1e-12
TBLA0E02520 Chr5 complement(632027..633718) [1692 bp, 563 aa] {O...    72   2e-12
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    72   2e-12
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    72   2e-12
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    72   2e-12
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               72   2e-12
Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {...    72   3e-12
KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {...    72   3e-12
Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON...    72   3e-12
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    71   4e-12
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    71   4e-12
TDEL0D06500 Chr4 (1166063..1167691) [1629 bp, 542 aa] {ON}             71   4e-12
YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}  ...    71   5e-12
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    70   7e-12
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    70   8e-12
Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON...    70   8e-12
KAFR0K00100 Chr11 complement(10324..11913) [1590 bp, 529 aa] {ON}      70   9e-12
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    70   1e-11
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    69   2e-11
TDEL0F01670 Chr6 complement(309067..310815) [1749 bp, 582 aa] {O...    69   3e-11
KAFR0J00480 Chr10 (84206..85708) [1503 bp, 500 aa] {ON} Anc_5.28...    68   3e-11
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    69   3e-11
KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {O...    67   5e-11
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    67   6e-11
Ecym_6229 Chr6 complement(427712..429415) [1704 bp, 567 aa] {ON}...    67   7e-11
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    67   1e-10
KLLA0F18106g Chr6 (1657556..1659325) [1770 bp, 589 aa] {ON} simi...    66   1e-10
KAFR0K00150 Chr11 complement(37495..39087) [1593 bp, 530 aa] {ON}      66   1e-10
Suva_8.420 Chr8 (755472..757112) [1641 bp, 546 aa] {ON} YBR008C ...    66   1e-10
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    66   1e-10
TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON}             66   2e-10
ZYRO0A13618g Chr1 (1083024..1084613) [1590 bp, 529 aa] {ON} simi...    66   2e-10
YBR008C Chr2 complement(252563..254209) [1647 bp, 548 aa] {ON}  ...    65   2e-10
ZYRO0B16808g Chr2 (1368857..1370446) [1590 bp, 529 aa] {ON} simi...    65   3e-10
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    65   3e-10
Skud_15.531 Chr15 (957329..958948) [1620 bp, 539 aa] {ON} YBR008...    65   3e-10
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    64   5e-10
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    64   5e-10
AER339C Chr5 complement(1259842..1261563) [1722 bp, 573 aa] {ON}...    64   5e-10
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    64   6e-10
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    64   7e-10
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    63   1e-09
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    63   2e-09
TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON}               62   3e-09
Kpol_2002.86 s2002 (201096..203006) [1911 bp, 636 aa] {ON} (2010...    62   3e-09
KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON}               62   3e-09
NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa] ...    62   3e-09
KNAG0F03480 Chr6 complement(657351..658997) [1647 bp, 548 aa] {O...    61   4e-09
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     62   4e-09
Ecym_7063 Chr7 complement(130980..132842) [1863 bp, 620 aa] {ON}...    61   5e-09
Kpol_1057.25 s1057 (56904..58550) [1647 bp, 548 aa] {ON} (56904....    60   9e-09
TPHA0O02010 Chr15 complement(410334..412022) [1689 bp, 562 aa] {...    60   9e-09
CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {...    60   9e-09
TPHA0A00130 Chr1 complement(10942..12645) [1704 bp, 567 aa] {ON}       59   2e-08
Kpol_358.7 s358 complement(24674..26041) [1368 bp, 455 aa] {ON} ...    59   2e-08
TPHA0G01430 Chr7 (292540..294453) [1914 bp, 637 aa] {ON} Anc_8.7...    59   2e-08
ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON...    59   2e-08
Kpol_1018.195 s1018 (493001..494647) [1647 bp, 548 aa] {ON} (493...    59   3e-08
TDEL0E04480 Chr5 complement(836068..837918) [1851 bp, 616 aa] {O...    59   3e-08
TBLA0A04260 Chr1 (1055087..1056790) [1704 bp, 567 aa] {ON}             58   4e-08
KAFR0B00180 Chr2 complement(43943..45535) [1593 bp, 530 aa] {ON}       58   4e-08
Kwal_55.19590 s55 complement(38363..39964) [1602 bp, 533 aa] {ON...    58   4e-08
ZYRO0E09988g Chr5 (796142..797788) [1647 bp, 548 aa] {ON} simila...    58   4e-08
ZYRO0G16302g Chr7 complement(1336890..1338533) [1644 bp, 547 aa]...    57   6e-08
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    58   6e-08
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    57   7e-08
TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON}             57   7e-08
Suva_10.43 Chr10 (89159..90922) [1764 bp, 587 aa] {ON} YLL028W (...    57   7e-08
CAGL0H06039g Chr8 complement(592526..594295) [1770 bp, 589 aa] {...    57   8e-08
CAGL0L10912g Chr12 complement(1167086..1169041) [1956 bp, 651 aa...    57   9e-08
Skud_3.178 Chr3 complement(290523..291692) [1170 bp, 389 aa] {ON...    56   1e-07
Kpol_1044.21 s1044 (47355..49118) [1764 bp, 587 aa] {ON} (47355....    57   1e-07
Kpol_1018.193 s1018 (487656..487952,487955..487999,488002..48916...    57   1e-07
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    57   1e-07
NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {O...    56   2e-07
ZYRO0E09966g Chr5 (793128..794813) [1686 bp, 561 aa] {ON} simila...    56   2e-07
TPHA0K02160 Chr11 complement(461256..463082) [1827 bp, 608 aa] {...    56   2e-07
NDAI0A07730 Chr1 complement(1777435..1779102) [1668 bp, 555 aa] ...    56   2e-07
Smik_2.128 Chr2 complement(240029..241672) [1644 bp, 547 aa] {ON...    56   2e-07
TBLA0C07220 Chr3 (1750032..1751870) [1839 bp, 612 aa] {ON}             56   2e-07
Skud_15.438 Chr15 complement(773226..775205) [1980 bp, 659 aa] {...    56   2e-07
Smik_15.455 Chr15 complement(784048..786027) [1980 bp, 659 aa] {...    56   2e-07
TDEL0A06670 Chr1 complement(1163596..1165473) [1878 bp, 625 aa] ...    56   2e-07
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    55   3e-07
KLTH0E00528g Chr5 complement(54185..55843) [1659 bp, 552 aa] {ON...    55   3e-07
KAFR0F04390 Chr6 (860978..862681) [1704 bp, 567 aa] {ON} Anc_4.3...    55   4e-07
ZYRO0E09900g Chr5 (786545..788164) [1620 bp, 539 aa] {ON} simila...    55   4e-07
Kwal_26.8985 s26 complement(1029923..1031665) [1743 bp, 580 aa] ...    55   4e-07
KLTH0D12320g Chr4 complement(1001954..1003720) [1767 bp, 588 aa]...    55   4e-07
TPHA0I03320 Chr9 (737136..738824) [1689 bp, 562 aa] {ON}               55   5e-07
Smik_12.27 Chr12 (69102..70865) [1764 bp, 587 aa] {ON} YLL028W (...    55   5e-07
TBLA0A10350 Chr1 (2550231..2551796) [1566 bp, 521 aa] {ON} Anc_5...    54   6e-07
Kpol_413.2 s413 complement(4040..6043) [2004 bp, 667 aa] {ON} co...    55   6e-07
KLTH0E06138g Chr5 (558501..560345) [1845 bp, 614 aa] {ON} simila...    54   7e-07
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    54   7e-07
Skud_12.38 Chr12 (75867..77630) [1764 bp, 587 aa] {ON} YLL028W (...    54   7e-07
KNAG0G02830 Chr7 complement(625263..627296) [2034 bp, 677 aa] {O...    54   9e-07
Kwal_55.20686 s55 (517314..519155) [1842 bp, 613 aa] {ON} YLL028...    54   1e-06
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    54   1e-06
ZYRO0E09922g Chr5 (788952..790643) [1692 bp, 563 aa] {ON} simila...    54   1e-06
KLTH0G06754g Chr7 (541019..542461) [1443 bp, 480 aa] {ON} simila...    53   1e-06
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    53   1e-06
Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W (...    53   2e-06
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    52   3e-06
TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.2...    52   3e-06
Suva_8.322 Chr8 complement(573995..575953) [1959 bp, 652 aa] {ON...    52   3e-06
KAFR0E00140 Chr5 complement(25875..27191) [1317 bp, 438 aa] {ON}       52   4e-06
NCAS0A03120 Chr1 (611490..613124) [1635 bp, 544 aa] {ON}               52   4e-06
NCAS0B00490 Chr2 complement(71160..73154) [1995 bp, 664 aa] {ON}...    52   4e-06
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    51   6e-06
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    51   7e-06
YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presum...    51   8e-06
KNAG0I03080 Chr9 (617011..618789) [1779 bp, 592 aa] {ON} Anc_4.3...    50   9e-06
ZYRO0E10054g Chr5 complement(804765..806651) [1887 bp, 628 aa] {...    50   1e-05
YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multid...    50   1e-05
ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} simila...    50   1e-05
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    50   2e-05
Kwal_23.4803 s23 complement(875449..877074) [1626 bp, 541 aa] {O...    49   2e-05
KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON}               49   2e-05
TBLA0B03550 Chr2 (824481..825134) [654 bp, 217 aa] {ON} Anc_8.72...    48   2e-05
SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} simila...    49   3e-05
Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W (...    48   5e-05
Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W (...    48   6e-05
KLTH0H09856g Chr8 (848950..850599) [1650 bp, 549 aa] {ON} simila...    48   6e-05
YLL028W Chr12 (84804..86564) [1761 bp, 586 aa] {ON}  TPO1Polyami...    48   7e-05
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    48   7e-05
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    47   8e-05
Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W...    47   1e-04
YOR273C Chr15 complement(834452..836431) [1980 bp, 659 aa] {ON} ...    47   1e-04
SAKL0H25498g Chr8 complement(2229233..2231041) [1809 bp, 602 aa]...    47   1e-04
TBLA0E02500 Chr5 (628027..629757) [1731 bp, 576 aa] {ON}               46   2e-04
TPHA0F00330 Chr6 (67642..69396) [1755 bp, 584 aa] {ON} Anc_4.30 ...    46   2e-04
SAKL0B12628g Chr2 complement(1091243..1092856) [1614 bp, 537 aa]...    46   2e-04
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    46   3e-04
TBLA0E01510 Chr5 (346010..348025) [2016 bp, 671 aa] {ON} Anc_4.3...    46   3e-04
KAFR0A04120 Chr1 complement(828182..829957) [1776 bp, 591 aa] {O...    46   3e-04
TBLA0D01160 Chr4 (296153..298081) [1929 bp, 642 aa] {ON} Anc_8.7...    46   3e-04
NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {O...    45   4e-04
ZYRO0F02090g Chr6 complement(169045..170850) [1806 bp, 601 aa] {...    45   4e-04
SAKL0H05412g Chr8 (486897..488639) [1743 bp, 580 aa] {ON} simila...    45   4e-04
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    45   4e-04
KAFR0D05140 Chr4 (1010805..1012529) [1725 bp, 574 aa] {ON}             45   5e-04
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    45   5e-04
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    45   6e-04
KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} simila...    45   7e-04
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    45   7e-04
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    44   0.001
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    44   0.001
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    43   0.002
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    43   0.002
NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa] ...    43   0.002
KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON}               43   0.002
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    43   0.003
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    43   0.003
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    42   0.003
ZYRO0D11088g Chr4 complement(937064..938680) [1617 bp, 538 aa] {...    42   0.003
CAGL0G03927g Chr7 complement(372896..374599) [1704 bp, 567 aa] {...    42   0.004
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    42   0.004
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    42   0.006
Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON} (12238..13...    42   0.006
ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON...    41   0.007
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    41   0.011
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    41   0.011
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    41   0.012
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               40   0.012
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...    40   0.021
NDAI0A04360 Chr1 (981092..982726) [1635 bp, 544 aa] {ON} Anc_5.469     40   0.022
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    40   0.024
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    40   0.027
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    39   0.027
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    39   0.030
Smik_3.206 Chr3 complement(303825..304154) [330 bp, 109 aa] {ON}...    37   0.031
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    39   0.032
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    39   0.032
TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.2...    39   0.036
Klac_YGOB_Anc_2.241 Chr6 (309169..310257,310260..310979) [1809 b...    39   0.037
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     39   0.042
TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4...    39   0.044
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    39   0.054
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    39   0.055
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    39   0.057
TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possi...    39   0.057
ZYRO0G21648g Chr7 complement(1783532..1784998) [1467 bp, 488 aa]...    38   0.062
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    38   0.080
AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON} Syn...    38   0.081
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    38   0.086
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    38   0.098
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    38   0.10 
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...    37   0.13 
YDR387C Chr4 complement(1248154..1249821) [1668 bp, 555 aa] {ON}...    37   0.14 
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    37   0.14 
TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON}               37   0.14 
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    37   0.14 
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    37   0.14 
TBLA0J00100 Chr10 complement(1866..3590) [1725 bp, 574 aa] {ON}        37   0.14 
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    37   0.15 
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    37   0.17 
SAKL0B12540g Chr2 complement(1075772..1077490) [1719 bp, 572 aa]...    37   0.17 
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     37   0.17 
Smik_3.207 Chr3 complement(304199..304828) [630 bp, 209 aa] {ON}...    36   0.18 
Ecym_6024 Chr6 (43495..44964) [1470 bp, 489 aa] {ON} similar to ...    37   0.19 
KNAG0I01800 Chr9 complement(354341..355630) [1290 bp, 429 aa] {O...    37   0.20 
SAKL0F02178g Chr6 complement(187479..189050) [1572 bp, 523 aa] {...    37   0.20 
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...    37   0.22 
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    37   0.23 
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    37   0.23 
TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa] ...    36   0.25 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    36   0.25 
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               36   0.25 
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    36   0.28 
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    36   0.31 
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}               36   0.31 
KAFR0D00800 Chr4 complement(170100..171776) [1677 bp, 558 aa] {O...    36   0.31 
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               36   0.38 
KLTH0B00330g Chr2 (29891..31591) [1701 bp, 566 aa] {ON} highly s...    36   0.39 
KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {...    35   0.43 
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    35   0.43 
KNAG0C03990 Chr3 (786172..788541) [2370 bp, 789 aa] {ON} Anc_7.3...    35   0.47 
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    35   0.52 
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...    35   0.52 
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    35   0.53 
TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa] ...    35   0.55 
TDEL0C00150 Chr3 (14725..16305) [1581 bp, 526 aa] {ON}                 35   0.60 
SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {...    35   0.60 
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               35   0.61 
Ecym_1317 Chr1 complement(643844..645484) [1641 bp, 546 aa] {ON}...    35   0.63 
Smik_4.657 Chr4 complement(1168668..1170332) [1665 bp, 554 aa] {...    35   0.67 
Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {...    35   0.72 
KLLA0A03223g Chr1 (290002..292035) [2034 bp, 677 aa] {ON} simila...    35   0.78 
Skud_4.660 Chr4 complement(1168794..1170461) [1668 bp, 555 aa] {...    35   0.78 
KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weak...    35   0.87 
KAFR0B01080 Chr2 (204541..206721) [2181 bp, 726 aa] {ON} Anc_7.3...    34   1.1  
KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {O...    34   1.1  
TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.8...    34   1.2  
AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON} Unc...    34   1.2  
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    34   1.2  
Smik_5.14 Chr5 (18370..20214) [1845 bp, 614 aa] {ON} YDL247W (REAL)    34   1.2  
CAGL0M01672g Chr13 (186088..187731) [1644 bp, 547 aa] {ON} simil...    34   1.3  
KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} high...    34   1.4  
YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}...    34   1.4  
Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W (...    34   1.5  
KLTH0G02024g Chr7 complement(156778..158406) [1629 bp, 542 aa] {...    34   1.5  
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...    34   1.5  
KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON}               34   1.6  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    34   1.6  
Suva_2.562 Chr2 complement(999213..1000880) [1668 bp, 555 aa] {O...    34   1.6  
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 34   1.6  
SAKL0G07480g Chr7 complement(621035..622549) [1515 bp, 504 aa] {...    33   1.7  
ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conser...    33   1.9  
ZYRO0E03916g Chr5 complement(296502..298217) [1716 bp, 571 aa] {...    33   2.0  
AAR192C Chr1 complement(686882..688384) [1503 bp, 500 aa] {ON} N...    33   2.0  
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...    33   2.0  
YDL247W Chr4 (5985..7814) [1830 bp, 609 aa] {ON}  MPH2Alpha-gluc...    33   2.1  
TDEL0C05800 Chr3 complement(1047254..1048144) [891 bp, 296 aa] {...    33   2.1  
TDEL0C06990 Chr3 complement(1271111..1272001) [891 bp, 296 aa] {...    33   2.1  
NDAI0G04470 Chr7 complement(1071044..1072729) [1686 bp, 561 aa] ...    33   2.1  
TBLA0H00750 Chr8 (171288..172742) [1455 bp, 484 aa] {ON} Anc_2.2...    33   2.1  
YJR160C Chr10 complement(738008..739816) [1809 bp, 602 aa] {ON} ...    33   2.1  
TDEL0E02280 Chr5 (438756..440519) [1764 bp, 587 aa] {ON} Anc_5.3...    33   2.3  
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    33   2.3  
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    33   2.5  
TDEL0E02310 Chr5 (450790..452493) [1704 bp, 567 aa] {ON} Anc_5.3...    33   2.6  
Suva_37.1 Chr37 complement(3..797) [795 bp, 265 aa] {ON} YFL011W...    33   2.6  
KLTH0E10406g Chr5 (938423..940624) [2202 bp, 733 aa] {ON} weakly...    33   2.6  
NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {O...    33   2.7  
NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {O...    33   2.9  
Suva_9.197 Chr9 (326927..327796) [870 bp, 289 aa] {ON} YFL011W (...    32   3.0  
KLTH0G19404g Chr7 (1672150..1673691) [1542 bp, 513 aa] {ON} weak...    33   3.1  
KLTH0D00484g Chr4 complement(44278..45819) [1542 bp, 513 aa] {ON...    33   3.1  
KNAG0C04620 Chr3 complement(906275..907915) [1641 bp, 546 aa] {O...    33   3.1  
AFL204C Chr6 complement(51587..53194) [1608 bp, 535 aa] {ON} Unc...    33   3.2  
TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {O...    33   3.3  
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    33   3.3  
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    33   3.3  
NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {O...    33   3.4  
NDAI0A02890 Chr1 (648510..651236) [2727 bp, 908 aa] {ON}               33   3.4  
Kwal_56.24841 s56 complement(1167890..1169425) [1536 bp, 511 aa]...    33   3.4  
YOL156W Chr15 (25273..26976) [1704 bp, 567 aa] {ON}  HXT11Putati...    33   3.4  
TBLA0A07970 Chr1 (1971258..1972760) [1503 bp, 500 aa] {ON} Anc_5...    32   3.8  
YFL011W Chr6 (112345..113985) [1641 bp, 546 aa] {ON}  HXT10Putat...    32   3.8  
KAFR0L01310 Chr12 complement(241337..243691) [2355 bp, 784 aa] {...    33   3.8  
Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345...    32   3.9  
TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.3...    32   3.9  
KLTH0F15136g Chr6 (1240733..1242346) [1614 bp, 537 aa] {ON} simi...    32   4.0  
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...    32   4.0  
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...    32   4.0  
NCAS0D03450 Chr4 complement(644151..645587) [1437 bp, 478 aa] {O...    32   4.1  
SAKL0H12518g Chr8 complement(1064480..1066672) [2193 bp, 730 aa]...    32   4.3  
KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly...    32   4.5  
Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094...    32   5.0  
KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {...    32   5.1  
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...    32   5.3  
ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly s...    32   5.6  
TBLA0A03420 Chr1 (824716..826449) [1734 bp, 577 aa] {ON}               32   5.7  
Skud_7.639 Chr7 complement(1062313..1064163) [1851 bp, 616 aa] {...    32   5.9  
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    32   6.0  
NDAI0F02060 Chr6 complement(505217..506725) [1509 bp, 502 aa] {O...    32   6.2  
SAKL0G14938g Chr7 (1282084..1283880) [1797 bp, 598 aa] {ON} simi...    32   6.2  
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)     32   6.2  
KLLA0E16259g Chr5 complement(1450546..1452348) [1803 bp, 600 aa]...    32   6.3  
NCAS0E03740 Chr5 complement(733564..736194) [2631 bp, 876 aa] {O...    32   6.9  
Skud_96.1 Chr96 (1..624) [624 bp, 208 aa] {ON} YOL156W (REAL)          31   7.1  
Kwal_55.20064 s55 (235602..236315) [714 bp, 238 aa] {ON} YHR094C...    31   7.2  
TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {O...    32   7.5  
NCAS0E01550 Chr5 (291758..293392) [1635 bp, 544 aa] {ON} Anc_8.22      32   7.6  
Kwal_47.18976 s47 (1049766..1051370) [1605 bp, 534 aa] {ON} YKL2...    32   7.6  
TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa] ...    32   7.9  
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    32   8.2  
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...    32   8.4  
TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa] ...    32   8.4  
NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa] ...    31   8.6  
KLTH0E03146g Chr5 (283871..285379) [1509 bp, 502 aa] {ON} conser...    31   8.9  
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        31   9.0  
Smik_12.140 Chr12 (270030..271751) [1722 bp, 573 aa] {ON} YLR081...    31   9.4  
Ecym_1319 Chr1 complement(649182..650789) [1608 bp, 535 aa] {ON}...    31   9.6  
Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {...    31   9.8  
Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W (...    31   10.0 

>Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}
           similar to Ashbya gossypii AGL069C
          Length = 638

 Score = 1181 bits (3056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/638 (91%), Positives = 583/638 (91%)

Query: 1   MVVSFLGIVQPGSEDHGLPELNVPGTFAMMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MVVSFLGIVQPGSEDHGLPELNVPGTFAMMQ                             
Sbjct: 1   MVVSFLGIVQPGSEDHGLPELNVPGTFAMMQKGVDEVSVSVVKEDSGVDAGCGVAASGSR 60

Query: 61  XXXXXXXXXXXXDMKGQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVC 120
                       DMKGQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVC
Sbjct: 61  CSSVSGSSPLDSDMKGQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVC 120

Query: 121 VGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGK 180
           VGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGK
Sbjct: 121 VGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGK 180

Query: 181 RLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAY 240
           RLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAY
Sbjct: 181 RLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAY 240

Query: 241 RLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTP 300
           RLGIYT              SLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTP
Sbjct: 241 RLGIYTLLLLGGKNLVPLLGSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTP 300

Query: 301 VPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEA 360
           VPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEA
Sbjct: 301 VPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEA 360

Query: 361 ETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYA 420
           ETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYA
Sbjct: 361 ETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYA 420

Query: 421 VVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNH 480
           VVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNH
Sbjct: 421 VVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNH 480

Query: 481 GIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITY 540
           GIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITY
Sbjct: 481 GIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITY 540

Query: 541 AVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIP 600
           AVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIP
Sbjct: 541 AVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIP 600

Query: 601 LYRWGKLCRSWTNRKNLLQFSYRVNDDGKDEKDNHTER 638
           LYRWGKLCRSWTNRKNLLQFSYRVNDDGKDEKDNHTER
Sbjct: 601 LYRWGKLCRSWTNRKNLLQFSYRVNDDGKDEKDNHTER 638

>AGL069C Chr7 complement(578235..580019) [1785 bp, 594 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YNR055C
           (HOL1)
          Length = 594

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/623 (63%), Positives = 461/623 (73%), Gaps = 41/623 (6%)

Query: 3   VSFLGIVQPGS---EDHGLPELNVPGTFAMMQXXXXXXXXXXXXXXXXXXXXXXXXXXXX 59
           + FLGIVQP S   E   LP L+V GTFAM +                            
Sbjct: 1   MGFLGIVQPRSGDGESQELPTLDVTGTFAMTREAVEAMRH-------------------- 40

Query: 60  XXXXXXXXXXXXXDMKGQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALV 119
                           G ++G  D  L++TKKGI+LNPQPS+  +DPLNWPIWRRD+ALV
Sbjct: 41  ---------------AGHDTGVDD--LQRTKKGIVLNPQPSKHTRDPLNWPIWRRDLALV 83

Query: 120 CVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFG 179
           CVGWHCFVGGGQTSMLA+GFSKLSAEL VP+SQ+S+LVGPMML+L +GS+ ASPTAVLFG
Sbjct: 84  CVGWHCFVGGGQTSMLAAGFSKLSAELHVPISQVSFLVGPMMLALAIGSVVASPTAVLFG 143

Query: 180 KRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERA 239
           KR+VYL+GILIF+ GSIGCA S SF  LLI R+VSGFGLSTVESLPSATIAEIYFAHERA
Sbjct: 144 KRMVYLMGILIFLGGSIGCALSNSFASLLIFRMVSGFGLSTVESLPSATIAEIYFAHERA 203

Query: 240 YRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRT 299
           YRLG+YT              SLVFE+L+THWLFWILTIIAG NFVLHLLFVPETFWDRT
Sbjct: 204 YRLGLYTLLLLGGKNLVPLLGSLVFENLTTHWLFWILTIIAGVNFVLHLLFVPETFWDRT 263

Query: 300 PVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQE 359
           PVPN+RSL ET IAR+ + +  N+S  T        +    H+  D  P  L D+ N   
Sbjct: 264 PVPNERSLEETIIARETQAVVCNLSHRTPSLGESTSQSEDDHIGKDP-PKQLYDQKNDDA 322

Query: 360 AETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAY 419
            E  S+ R+HI S+++  +  GLGI+HGRHT+D W MV+LRPFVL SYPA+L GA +YA+
Sbjct: 323 TEAPSRIRSHINSMTQSHLTTGLGIFHGRHTMDKWRMVLLRPFVLCSYPAVLLGALMYAF 382

Query: 420 AVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHN 479
           AVV LI++SQVIDHAYKD+YGFSSASVGLVYIAPF+GGCLGSL AG+ SD+  R LA  N
Sbjct: 383 AVVFLIMVSQVIDHAYKDLYGFSSASVGLVYIAPFVGGCLGSLCAGKLSDLLVRSLAMRN 442

Query: 480 HGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAIT 539
           HGIYEPEFRLFM +PAV+  A GLLGFG+SL+ Q HWI+P+IFFGVLGFGSSMCSTT IT
Sbjct: 443 HGIYEPEFRLFMAIPAVISTAAGLLGFGFSLKNQAHWIVPTIFFGVLGFGSSMCSTTGIT 502

Query: 540 YAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAI 599
           YAVDSYK F+QE+LVT N+ KN+LGFA SFFNV F L  GY  AF CY +IE+ +G+ AI
Sbjct: 503 YAVDSYKHFAQESLVTFNIFKNVLGFAFSFFNVNFSLQAGYDKAFLCYTVIELVLGVCAI 562

Query: 600 PLYRWGKLCRSWTNRKNLLQFSY 622
            +YRWGKLCRSWT+RK L+QFSY
Sbjct: 563 VIYRWGKLCRSWTDRKALMQFSY 585

>KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {ON}
           weakly similar to uniprot|P53389 Saccharomyces
           cerevisiae YNR055C HOL1 Putative ion transporter similar
           to the major facilitator superfamily of transporters;
           mutations in membrane-spanning domains permit
           nonselective cation uptake
          Length = 611

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/566 (56%), Positives = 402/566 (71%), Gaps = 6/566 (1%)

Query: 76  GQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSML 135
           G ++  +   ++ TKKGIILNPQPS+ K+DPLNWP+WRRD AL  VGWHCFVGGGQTS+L
Sbjct: 43  GDDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSIL 102

Query: 136 ASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGS 195
           A+G   L+ E    LS ISYLVG MML+L +GSI ASP AV+FGKR+VYLVGI+IF  GS
Sbjct: 103 AAGSKGLALEFHRSLSDISYLVGGMMLALALGSIIASPCAVIFGKRIVYLVGIIIFFFGS 162

Query: 196 IGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXX 255
           IGCA S ++  LL SR+VSG G+ST+ESLPSAT+AEIYFAHERAYRLG YT         
Sbjct: 163 IGCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTLLLLGGKNL 222

Query: 256 XXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQ 315
                S VFE+L  HWLFWI+TII G NF+LH+LFVPETFWDRTPVPN+RS+ ET IAR 
Sbjct: 223 VPLLASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARA 282

Query: 316 VRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIK--SI 373
             G + +V+I+   + +    E A  ++    P  L   +  Q     S+ R  IK  +I
Sbjct: 283 ADG-ARDVAISGYSAPKFQGEEDAS-LSKSLSPELLKSVTPTQSHRYLSRVRTKIKCSNI 340

Query: 374 SEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDH 433
           ++  +  GLGI+HGRH++D W MVMLRPFVLF YPA+LFGA+LY+ A+V LI+++Q+I+ 
Sbjct: 341 AQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINT 400

Query: 434 AYKD-IYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMV 492
            Y +  Y FSS  +GLVY++PF+G  LGSL AG  SD   R  A  + GIYEPEFRLFMV
Sbjct: 401 VYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMV 460

Query: 493 LPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEA 552
           LPA L  A+GL+GFGWS +  D WI P+IF GV+GFGSS+ STTAIT+ VDSYK ++QEA
Sbjct: 461 LPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEA 520

Query: 553 LVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWT 612
           LVTLN++KN++GFA SFFN KF +  GYK  F  Y  +E+ + L+AIPLY +GK  R WT
Sbjct: 521 LVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWT 580

Query: 613 NRKNLLQFSY-RVNDDGKDEKDNHTE 637
           + K LL FSY + N       D H E
Sbjct: 581 DSKGLLDFSYVKKNHSRGSTGDRHME 606

>Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {ON}
           YNR055C (HOL1) - Putative ion transporter similar to the
           major facilitator superfamily of transporters [contig
           55] FULL
          Length = 612

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/547 (57%), Positives = 395/547 (72%), Gaps = 17/547 (3%)

Query: 86  LKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAE 145
           ++ TKKGIILNPQPSE  +DPLNWP+WRRDIAL+ VGWHCFVGGGQTS+LA+G   L+ E
Sbjct: 49  MQTTKKGIILNPQPSESMRDPLNWPVWRRDIALLVVGWHCFVGGGQTSILAAGSRSLAEE 108

Query: 146 LQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFN 205
               LS ISYLVG MML+L  GSI ASP+AVLFGKR++YL+GI++F  GSIGC+ S S+ 
Sbjct: 109 FNRSLSDISYLVGGMMLALAFGSIIASPSAVLFGKRILYLIGIIVFFFGSIGCSVSHSYE 168

Query: 206 WLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFE 265
            LL SR+VSG G++T+ESLPSAT+AEIYFAHERAYRLG+YT              SLVF+
Sbjct: 169 SLLASRIVSGLGVATIESLPSATVAEIYFAHERAYRLGVYTLLLLGGKNLVPLLASLVFQ 228

Query: 266 HLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSI 325
            L  +WLFWI+TII G NFVLHL FVPETFWDR PVP++RS+ E+ IAR V         
Sbjct: 229 SLDRYWLFWIVTIIVGINFVLHLFFVPETFWDRAPVPSRRSIQESAIARAVNA------- 281

Query: 326 ATVRSTRLNPRE--SAGHVNDDGVPVGLTDESNAQEAETGSKTR-------AHIKSISEK 376
           A V     N R   S+   +D  +   L  E+  ++ E     R       A   +++  
Sbjct: 282 AEVAGEARNRRSIASSFDYDDSSLTHSLRSEAMQRDTEASQHRRNSNLRPNAATNALARS 341

Query: 377 QMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYK 436
            + +GLG+YHGRHT+D+WCMVMLRPFVLF+YPA+LFGA+LY+ A+V LI+++Q+I+  + 
Sbjct: 342 HLTVGLGLYHGRHTVDSWCMVMLRPFVLFAYPAVLFGAFLYSLAIVWLIMVAQIINTVFA 401

Query: 437 DI-YGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPA 495
           +  Y FS   +GLVYIAPFIG   GS+ AG  SD   RLLA  N G+YEPEFRL M  PA
Sbjct: 402 NAPYKFSPIHIGLVYIAPFIGSIFGSICAGPVSDKMVRLLAKRNCGVYEPEFRLLMTAPA 461

Query: 496 VLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVT 555
            +  A+GL+GFGWS +R D WI P+IF G++GFGSS+ STTAIT+ VDSYK+++QEALVT
Sbjct: 462 GISTALGLMGFGWSAQRGDPWIAPTIFLGIVGFGSSLASTTAITFTVDSYKQYAQEALVT 521

Query: 556 LNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNRK 615
           LN++KN++GFA SFFN +F + EGYK AF  Y  +EIF+ L+AIPLY +GK  R WT+RK
Sbjct: 522 LNVLKNVMGFAFSFFNARFNVEEGYKIAFVVYGSVEIFVCLFAIPLYHYGKRLRHWTDRK 581

Query: 616 NLLQFSY 622
            LL FSY
Sbjct: 582 GLLDFSY 588

>Suva_15.426 Chr15 complement(752324..753946) [1623 bp, 540 aa] {ON}
           YNR055C (REAL)
          Length = 540

 Score =  207 bits (527), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 151/552 (27%), Positives = 262/552 (47%), Gaps = 41/552 (7%)

Query: 73  DMKGQESGGSDDHLKKTK-KGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQ 131
           D +G      D +LKK   K IIL+PQPS+   DPLNW    + +  + +          
Sbjct: 23  DDRGVGEENIDSNLKKAAGKNIILSPQPSDQPDDPLNWSKKIKTLYFIGILLTSVGPAIM 82

Query: 132 TSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIF 191
             +L   F++LS+   VPL+ ++ L G +++SLGV S   +  + ++GKRL++L+  L  
Sbjct: 83  GPLLVPAFNELSSIFDVPLTTVAQLNGGLVMSLGVSSYLCNQLSSIYGKRLLFLLTSLCQ 142

Query: 192 MIGSIGCACSTSFNWLLISRVVSGFGLSTVESLP-SATIAEIYFAHERAYRLGIYTXXXX 250
           ++ +I  ACS SF  L+ +R+  G  +    S   +++IA+++F HERA  +GI++    
Sbjct: 143 VVIAIWGACSKSFRSLIAARIFQGLFMGMSYSAAGTSSIADVFFVHERAKYVGIWSFVLL 202

Query: 251 XXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHET 310
                       V E LS  W F  L I      V H   VPE+ + R          +T
Sbjct: 203 TTNNITPIISGYVIEDLSWKWSFGFLAIYLFVCLVFHFFLVPESAFKR----------DT 252

Query: 311 RIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHI 370
           +     +G+S+  S++                        + D+    +    S++   +
Sbjct: 253 KTEVFYQGVSKAESLS------------------------VHDQKKEYQVSAASESSG-L 287

Query: 371 KSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQV 430
           +   E      L +Y GR +  +   V+ RP+++   P +++G   +      +I+I  V
Sbjct: 288 QDTKEYSFKKSLRVYRGRQSELSLFYVLFRPWLMLQNPIVIWGVLQWCLCYTWVIMIGSV 347

Query: 431 IDHAYK-DIYGFSSASVGLVY-IAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFR 488
               +    Y FS +S G++  +AP IG  +G+L +G  SD     +A  N+G+YEPEFR
Sbjct: 348 ASQMFTAPPYNFSVSSTGVISGVAPLIGTTIGTLASGTISDYLIDFMARKNNGVYEPEFR 407

Query: 489 LFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEF 548
           LFM++P ++   IG  G GW +E    WI  +++  +L  G +   T+ ITY VDS  + 
Sbjct: 408 LFMMIPYMILLLIGGFGTGWQVENGKSWISVAVYLAILFCGVACGVTSIITYTVDSLGDC 467

Query: 549 SQEALVTLNMVKNILGFAVSF-FNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKL 607
           S EA   + +VK+   + + + FN  +    G K+ +   +     + L +IP+Y +GK 
Sbjct: 468 SGEAFGLMMLVKSAFAYGLIWKFNTWYA-ERGAKSVYGIMSGATCAVILLSIPMYIFGKR 526

Query: 608 CRSWTNRKNLLQ 619
            R +  +  + +
Sbjct: 527 GRLYVKQHGIYK 538

>Kwal_33.15241 s33 complement(1027827..1029569) [1743 bp, 580 aa]
           {ON} YNR055C (HOL1) - Putative ion transporter similar
           to the major facilitator superfamily of transporters
           [contig 94] FULL
          Length = 580

 Score =  170 bits (431), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 134/545 (24%), Positives = 235/545 (43%), Gaps = 21/545 (3%)

Query: 83  DDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKL 142
           +  L+KTKK ++L PQPSE   DPLNW + R+ +    + +        ++   +    L
Sbjct: 32  ESSLRKTKKDVVLIPQPSESPNDPLNWSVMRKTLHFALMAFITAFTAATSNDAGAAQYNL 91

Query: 143 SAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACST 202
           + E  +    ++   G + L +G G++F +P A L+G+++ YL+ I + +IG++    ST
Sbjct: 92  NEEYGISYDSMNTGAGVLFLGIGWGTLFLAPLANLYGRKITYLICISLGLIGAVWFGFST 151

Query: 203 SFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSL 262
                + S++  G   S  E+    ++++I+F H+    L +Y                 
Sbjct: 152 RTRDTIWSQLFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYILATSVGTFLGPLIAGY 211

Query: 263 VFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR----TPVPNKRSLHETRIARQVRG 318
           +    S HW+ WI  II+G   ++ L    ET++DR    TPV ++R   E+R     + 
Sbjct: 212 ISSFTSYHWIGWIAAIISGGLLIVILFGCEETYFDRNKYVTPV-SRRPNSESRGTFDSQC 270

Query: 319 LSENVSIATVRSTRLNPRESAGHVND----DGVP--VGLTDESNAQEAETGSKTRAH--I 370
            +  +S +      ++  +    VN     D VP  V    + N  +     K   H  I
Sbjct: 271 CTPLMSSSNNNDEEIDSNKELKKVNQNSTCDIVPSCVASIHDYNLVDGAEERKKPYHKRI 330

Query: 371 KSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQV 430
             I++     G G+      I     + +R   +F +P +      +    V L      
Sbjct: 331 AIITKASNLRGWGVKQYFQYI----ALNMR---MFLFPPVWLSGLFWGIQDVLLTFYLTT 383

Query: 431 ID-HAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRL 489
            D + Y+  + +S   V ++ +   IG  +G + AG  SD     +A  N+GI E E+RL
Sbjct: 384 EDTYFYEPPWNYSDRGVAIMNVPTLIGAVIGCVCAGIVSDYFILWMARRNNGILEAEYRL 443

Query: 490 FMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFS 549
           +      +    GLL FG    RQ  W +  +  G +GF        A+ Y +D Y +  
Sbjct: 444 YFSFATGIIGPAGLLMFGIGAARQLPWQVIYVGLGFIGFSWGCSGDIAMAYLMDCYPDMV 503

Query: 550 QEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCR 609
            E +V   ++ N +    +F    +    G +N +   A+I   I   AIP++ WGK  R
Sbjct: 504 LEGMVCTAIINNTISCIFTFVCSYWLEASGTENTYIALAVINFAITTLAIPMFIWGKKIR 563

Query: 610 SWTNR 614
             T +
Sbjct: 564 KATKK 568

>Skud_14.391 Chr14 complement(696469..698223) [1755 bp, 584 aa] {ON}
           YNR055C (REAL)
          Length = 584

 Score =  168 bits (425), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 133/557 (23%), Positives = 240/557 (43%), Gaps = 23/557 (4%)

Query: 83  DDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKL 142
           +  LKKT  G++L PQPS    DPLNW  WR+      + +        ++   +    L
Sbjct: 32  ESKLKKTTSGVVLIPQPSYSSNDPLNWSAWRKFAHFGLMAFITAFTAATSNDAGAAQDSL 91

Query: 143 SAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACST 202
           +    +    ++   G + L +G  ++F +P A L+G+++ Y+V   + + G++  A + 
Sbjct: 92  NEIYGISYDSMNTGAGVLFLGIGWSTLFLAPFANLYGRKITYIVCTTLGLFGALWFALAK 151

Query: 203 SFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSL 262
             +  + S++  G   S  E+    ++++I+F H+    L +Y                 
Sbjct: 152 RTSDTIWSQLFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYIMCTSIGTFLGPLIAGY 211

Query: 263 VFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR----TPVPNKRSLHETRIARQVRG 318
           +    +  W+ W+  II+G   V+ +L   ET++DR    TP+ + +S +E     Q   
Sbjct: 212 ISAFTNFRWVGWVAVIISGGLLVVIILGCEETYFDRGQYMTPLTSSQSGYEDGTTLQ--- 268

Query: 319 LSENVSIATVRSTRLNPRESA-GHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISE-- 375
            + + ++ + +   L+ + S  G + + GV      E N +E  T  +TR  I    E  
Sbjct: 269 -NSDNTVVSRKKHHLDAKLSTPGAMGEKGVSETAEFEVNNEEEATIPETRELIDGSKEPL 327

Query: 376 ----KQMAIGLGIY----HGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIII 427
               K++AI         +G      +  + LR   +F +P +      +    V L   
Sbjct: 328 KPYQKRIAIFTKATNLKGYGFKQYFKYLKINLR---MFLFPPVWLSGMFWGIQDVFLTFY 384

Query: 428 SQVIDHAYKDI-YGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPE 486
               + AY +  + +S   V ++ +   IG  +G + AG  SD     +A HN GI E E
Sbjct: 385 LTTQESAYYEPPWNYSDFGVAIMNVPTLIGAVIGCICAGIVSDYFVLWMARHNRGILEAE 444

Query: 487 FRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYK 546
           FRL+  +   +    GLL FG    RQ  W    +  G +GF        A+ Y +D Y 
Sbjct: 445 FRLYFSIATAVIGPAGLLMFGIGTARQWPWQAIYVGLGFVGFAWGCSGDIAMAYLMDCYP 504

Query: 547 EFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGK 606
           +   E +V   ++ N +    +F    +    G +N +   A+I   I  +A+P+Y +GK
Sbjct: 505 DMVLEGMVCTAIINNTISCIFTFTCSDWLAASGTENTYIALAVINFGITAFALPMYHYGK 564

Query: 607 LCRSWTNRKNLLQFSYR 623
             R WT +  L   + R
Sbjct: 565 RIRIWTKQWYLESVNLR 581

>Suva_14.414 Chr14 complement(713179..714927) [1749 bp, 582 aa] {ON}
           YNR055C (REAL)
          Length = 582

 Score =  166 bits (421), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 134/549 (24%), Positives = 243/549 (44%), Gaps = 27/549 (4%)

Query: 83  DDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKL 142
           +  LKK   G++L PQPS    DPLNW  WR+      + +        ++   +    L
Sbjct: 32  ESKLKKNPSGVVLIPQPSYSPNDPLNWSGWRKMAHFGLMAFITAFTAATSNDAGAAQDSL 91

Query: 143 SAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACST 202
           +    +  + ++   G + L +G  ++F +P A L+G+++ Y+V I + + G++  A + 
Sbjct: 92  NEIYGISYNSMNTGAGVLFLGIGWSTLFLAPFANLYGRKITYIVCITLGLFGALWFALAK 151

Query: 203 SFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSL 262
             +  + S++  G   S  E+    ++++I+F H+    L +Y                 
Sbjct: 152 RTSDTIWSQLFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYIMCTSIGTFLGPLIAGY 211

Query: 263 VFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR----TPVPNKRSLHE--------- 309
           +  +L+  W+ W+  II+G   V  +L   ET++DR    TP+ +K+S +E         
Sbjct: 212 ISAYLNFRWVGWVAVIISGGLLVAIVLGCEETYFDRGRYMTPLTSKQSGYEDGTTLQNSD 271

Query: 310 -TRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKT-- 366
            T ++++ R L  N+++   R   ++  E+A    ++   V + +    +E   GSK   
Sbjct: 272 NTLVSQKKRHLDANLAM---REKGMDVSETAEFEVNNEEEVTIPE---TRELIDGSKEPL 325

Query: 367 RAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLII 426
           + + K ++    A  L  Y G      +  + LR   +F +P +      +    V L  
Sbjct: 326 KPYPKRVAIFTKATNLKGY-GFKQYFKYLKINLR---MFLFPPVWLSGMFWGIQDVFLSF 381

Query: 427 ISQVIDHAYKDI-YGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEP 485
                + AY D  + +S   V ++ +   IG  +G + AG  SD     +A HN GI E 
Sbjct: 382 YLTTQEDAYYDPPWNYSDFGVAIMNVPTLIGAVIGCICAGIVSDYFVLWMARHNKGILEA 441

Query: 486 EFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSY 545
           EFRL+  +   +    GLL FG    RQ  W    +  G +GF        A+ Y +D Y
Sbjct: 442 EFRLYFSVATAIIGPAGLLMFGIGTARQWPWQAIYVGLGFVGFSWGCSGDIAMAYLMDCY 501

Query: 546 KEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWG 605
            E   E +V   ++ N +    +F    +    G +N +   A+I   I  +A+P+Y +G
Sbjct: 502 PEMVLEGMVCTAIINNTISCIFTFTCSDWLAASGTENTYIALAVINFGITAFALPMYHYG 561

Query: 606 KLCRSWTNR 614
           K  R WT +
Sbjct: 562 KRIRLWTKQ 570

>KLLA0D12606g Chr4 complement(1068516..1070297) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|P53389 Saccharomyces
           cerevisiae YNR055C HOL1 Putative ion transporter similar
           to the major facilitator superfamily of transporters;
           mutations in membrane-spanning domains permit
           nonselective cation uptake
          Length = 593

 Score =  166 bits (420), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 149/555 (26%), Positives = 247/555 (44%), Gaps = 25/555 (4%)

Query: 83  DDHLKKTKKG-IILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSK 141
           D H K  K   I+L P PS+   DPLNW + R+ +AL C   +    G  T+ + S  + 
Sbjct: 26  DGHDKSDKNAKIVLVPTPSDDPDDPLNWEMKRKLLALSCSLVYTLGVGVPTAAIYSVLND 85

Query: 142 LSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACS 201
           +S +  + LSQ++   G + L LG+G     P A+ +GKR VY+  +L   +  +    +
Sbjct: 86  VSIQTGISLSQLNNATGYLFLFLGIGCFVFQPLALQYGKRPVYVFTMLATALICVWPPYT 145

Query: 202 TSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXS 261
            S    + S+VV GF  + +ESLP  T+++++F H+R+  L  Y                
Sbjct: 146 KSKGEWIGSKVVQGFFGAAIESLPEITVSDLFFEHQRSSGLATYGVTLLFASYIAPCIAG 205

Query: 262 LVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSE 321
            + +  S  W+ W   I A    V    F+ ET +DR    + R+     + R    +  
Sbjct: 206 FISDGQSWEWVMWWCAIFAAVCTVFLFFFMEETNYDRKLKIDSRTGQPITMDRHDGTVVS 265

Query: 322 NVSIATVRSTRLNPRESAGHVNDDGVPV----GLT-DESNAQEAETGSKTRAHIKSISEK 376
           NV  AT     L  +E+  H+N D        G+T D  +   +   ++    +  +S  
Sbjct: 266 NVFSATANIDTLLNKEN-NHINVDETSSDSVGGVTGDVPDVLHSVLSAENSNIMNQLSRV 324

Query: 377 QMAIGLGIYHGRHTIDNWCMV---------------MLRPFVLFSYPAILFGAWLYAYAV 421
           ++  G  +   + T   W  +                + PF LF  P IL+  + Y  ++
Sbjct: 325 EVVDGATVQQRKSTKTFWSKLSMTSGAKEKFLLHHYFMAPFYLFGLPGILWAGFFYGQSL 384

Query: 422 V--SLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHN 479
           +  +++  ++V+  A    Y FSS + GL Y +P I   +   + G  SD     +A + 
Sbjct: 385 IWFNVLNATEVLILAAPP-YNFSSTACGLAYFSPLIFSFIVFFLVGTFSDWLKVRIARYR 443

Query: 480 HGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAIT 539
            G+  PE RL+ V+          + +G     + HW       G+LG  S    T + T
Sbjct: 444 GGLSLPEDRLYTVIIYCFIGVAACILWGVGAYYEIHWFGLVFGLGMLGGCSMFGITISTT 503

Query: 540 YAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAI 599
           YA+D YKE   EA+V + +++N++ FAVSF   K+  + G KNAF   A I +   L  +
Sbjct: 504 YAIDCYKELDTEAMVVVIIIRNVMSFAVSFGITKWIENLGLKNAFISAAFILLACNLTFV 563

Query: 600 PLYRWGKLCRSWTNR 614
            +  WG   R+ T  
Sbjct: 564 GMVIWGPGLRNRTKH 578

>TDEL0H00160 Chr8 complement(16735..18462) [1728 bp, 575 aa] {ON} 
          Length = 575

 Score =  163 bits (412), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 129/556 (23%), Positives = 229/556 (41%), Gaps = 45/556 (8%)

Query: 78  ESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLAS 137
           +SG +   LK  K G++L PQPS+   DPLNW  WR+ +    + +        ++   +
Sbjct: 34  KSGSTTGRLKTDKNGVVLIPQPSDSPNDPLNWSKWRKFLHFGLMAFITAFTAATSNDAGA 93

Query: 138 GFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIG 197
               L+    +    ++   G + L +G  ++F +P A L+G+++ YL+  ++ + G++ 
Sbjct: 94  TQDSLNEYYGISYDSMNVGAGVLFLGIGWATLFTAPLASLYGRKITYLICTILGLFGALW 153

Query: 198 CACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXX 257
            A +   +  + S++  G   S  E+   +++ +IYF H+    L +Y            
Sbjct: 154 FALAKRTSDTIWSQLFVGISESCAEAQVQSSLNDIYFQHQMGSILTVYILCTSIGTFLGP 213

Query: 258 XXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVR 317
                +    +  W+ W+  II+G   +  +    ET++DR    NK   + T +     
Sbjct: 214 LIAGYIASLTNFRWVGWVAVIISGGLLIALIFGCEETYFDR----NK---YITPLTYGGN 266

Query: 318 GLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNA--QEAETGSKTRAHIKSISE 375
              ++ +                   DD   VGL +++N   ++A+   ++  H  S   
Sbjct: 267 PFGDDCA-------------------DDRSSVGLNEKANKPIEQADVAGESEVHELSPPA 307

Query: 376 KQMAIG----LGIYHGR-------HTIDNWCMVMLRPFVLFS-----YPAILFGAWLYAY 419
            Q+  G    L  YH R         +  W       FVLF+     YP +      +  
Sbjct: 308 DQLIDGASEKLKPYHKRVALITKGSNLKGWGFKQYPKFVLFNLRMMLYPPVWLSGLFWGI 367

Query: 420 AVVSLIIISQVIDHAYKDI-YGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAH 478
             V L       +  Y D  + +S   V ++ +   IG  +G + AG  SD     +A  
Sbjct: 368 QDVFLTFYLTTEESYYYDPPWNYSDYGVAIMCVPTLIGAVIGCIYAGIVSDYFVLWMARK 427

Query: 479 NHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAI 538
           N+GI E E+RL+           GLL FG   ER   W +  +  G +GF        A+
Sbjct: 428 NNGILEAEYRLYFSFATAFIGPAGLLMFGIGTERALSWQVIYVGLGFIGFSWGCSGDIAM 487

Query: 539 TYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWA 598
            Y +D Y E   E +V   ++ N +    +F    +    G +N +   A+I   I L A
Sbjct: 488 AYLMDCYPEMVLEGMVCTAIINNSISCIFTFVCSDWLSASGTENTYIALAVINFAITLLA 547

Query: 599 IPLYRWGKLCRSWTNR 614
           +P + +GK  R WT +
Sbjct: 548 LPSFIYGKRIRLWTKK 563

>YNR055C Chr14 complement(728426..730186) [1761 bp, 586 aa] {ON}
           HOL1Putative transporter in the major facilitator
           superfamily (DHA1 family) of multidrug resistance
           transporters; mutations in membrane-spanning domains
           permit cation and histidinol uptake
          Length = 586

 Score =  159 bits (403), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 143/568 (25%), Positives = 245/568 (43%), Gaps = 43/568 (7%)

Query: 83  DDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKL 142
           +  LKKT  G++L PQPS    DPLNW  WR+   L   G   F+     +   +  S  
Sbjct: 32  ESKLKKTSSGVVLIPQPSYSPNDPLNWSSWRK---LAHFGLMAFI-----TAFTAATSND 83

Query: 143 SAELQVPLSQI------SYLVGPMMLSLGVG--SIFASPTAVLFGKRLVYLVGILIFMIG 194
           +   Q  L++I      S   G  +L LG+G  ++F +P A L+G+++ Y+V   + + G
Sbjct: 84  AGAAQDSLNEIYGISYDSMNTGAGVLFLGIGWSTLFLAPFANLYGRKITYIVCTTLGLFG 143

Query: 195 SIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXX 254
           ++  A +   +  + S++  G   S  E+    ++++I+F H+    L +Y         
Sbjct: 144 ALWFALAKRTSDTIWSQLFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYIMCTSIGTF 203

Query: 255 XXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR----TPVPNKRSLHET 310
                   +    +  W+ W+  II+G   +  +    ET++DR    TP+ + +S +E 
Sbjct: 204 LGPLIAGYISAFTNFRWVGWVAVIISGGLLITIIFGCEETYFDRGQYMTPLTSCQSGYED 263

Query: 311 RIARQVRGLSENVSIATVRSTRLNPRESA-GHVNDDGVPVGLTDES-----------NAQ 358
               Q    S+N +++  R   L+ + S  G + + GV +  T E              +
Sbjct: 264 GTTLQN---SDNTAVSR-RKRHLDAKLSTPGAMGEKGVDLSETAEFEVNNEEEVTIPETR 319

Query: 359 EAETGSKT--RAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWL 416
           E   GSK   + + K ++    A  L  Y G      +  + LR   +F +P +      
Sbjct: 320 ELIDGSKEHLKPYPKRVAILTKATNLKGY-GFKQYFKYLKINLR---MFLFPPVWLSGMF 375

Query: 417 YAYAVVSLIIISQVIDHAYKDI-YGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLL 475
           +    V L       + AY +  + +S   V ++ +   IG  +G + AG  SD     +
Sbjct: 376 WGIQDVFLTFYLTTQESAYYEPPWNYSDFGVAIMNVPTLIGAVIGCICAGIVSDYFVLWM 435

Query: 476 AAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCST 535
           A HN GI E EFRL+  +   +    GLL FG    RQ  W    +  G +GF       
Sbjct: 436 ARHNRGILEAEFRLYFSIATAIIGPAGLLMFGIGTARQWPWQAIYVGLGFVGFAWGCSGD 495

Query: 536 TAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIG 595
            A+ Y +D Y +   E +V   ++ N +    +F    +    G +N +   A+I   I 
Sbjct: 496 IAMAYLMDCYPDMVLEGMVCTAIINNTISCIFTFTCSDWLAASGTENTYIALAVINFGIT 555

Query: 596 LWAIPLYRWGKLCRSWTNRKNLLQFSYR 623
            +A+P+Y +GK  R WT R  L   + R
Sbjct: 556 AFALPMYYYGKRIRLWTKRWYLQSVNLR 583

>Smik_14.389 Chr14 complement(685196..686956) [1761 bp, 586 aa] {ON}
           YNR055C (REAL)
          Length = 586

 Score =  157 bits (396), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 140/567 (24%), Positives = 240/567 (42%), Gaps = 41/567 (7%)

Query: 83  DDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKL 142
           +  LKK   G+IL PQPS    DPLNW   R+   L   G   F+     +   +  S  
Sbjct: 32  ESKLKKNTSGVILIPQPSYSPNDPLNWSSCRK---LAHFGLMAFI-----TAFTAATSND 83

Query: 143 SAELQVPLSQI------SYLVGPMMLSLGVG--SIFASPTAVLFGKRLVYLVGILIFMIG 194
           +   Q  L++I      S   G  +L LG+G  ++F +P A L+G+++ Y+V   + + G
Sbjct: 84  AGAAQDSLNEIYGISYDSMNTGAGVLFLGIGWSTLFLAPFANLYGRKITYIVCTTLGLFG 143

Query: 195 SIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXX 254
           ++  A +   +  + S++  G   S  E+    ++++I+F H+    L +Y         
Sbjct: 144 ALWFAVAKRTSDTIWSQLFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYIMCTSIGTF 203

Query: 255 XXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR----TPVPNKRSLHET 310
                   +    +  W+ W+  II+G   +  +    ET++DR    TP+   +S +E 
Sbjct: 204 LGPLVAGYISAFTNFRWVGWVAVIISGGLLIAIIFGCEETYFDRGQYMTPLTGCQSGYED 263

Query: 311 RIARQVRGLSENVSIATVRSTRLNPRESA-GHVNDDGVPVGLTDE--SNAQEAETGSKTR 367
               Q    + + ++ + R   L+ + S  G + +    V  T E   N +E  T  +TR
Sbjct: 264 GTTLQ----NSDNTVISRRKRHLDAKLSTPGAIGEKSREVAETAEFEVNNEEEATIPETR 319

Query: 368 AHIKSISE--KQMAIGLGIY--------HGRHTIDNWCMVMLRPFVLFSYPAILFGAWLY 417
             I    E  K     + I+        +G      +  + LR   +F +P +      +
Sbjct: 320 ELIDGSKEPLKSYPKRIAIFTKATNLKGYGFKQYFKYLKINLR---MFLFPPVWLSGMFW 376

Query: 418 AYAVVSLIIISQVIDHAYKDI-YGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLA 476
               V L       + AY D  + +S   V ++ +   IG  +G + AG  SD     +A
Sbjct: 377 GIQDVFLTFYLTTQESAYYDPPWNYSDFKVAIMNVPTVIGAVIGCICAGIVSDYFVLWMA 436

Query: 477 AHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTT 536
            HN GI E EFRL+  +   +    GLL FG    RQ  W    +  G +GF        
Sbjct: 437 RHNRGILEAEFRLYFSIATAIIGPAGLLMFGIGTARQWPWQAIYVGLGFVGFAWGCSGDI 496

Query: 537 AITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGL 596
           A+ Y +D Y +   E +V   ++ N +    +F    +    G +N +   A+I   I  
Sbjct: 497 AMAYLMDCYPDMVLEGMVCTAIINNTISCIFTFTCSDWLAASGTENTYIALAVINFGITA 556

Query: 597 WAIPLYRWGKLCRSWTNRKNLLQFSYR 623
           +A+P+Y +GK  R WT +  L   + R
Sbjct: 557 FALPMYYYGKRVRLWTKQWYLESVNLR 583

>ZYRO0E02288g Chr5 complement(171852..173489) [1638 bp, 545 aa] {ON}
           similar to gnl|GLV|KLLA0D12606g Kluyveromyces lactis
           KLLA0D12606g and some similarities with YNR055C
           uniprot|P53389 Saccharomyces cerevisiae YNR055C HOL1
           Putative ion transporter similar to the major
           facilitator superfamily of transporters; mutations in
           membrane- spanning domains permit nonselective cation
           uptake
          Length = 545

 Score =  155 bits (392), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 132/529 (24%), Positives = 233/529 (44%), Gaps = 30/529 (5%)

Query: 81  GSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFS 140
           G    ++  ++ ++L P+PS+  +DPLNW   R+ +A  CV       G  ++ + S   
Sbjct: 13  GDARLVEGEEREVVLLPKPSKDPEDPLNWSRPRKWLATACVIVVTIGIGIPSAAIYSVLP 72

Query: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC 200
            ++ E  + L+ ++   G + L  G+G +   P A+ +GKR VYL  +L   +  +    
Sbjct: 73  NIAEERNLSLADLNQGTGYLFLFYGLGCLVFQPLALQYGKRPVYLFSMLATSLICVWPPY 132

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
           + S    + S+++ G   S VESLP  ++++++F HER+  L +Y               
Sbjct: 133 TRSNGEWIASKILQGLFGSCVESLPEISMSDLFFEHERSLGLSLYALTLMGVSYSAPLVA 192

Query: 261 SLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLS 320
             +       W+ W  +I+A   FV+    + ET + R      R   E  +  ++ G  
Sbjct: 193 GFISAGQGWQWVMWWCSILAAVCFVILFFAMEETSYTR------RVQDEASLDPEIDG-- 244

Query: 321 ENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAI 380
           E V  + V +  +   + A    DD V +    + +A     GS +      + +  +  
Sbjct: 245 EEVHESNVENGEVE-NDKAEKAKDDLVKI--RSDYSAHSLSEGSISWPQTSYMQKISLTR 301

Query: 381 GLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIII--SQVIDHAYKDI 438
           G       H        M  PF +  +P IL+  +LY  ++V   ++  ++ +  A K  
Sbjct: 302 GFKSKFMLH------YYMFMPFRMAQFPVILWAGFLYGSSLVWFNVLNATEAMVLAGKP- 354

Query: 439 YGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLC 498
           Y FSS+  GL Y++P +   +   IAG  SD      A   +G   PE RL+++    + 
Sbjct: 355 YNFSSSMCGLAYVSPLVCTFIVFPIAGFCSDKLKVYFARKRNGFSIPEDRLWLLFVYAIL 414

Query: 499 NAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNM 558
                L +G     Q HW    +  G+LG        ++  Y VD+Y+E   EA+V + +
Sbjct: 415 GCAASLLWGIGAYYQIHWFPLVLALGILGGCGVFGPVSSAAYVVDTYRELDAEAMVVVIL 474

Query: 559 VKNILGFAVSFFNVKFCLHEGYKN-----AFTCYA-----LIEIFIGLW 597
           ++N++ FA S+    +  + GYK      AF C A     L+ IF G W
Sbjct: 475 IRNLMSFACSYGITHWVENLGYKRCFIGVAFCCLATNSSFLVMIFTGPW 523

>KLLA0E09637g Chr5 (853845..855602) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C
          Length = 585

 Score =  155 bits (393), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 132/550 (24%), Positives = 233/550 (42%), Gaps = 30/550 (5%)

Query: 85  HLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSA 144
            LKK   G+IL PQPS+   DPLNW + R+      + +        ++   +    L+ 
Sbjct: 34  RLKKDSNGVILIPQPSDSPNDPLNWSVIRKLAHFALMAFITAFTAATSNDAGAAQDSLNE 93

Query: 145 ELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSF 204
              +    ++   G + L +G  ++F +P A L+G+++ YL+ I + ++G++  A ++S 
Sbjct: 94  IYGISYDAMNTGAGVLFLGIGWATLFLAPFANLYGRKITYLICITLGLLGALWFALASST 153

Query: 205 NWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVF 264
              + S++  G   S  E+    ++ +IYF H+    L +Y                 + 
Sbjct: 154 KDTIWSQLFVGISESCAEAQVQLSLTDIYFQHQLGSVLTVYILATSIGTFLGPLIAGYIA 213

Query: 265 EHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR----TPVPNKRSLHETRIARQVRGLS 320
              S  W+ W   II+G   V  +    ET++DR    TP+ +++           +  S
Sbjct: 214 SLTSFRWVGWCAVIISGGLLVWIVFGCEETYFDRKQYRTPLTSQKGYSGVEDGSSYQNSS 273

Query: 321 ENVSIATVRSTRL-NPRESAGHVNDDGVPVGLTDE--------SNAQEAETGSKTR---- 367
             +   T+   +  + + +   +N+D   V  T+          N +E   GSK +    
Sbjct: 274 NLLEKKTMLIEQFADSKNNDSKMNEDSNEV--TNRYADYPEAYENVEELIDGSKEKMKPY 331

Query: 368 -AHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLII 426
              I+ I++     G G       I       LR   +F +P +      +    V L  
Sbjct: 332 YKRIQLITKSGNLRGYGFKQYFKYIG----FNLR---MFLFPPVWLSGMFWGIQDVFLSF 384

Query: 427 ISQVIDHA-YKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEP 485
                D   Y+  + +S   V ++ +   IG  +G   AG  SD     +A  N+GI E 
Sbjct: 385 YLTTEDTVFYEAPWNYSDYGVAIMNVPTLIGAVIGCFYAGVISDYFVLWMARKNNGILEA 444

Query: 486 EFRL-FMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDS 544
           E+RL F    A++C A GLL FG   +R   W +  +  G +GFG       A++Y +D 
Sbjct: 445 EYRLYFAAATAIICPA-GLLMFGIGTDRNLPWQVIYVGLGFIGFGWGCSGDIAMSYLMDC 503

Query: 545 YKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRW 604
           Y E   E +V   ++ N +    +F    +    G +N +   A+I   + L A+P+Y +
Sbjct: 504 YPEMVLEGMVCTAIINNTISCIFTFVCSYWLDASGTENTYIALAVINFAVTLLALPMYIY 563

Query: 605 GKLCRSWTNR 614
           GK  R WT +
Sbjct: 564 GKRIRMWTKK 573

>SAKL0G12232g Chr7 (1042473..1044263) [1791 bp, 596 aa] {ON} highly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C
          Length = 596

 Score =  155 bits (393), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 130/555 (23%), Positives = 234/555 (42%), Gaps = 29/555 (5%)

Query: 85  HLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSA 144
            LKK   G+IL PQPS+   DPLNW  +R+      + +        ++   +    L+ 
Sbjct: 34  RLKKDHNGVILIPQPSDSPNDPLNWSRFRKLAHFALMSFITAFTAATSNDAGAAQDSLNE 93

Query: 145 ELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSF 204
              +    ++   G + L +G  ++F +P + L+G+++ Y+V I + ++G++  A +   
Sbjct: 94  IYGITYDSMNTGAGVLFLGIGWATLFLAPFSNLYGRKITYVVCITLGLLGAMWFALAKRT 153

Query: 205 NWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVF 264
           +  + S++  G   S  E+    ++++IYF H+    L +Y                 + 
Sbjct: 154 SDTIWSQLFVGISESCAEAQVQLSLSDIYFQHQLGSVLTVYILATSIGTFLGPLIAGYIA 213

Query: 265 EHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR----TPVPNKRSLHETRIARQVRGLS 320
              +  W+ W   II+G+  +  L    ET++DR    TP+ +++SL        ++   
Sbjct: 214 SLTTFRWVGWCAVIISGALLMFILFGCEETYFDRKRYVTPLTSQKSLRNFEDGTTLQDSD 273

Query: 321 ENVSIATVRSTR------------LNPRESA-GHVNDDGVPVGLTDESNA-----QEAET 362
            ++   + +ST+            L  RE A   V D  + V   DE  A     Q+   
Sbjct: 274 NHIYFDSEKSTKAADFDFCPDGTNLVSREKAENKVTDSTIQVHDNDEPKASFTVKQDLID 333

Query: 363 GSKT--RAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYA 420
           GSK   + + K IS    A  L  +  R     +  + LR   +F +P +      +   
Sbjct: 334 GSKENLKPYHKRISIVTKATNLRGWGFRQYF-KYLGINLR---MFLFPPVWLSGLFWGIQ 389

Query: 421 VVSLIIISQVIDHA-YKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHN 479
            V L       D   Y + + +S   V ++ +   IG  +G + AG  SD     +A  N
Sbjct: 390 DVFLSFYLTTEDTLFYDEPWNYSDYGVAIMNVPTLIGAVVGCIYAGTVSDYFVLWMARKN 449

Query: 480 HGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAIT 539
           +GI E E+RL+    + +    GLL FG    R   W +  +  G +GF        A+ 
Sbjct: 450 NGILEAEYRLYFSFASAIIGPAGLLMFGIGSARALPWQVIYVGLGFIGFSWGCSGDIAMG 509

Query: 540 YAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAI 599
           Y +D Y +   E +V   ++ N      +F    +    G +N +   A+I   I   A+
Sbjct: 510 YLMDCYPDMVLEGMVCTAIINNTTSCIFTFVCSYWIEASGTENTYIALAVINFGIASLAL 569

Query: 600 PLYRWGKLCRSWTNR 614
           P++ +GK  R WT +
Sbjct: 570 PMFIYGKRIRKWTKK 584

>SAKL0G12254g Chr7 (1044636..1046381) [1746 bp, 581 aa] {ON} highly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C
          Length = 581

 Score =  148 bits (373), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 118/540 (21%), Positives = 228/540 (42%), Gaps = 14/540 (2%)

Query: 85  HLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSA 144
            LKK   G++L PQPS+   DPLNW  +R+      + +        ++   +    L+ 
Sbjct: 34  RLKKDNNGVVLIPQPSDSPNDPLNWSRFRKLAHFALMSFITAFTAATSNDAGAAQDSLNE 93

Query: 145 ELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSF 204
              +    ++   G + L +G  ++F +P + L+G+++ Y+V I + ++G++  A +   
Sbjct: 94  IYGITFDSMNTGAGVLFLGIGWATLFLAPLSNLYGRKITYVVCITLGLLGAMWFALAKRT 153

Query: 205 NWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVF 264
           +  + S++  G   S  E+    ++++IYF H+    L +Y                 + 
Sbjct: 154 SDTIWSQLFVGISESCAEAQVQLSLSDIYFQHQLGSVLTVYILATSIGTFLGPLIAGYIA 213

Query: 265 EHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR----TPVPNKRSLHETRIARQVRGLS 320
              +  W+ W   II+G+  +  L    ET++DR    TP+ ++++         ++  S
Sbjct: 214 SLTTFRWVGWCAVIISGALLMFILFGCEETYFDRGMYITPLTSQKTSQGCEDGTTLQN-S 272

Query: 321 ENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNA-----QEAETGSKTRAHIKSISE 375
           E+  +      + NP +S           G+++E N      +E   GSK +  +K   E
Sbjct: 273 EDRLVYASGEKQKNP-DSKDVETSAVTSFGVSEELNRTIISHKELIDGSKEK--LKPYRE 329

Query: 376 KQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSL-IIISQVIDHA 434
           +   I +           +   +     +F +P +      +    V L   ++   D+ 
Sbjct: 330 RVSLITIATNLNGCGAKQYFRYLGINLRMFLFPPVWLSGLFWGIQDVFLSFYLTTEEDNY 389

Query: 435 YKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLP 494
           Y   + +S   V ++ +   IG  +G + AG  SD     +A  N+GI E E+RL+    
Sbjct: 390 YDPPWNYSDYGVAIMNVPTLIGAVVGCIYAGTVSDYFVLWMARKNNGILEAEYRLYFSFA 449

Query: 495 AVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALV 554
           + +    GLL FG    R   W +  +  G +GF        A+ Y +D Y +   E +V
Sbjct: 450 SAIIGPAGLLMFGIGSARALPWQVIYVGLGFIGFSWGCSGDIAMGYLMDCYPDMVLEGMV 509

Query: 555 TLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNR 614
              ++ N      +F    +    G +N +   A+I   I   A+P++ +GK  R WT +
Sbjct: 510 CTAIINNTTSCIFTFVCSYWIEASGTENTYIALAVINFGIASLALPMFIYGKRIRKWTKK 569

>KLTH0B02816g Chr2 (219220..220971) [1752 bp, 583 aa] {ON} highly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C
          Length = 583

 Score =  147 bits (370), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 120/550 (21%), Positives = 227/550 (41%), Gaps = 28/550 (5%)

Query: 83  DDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKL 142
           +  L+KT + ++L PQPSE   DPLNW   R+ +    + +        ++   +    L
Sbjct: 32  ESSLRKTTEDVVLIPQPSESPNDPLNWSKARKFLHFALMSFITAFTAATSNDAGAAQDSL 91

Query: 143 SAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACST 202
           +    +    ++   G + L +G  ++F +P A L+G+++ Y++   + + G+I    + 
Sbjct: 92  NEFYGISYDSMNTGAGVLFLGIGWSTLFLAPLANLYGRKITYIICTALGLAGAIWFGFAR 151

Query: 203 SFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSL 262
             +  + S++  G   S  E+    ++++I+F H+    L +Y                 
Sbjct: 152 RTSDTIWSQLFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYILATSAGTFLGPLIAGY 211

Query: 263 VFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR----TPVPNKRSLHETRIARQVRG 318
           +    S  W+ WI  II+G+  ++ +    ET++DR    TPV  K  L      R    
Sbjct: 212 ISALTSFRWVGWIAAIISGALLIIIVFGCEETYFDRNRYVTPVSRKAHL------RSGGN 265

Query: 319 LSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAE-------------TGSK 365
                S   + +++ N  E     +   VP   T+++   E               +  K
Sbjct: 266 YDSQCSAQPLLASQDNCDEYGFKHDPKNVPNQKTEKTTEVEPSFNASIEDFKLIDGSEEK 325

Query: 366 TRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLI 425
            + + K ++    +  L  + G     N+  + +R   +F +P +      +    V L 
Sbjct: 326 LKPYYKRVAIITKSTNLRGW-GVKQYFNYLGINMR---MFLFPPVWLSGLFWGIQDVFLT 381

Query: 426 IISQVIDHAYKDI-YGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYE 484
                 D  + +  + +S   V ++ +   IG  +G + AG  SD     +A  NHGI E
Sbjct: 382 FYLTTEDTYFPEAPWNYSDYGVAIMNVPTLIGAIIGCIYAGIVSDYFVLWMARRNHGILE 441

Query: 485 PEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDS 544
            E+RL+      +    GLL FG    RQ  W +  +  G +GF        A+ Y +D 
Sbjct: 442 AEYRLYFSFATAIIGPAGLLMFGIGAARQLPWQVIYVGLGFIGFSWGCSGDIAMAYLMDC 501

Query: 545 YKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRW 604
           Y +   E +V   ++ N +    +F    +    G +N +   A+I   I + A+P++ W
Sbjct: 502 YPDMILEGMVCTAIINNTISCIFTFVCSYWLDASGTENTYIALAVINFGITMLAVPMFIW 561

Query: 605 GKLCRSWTNR 614
           GK  R  T +
Sbjct: 562 GKKIRQATRK 571

>KLTH0E00132g Chr5 (3262..5010) [1749 bp, 582 aa] {ON} weakly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C HOL1 Putative ion transporter similar to the
           major facilitator superfamily of transporters; mutations
           in membrane-spanning domains permit nonselective cation
           uptake
          Length = 582

 Score =  146 bits (368), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 143/547 (26%), Positives = 245/547 (44%), Gaps = 38/547 (6%)

Query: 83  DDHL---KKTKKG------IILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTS 133
           D HL    +T+K       I+LNP PS+   DPLNW   R+  A+ CV  +       T+
Sbjct: 13  DSHLVDFDETRKSGEREGKIVLNPTPSDDPDDPLNWTPRRKWTAVACVLIYTLGACIPTA 72

Query: 134 MLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMI 193
            + S    + A   + LS+++   G M L LG+G +   P A+ FGKR +YL  +L   +
Sbjct: 73  AIYSVLPNIEANTNITLSELNNGTGYMFLFLGLGCLIFQPLALQFGKRPIYLFSMLATAL 132

Query: 194 GSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXX 253
             +    + S    + S+++ GF  S++ESLP  ++++++F HER++ L +Y        
Sbjct: 133 ICVWPPYTKSNGEWVASKILQGFVGSSMESLPEISMSDLFFEHERSFALSLYGLTLLSAS 192

Query: 254 XXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR------------TPV 301
                    + E     W+ W   I     FVL    + ET +DR            T  
Sbjct: 193 FLAPFVAGFISEGQGWEWVMWWCAIFGAVCFVLLFFLMEETNYDRKLKVDAATGEVITLA 252

Query: 302 PNKRSLHE--TRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDE-SNAQ 358
             K+ L    T I   +   SE  +      T+ N   ++    +    + + ++ SN +
Sbjct: 253 SRKQQLGAVFTNIDEVIASNSEGNNAGEKNETKTNDIGASLQTEEYPENINIVNQVSNVE 312

Query: 359 EAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYA 418
             ++ S    +  + +  Q    L ++ GR         +  PF++  +P +L+  +LY 
Sbjct: 313 VVDSNSYAPNYEGTKTYLQK---LSLFGGRRKKFLLQHYIFAPFLMARFPVVLWAGFLYG 369

Query: 419 YAVVSLIIISQVIDHAYK-DIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSD-VNTRLLA 476
            ++V   +++           Y FSS+++G+ Y++P I   +   I+G  SD +  R+  
Sbjct: 370 SSLVWFNVLNATAALILGGSPYDFSSSTIGVAYLSPTIFSVILFFISGLCSDWLKVRVAL 429

Query: 477 AHNHGIYEPEFRLF-MVLPAVL-CNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCS 534
               G+ +PE RL+ +V+  VL C A  L G G   E   HW       G+LG       
Sbjct: 430 WRGTGLSKPEDRLWILVIYCVLGCAASILWGVGAYYEI--HWFGLVFGMGLLGGCGIFGI 487

Query: 535 TTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKN-----AFTCYAL 589
            ++ TY VD+YKE   EA+V + +++N + F VS+    +    GYK      AF C+A 
Sbjct: 488 ASSATYVVDTYKELDTEAMVVVIIIRNCMSFGVSYGITDWVTDLGYKKCFISVAFLCFAA 547

Query: 590 IEIFIGL 596
              F+ +
Sbjct: 548 NFTFLAM 554

>KLTH0A00440g Chr1 (37100..38848) [1749 bp, 582 aa] {ON} weakly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C HOL1 Putative ion transporter similar to the
           major facilitator superfamily of transporters; mutations
           in membrane-spanning domains permit nonselective cation
           uptake
          Length = 582

 Score =  146 bits (368), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 143/547 (26%), Positives = 245/547 (44%), Gaps = 38/547 (6%)

Query: 83  DDHL---KKTKKG------IILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTS 133
           D HL    +T+K       I+LNP PS+   DPLNW   R+  A+ CV  +       T+
Sbjct: 13  DSHLVDFDETRKSGEREGKIVLNPTPSDDPDDPLNWTPRRKWTAVACVLIYTLGACIPTA 72

Query: 134 MLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMI 193
            + S    + A   + LS+++   G M L LG+G +   P A+ FGKR +YL  +L   +
Sbjct: 73  AIYSVLPNIEANTNITLSELNNGTGYMFLFLGLGCLIFQPLALQFGKRPIYLFSMLATAL 132

Query: 194 GSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXX 253
             +    + S    + S+++ GF  S++ESLP  ++++++F HER++ L +Y        
Sbjct: 133 ICVWPPYTKSNGEWVASKILQGFVGSSMESLPEISMSDLFFEHERSFALSLYGLTLLSAS 192

Query: 254 XXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR------------TPV 301
                    + E     W+ W   I     FVL    + ET +DR            T  
Sbjct: 193 FLAPFVAGFISEGQGWEWVMWWCAIFGAVCFVLLFFLMEETNYDRKLKVDAATGEVITLA 252

Query: 302 PNKRSLHE--TRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDE-SNAQ 358
             K+ L    T I   +   SE  +      T+ N   ++    +    + + ++ SN +
Sbjct: 253 SRKQQLGAVFTNIDEVIASNSEGNNAGEKNETKTNDIGASLQTEEYPENINIVNQVSNVE 312

Query: 359 EAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYA 418
             ++ S    +  + +  Q    L ++ GR         +  PF++  +P +L+  +LY 
Sbjct: 313 VVDSNSYAPNYEGTKTYLQK---LSLFGGRRKKFLLQHYIFAPFLMARFPVVLWAGFLYG 369

Query: 419 YAVVSLIIISQVIDHAYK-DIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSD-VNTRLLA 476
            ++V   +++           Y FSS+++G+ Y++P I   +   I+G  SD +  R+  
Sbjct: 370 SSLVWFNVLNATAALILGGSPYDFSSSTIGVAYLSPTIFSVILFFISGLCSDWLKVRVAL 429

Query: 477 AHNHGIYEPEFRLF-MVLPAVL-CNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCS 534
               G+ +PE RL+ +V+  VL C A  L G G   E   HW       G+LG       
Sbjct: 430 WRGTGLSKPEDRLWILVIYCVLGCAASILWGVGAYYEI--HWFGLVFGMGLLGGCGIFGI 487

Query: 535 TTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKN-----AFTCYAL 589
            ++ TY VD+YKE   EA+V + +++N + F VS+    +    GYK      AF C+A 
Sbjct: 488 ASSATYVVDTYKELDTEAMVVVIIIRNCMSFGVSYGITDWVTDLGYKKCFISVAFLCFAA 547

Query: 590 IEIFIGL 596
              F+ +
Sbjct: 548 NFTFLAM 554

>Ecym_2679 Chr2 complement(1313694..1315403) [1710 bp, 569 aa] {ON}
           similar to XP_002551481 Lachancea thermotolerans
          Length = 569

 Score =  145 bits (365), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 135/537 (25%), Positives = 241/537 (44%), Gaps = 25/537 (4%)

Query: 88  KTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQ 147
           + K  ++LNP PS+   DPLNW   R+ +A+VCV  +       T+ + S  + +     
Sbjct: 25  EDKNKVVLNPTPSDDPDDPLNWEFRRKWLAVVCVLAYTLGVVVPTAAIYSVLTSIEQSTD 84

Query: 148 VPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC------S 201
           + L ++++  G M L LG+G +   P A+ +GKR VYL  +L     S    C       
Sbjct: 85  ISLEKLNHGTGYMFLFLGLGGLVFQPLALQYGKRPVYLFSML-----STAAICLWPSFIK 139

Query: 202 TSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXS 261
           T+  W+ +S+++ GF  S +ESLP  T+++++F HER+  L +Y                
Sbjct: 140 TNDMWI-VSKILQGFVGSPIESLPEITMSDLFFEHERSLGLSLYALMLLVGSYLAPAVSG 198

Query: 262 LVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSE 321
            V +  S  W+ W   ++    F+    F+ ET ++R    N ++     I   +   + 
Sbjct: 199 FVSDSESWRWVMWGCAVLDVFCFIFLFFFMEETNYNRVLKINGKT--NRLIIPAIHQNNS 256

Query: 322 NVSIATVRSTRLNPRESAGHVNDDGVPVGLT--DESNA-----QEAETGSKTRAHIKSIS 374
           NV I    + R +   S+    +   P+  T  ++ N      Q ++    +  +    +
Sbjct: 257 NVVIQLCTAGRSDGSLSS---EEQKEPIAATNLEQPNGFAVFNQASDVVVVSSDYEPKYT 313

Query: 375 EKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHA 434
            K     L +  G+          + PF++  +P +L+  +LY  +++S  +++      
Sbjct: 314 SKSFYSKLSLISGKKPKFLLHQYFIMPFLMCRFPIVLWAGFLYGTSLISFNVMNATGALI 373

Query: 435 YKDI-YGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVL 493
              + Y F +   GL YI+P I   +   I+G  SD     +A    G    E RL++++
Sbjct: 374 LTGVPYNFETNIFGLAYISPTIFSLILFYISGYFSDQLKIRIAVWRGGKSLAEDRLWVLI 433

Query: 494 PAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEAL 553
           P VL      + +G   E + HW    I  G+LG        T+ TY VD YKE + EA+
Sbjct: 434 PYVLLGFFACILWGVGAEHKIHWSGLVIAMGILGGCGIFGIVTSTTYIVDCYKELATEAM 493

Query: 554 VTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRS 610
           V + +++N++ F +S+    +  + GYK  F   A I +      I + + G  CR+
Sbjct: 494 VVVILIRNLMSFGISYGITSWVQNMGYKKCFIALAFISLVCNSSFILMAKVGPWCRN 550

>Ecym_5082 Chr5 (178458..180182) [1725 bp, 574 aa] {ON} similar to
           Ashbya gossypii ADR337C
          Length = 574

 Score =  142 bits (359), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 123/543 (22%), Positives = 223/543 (41%), Gaps = 10/543 (1%)

Query: 73  DMKGQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQT 132
           +++  +   S + +K+ + G++L PQPS+   DPLNW   R+ +    + +        +
Sbjct: 24  ELESDDYNQSFNDIKRDRSGVVLIPQPSDSPNDPLNWSKCRKILHFALMSFITAFTAATS 83

Query: 133 SMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFM 192
           +   +    L     +    ++   G +   +G  ++  +P   L+G+RL Y + I + +
Sbjct: 84  NGTGAAADSLHDYYNITYDSLNAGAGVLFFGIGWATLIFAPLPSLYGRRLTYFICIFLGL 143

Query: 193 IGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXX 252
            G++  A ++    ++ S++  G   S  E+    ++ +I+F H+    L +Y       
Sbjct: 144 CGALWFARTSKTRDVIWSQLFVGISESCAEAHVQLSLTDIFFQHQLGSVLTVYIMSISVG 203

Query: 253 XXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRI 312
                     +    +  WL W   I++G+  V       ET++DR       S H   I
Sbjct: 204 TFLGPLIGRYIATLANFRWLGWCAAIMSGALLVWIYFGCEETYFDRHLYMTPYSKHSI-I 262

Query: 313 ARQVRGLSENVSIA-TVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIK 371
            + V  L  +V       S +  P  + G        +    E      E   K    IK
Sbjct: 263 NKSVDELPTSVDEGEDATSNKDGPITATGQTISTEKCITFDKELINGSKEPLKKYHKRIK 322

Query: 372 SISEKQMAIGLGI-YHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQV 430
            I++     G G+  + R+   N  M +  P  L    + LF  W      +S  + +Q 
Sbjct: 323 LITKATNLKGWGVKQYFRYLGTNLRMFLFPPVWL----SGLF--WGIQDVFLSFYLTTQD 376

Query: 431 IDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLF 490
             + Y + + +S+ SV L+ +    G  +G + AG  SDV    +A  N GI E E+RL+
Sbjct: 377 T-YFYDEPWNYSAYSVALMNVPTLAGAVIGCMYAGVISDVFVLWMARRNRGILEAEYRLY 435

Query: 491 MVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQ 550
               A    + GL+ FG   E      +  +  G +GF        A+ Y +D Y E   
Sbjct: 436 FSGAAAALGSSGLMMFGIGAENALPPPVIYVGLGFIGFAWGCSGDIAMAYLMDCYPEMVL 495

Query: 551 EALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRS 610
           E +   +++ N L    +F   ++    G KN +    LI + I   A+P+  +GK  R+
Sbjct: 496 EGMACTSVINNTLSCVFTFCCSQWLESFGTKNTYIILGLINLAITFLAVPMLIFGKRIRA 555

Query: 611 WTN 613
           WT 
Sbjct: 556 WTK 558

>SAKL0D02508g Chr4 (197981..199720) [1740 bp, 579 aa] {ON} similar
           to gnl|GLV|KLLA0D12606g Kluyveromyces lactis
           KLLA0D12606g and weakly similar to YNR055C
           uniprot|P53389 Saccharomyces cerevisiae YNR055C HOL1
           Putative ion transporter similar to the major
           facilitator superfamily of transporters; mutations in
           membrane- spanning domains permit nonselective cation
           uptake
          Length = 579

 Score =  142 bits (359), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 144/569 (25%), Positives = 253/569 (44%), Gaps = 46/569 (8%)

Query: 79  SGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASG 138
           S GS+D      + I+L P PS+   DPLNW   R+ +A+ CV  +    G  T+ + S 
Sbjct: 20  SDGSND------RKIVLIPTPSDDPDDPLNWSKPRKWLAVCCVLIYTLGVGVPTAAIYSV 73

Query: 139 FSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGIL-IFMIGSIG 197
            + + A+  + LS+++   G M L LG+G +   P A+ +GKR VYL  +L   MI    
Sbjct: 74  LTDIQAKTSITLSELNNGTGYMFLFLGLGCLVFQPLALQYGKRPVYLFSMLATTMICVWP 133

Query: 198 CACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXX 257
               T+  W + S+++ G   +T+ESLP  ++++++F HER+  L +Y            
Sbjct: 134 PYTKTNGEW-IASKILQGLFGATIESLPEISMSDLFFEHERSLGLSLYGLTLLAASYLAP 192

Query: 258 XXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR-------TPVPNKRSLHET 310
                + +     W+ W  +I     FVL    + ET ++R       T  P     H+ 
Sbjct: 193 VLAGFISQGQGWEWVMWWCSIFGAVCFVLLFFLMEETNYERKVKIDSTTNKPITMDSHQG 252

Query: 311 RIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKT---- 366
            ++      ++  +     S+++   E    + D      LT  ++A+ A   ++T    
Sbjct: 253 VVSGIFSNTNQIDAAMDSSSSQVEKNEIQLDIADKN---QLTSVASAENANIHNQTSNVE 309

Query: 367 ----------RAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWL 416
                     +   ++  EK     L +++G           + PF +  +P +L+  +L
Sbjct: 310 VVDLDSYVPQKTTTRTFREK-----LSLFNGAKKKFLLHHYAIAPFYMARFPVVLWAGFL 364

Query: 417 YAYAVVSLIIISQVIDHAYKDI-YGFSSASVGLVYIAPFIGGCLGSLIAGRGSD-VNTRL 474
           Y  ++V   +++           Y FSS+  G+ Y++P I   L   +AG  SD +  R+
Sbjct: 365 YGSSLVWFNVLNATAALILSGTPYEFSSSMCGVAYLSPTIFSLLFFYLAGFCSDWLKVRI 424

Query: 475 LAAHNHGIYEPEFRLFM--VLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSM 532
                +G+  PE RL++  V   + C A  L G G   E   HW    +  G+LG     
Sbjct: 425 AVWRGNGLSLPEDRLWVLCVYCVLGCGASILWGVGAYYEI--HWFGLIVGMGMLGGCGIF 482

Query: 533 CSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEI 592
              ++ TY VDSYKE   EA+V + +++N + F VS+    + ++ GYK  F   A I +
Sbjct: 483 GIASSTTYVVDSYKELDAEAMVVVILIRNCMSFGVSYGITDWVMNLGYKKCFISVAFISL 542

Query: 593 FIGLWAIPLYRWGKLCRSWTNRKNLLQFS 621
              L  + +   G     W N++  + +S
Sbjct: 543 LCNLTFLVMVYTGP---KWRNKQKAMYWS 568

>ADR336C Chr4 complement(1299394..1301100) [1707 bp, 568 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YNR055C
           (HOL1); Tandem gene duplication in this genome
          Length = 568

 Score =  139 bits (351), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 123/535 (22%), Positives = 235/535 (43%), Gaps = 18/535 (3%)

Query: 85  HLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSA 144
            LKK   G++L PQPS+   DPLNW +WR+ +    + +        ++  ++    L+ 
Sbjct: 35  RLKKDSCGVLLTPQPSDSPNDPLNWSVWRKYVHFGLMSFITAFTAATSNNASAAQDSLNE 94

Query: 145 ELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSF 204
              +  + ++   G + L +G G++  +P + L+G+++ Y++ I   ++G+I  A +++ 
Sbjct: 95  LYGITFAAMNTGAGVLFLCIGWGTLVFAPLSSLYGRKITYMICIGFGLLGAIWFASTSNT 154

Query: 205 NWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVF 264
           N  + S+ + G   +  E+    ++++I+F H+    L +Y                 + 
Sbjct: 155 NDAIWSQALVGVSEACAEAQVQLSLSDIFFQHQLGSVLTVYILCTSIGTFLGPLIAGYIS 214

Query: 265 EHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVS 324
              +  W+ W+  I++G   +  L F  ET++DR       +  ++ I R+    S + S
Sbjct: 215 SLTNFRWVGWVGAIVSGGLLLAFLFFCEETYFDRKAYITPLTWTDSSILRRN---SSSSS 271

Query: 325 IATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQ-EAETGSKTRAHIKSISEKQMAIGLG 383
           + TV +     + S G  + D     L   S     AE        I  I++     G G
Sbjct: 272 MLTVNANINEDKASGGGKDSDEEHCRLERTSLLDGAAEDPKPYHRRIALITKASNLKGWG 331

Query: 384 IYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSL-IIISQVIDHAYKDIYGFS 442
                  I     + +R   +F +P +      +    V L   ++   D+  +  + FS
Sbjct: 332 FKQYLKYIG----INMR---MFLFPPVWLSGLFWGIQDVFLSFYLTTEEDYYPEQPWNFS 384

Query: 443 SASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIG 502
           +  V L+ +   +G  +G + AG  SD     +A  N GI E E+RL+   P      +G
Sbjct: 385 NYQVALMNVPTLVGAVVGCMYAGVISDYFVLWMARRNGGIMEAEYRLYFSAPTAFLGTLG 444

Query: 503 LLGFGWSLERQDHWIIPSIFFG---VLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMV 559
           LL FG   E+Q   +  S+ +G   ++GF        A+++ +D Y E   E +V  +++
Sbjct: 445 LLLFGIGTEQQ---LSLSVVYGGLVLIGFSWGCSGDIAMSFLMDCYPEMVLEGMVCTSVI 501

Query: 560 KNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNR 614
            N L    +FF   F    G +N++   A++   + L A P+  +GK  R  T +
Sbjct: 502 NNTLSCIFTFFCSPFIEAVGTQNSYIFLAVVNFSVTLLAWPMLVYGKKVRKLTTK 556

>ADR337C Chr4 complement(1301383..1303095) [1713 bp, 570 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YNR055C
           (HOL1); Tandem gene duplication in this genome
          Length = 570

 Score =  139 bits (349), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 125/542 (23%), Positives = 224/542 (41%), Gaps = 35/542 (6%)

Query: 86  LKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAE 145
           +KK + G++L PQPS+   DPLNW  WR+ +    + +        ++   +    L + 
Sbjct: 37  IKKDRNGVVLVPQPSDSPNDPLNWSYWRKIMHFALMAFITAFTAATSNDAGATTESLHSI 96

Query: 146 LQVPLSQISYLVGPMMLSLGVG--SIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTS 203
             +    ++  VG  +L LGVG  ++  SP   LFG++L Y++ I + + G++  A +T 
Sbjct: 97  YGITYDSMN--VGAAVLFLGVGWSALLFSPLPSLFGRKLTYMICITLGLFGAMWFALATK 154

Query: 204 FNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLV 263
              ++ S++  G   S  E+    ++++I+F H+    L +Y                 +
Sbjct: 155 TGHVIWSQLFVGMSESCAEAHVQLSLSDIFFQHQLGSVLTVYIMATSVGTFLGPLIAGYI 214

Query: 264 FEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDR-------TPVPNKRSLHETRIARQV 316
               +  W+ W   II+    +  +    ET++DR       T V    +  E       
Sbjct: 215 ASLTNFRWVGWCAVIISAFLLLWIVFGCEETYFDRRLYQTPLTVVAGHSTDEEDNKCSAC 274

Query: 317 RGLS---ENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSI 373
            G +   E  S+A   +T LN R            V L  +      E   +    I+ I
Sbjct: 275 AGTTTGAEKRSLAYASNTELNERV-----------VMLNTQLIDGSEEPPKRYFRRIRLI 323

Query: 374 SEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGA--WLYAYAVVSLIIISQVI 431
           +      G G+      +     + LR   +F +P +      W      +S  + +Q  
Sbjct: 324 TRATNFRGWGVKQYFKYLG----LNLR---MFLFPPVWLSGLYWGTQDVFLSFYLTTQDT 376

Query: 432 DHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFM 491
           +  Y + + +S+  V ++ +   +G  +G + AG  SDV    LA  N+GI E EFRL+ 
Sbjct: 377 NF-YDEPWNYSTYRVAIMNVPTLLGAVVGCMYAGVISDVFVLWLARRNNGILEAEFRLYF 435

Query: 492 VLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQE 551
              A +   +GL+ FG+   R   W    I    +GF        A+ Y +D Y E   E
Sbjct: 436 AAVAGIAGTLGLILFGYGAARALPWQTVYIGLAFIGFTWGSFGDIAMAYLMDCYPEMVLE 495

Query: 552 ALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSW 611
            +    ++ N L    +          G K+ +    L+ + I L A+P++ +GK  R+W
Sbjct: 496 GMACTAVINNTLSCIFTLTCSYLLDTYGNKSTYLALGLLNLGITLLAVPMFLYGKQIRTW 555

Query: 612 TN 613
           + 
Sbjct: 556 SK 557

>TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.245
           YBR043C
          Length = 640

 Score =  130 bits (326), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 141/573 (24%), Positives = 246/573 (42%), Gaps = 56/573 (9%)

Query: 87  KKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAEL 146
           +K ++G++ +       KDP ++P   + + ++ + +   +G   TS++    + ++  L
Sbjct: 61  RKERRGLLAHLSIIPEFKDPRDYPASIKKLIVLIIAFSSLMGPMATSIVFPAINPITESL 120

Query: 147 QVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNW 206
                 ++  VG   LSLG+  ++ S  + + G+R VY+V  ++     IG A S + + 
Sbjct: 121 DTTTFMVNISVGVYSLSLGIFPLWWSSFSEMHGRRSVYVVSFIMLFGFCIGAALSPNISS 180

Query: 207 LLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEH 266
            +I RV+ G   ++V+S+ + T++++Y   +R   LGIY               S +   
Sbjct: 181 FIILRVLCGAASASVQSVGAGTVSDLYIPEDRGRNLGIYYMGPLMAPLIAPIIASGLVTR 240

Query: 267 LSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSI- 325
            S     W + I+AG + +L + F+PET   +    +K ++    + R+    ++N  I 
Sbjct: 241 WSWRSTQWFMVILAGFDVLLLVFFLPETLRKQD---SKAAIAAILLERRNHNANKNPGIE 297

Query: 326 ATVR--STRLNPRESAGHVND-DG---VPVGLTDESN----------------------A 357
           ATV   +   N  ES    ND DG   +   LTD S+                      +
Sbjct: 298 ATVDLVADHSNDNESKESSNDGDGEEDLRRMLTDASSRHNYPTADHNIDVGAPQISRIQS 357

Query: 358 QEAETGSKTR----AHIKSISEKQMAIG------LGIYHGR---HTIDNWCMV-MLRPF- 402
           Q+    S+ R    A +++  E ++A        L    GR     I N C +  +RP  
Sbjct: 358 QDPRWESRMRDYDLARMRTNLENELAKTETQKSRLTDSVGRSKKRIIMNQCYIHFIRPMK 417

Query: 403 --VLFSYPAILFGAWLYAYAVVSLIIISQVIDHAY-KDIYGFSSASVGLVYIAPFIGGCL 459
                 YP +L      A +   L  ++  I++ Y +  Y F    VGL+YI   +   +
Sbjct: 418 SVYFLKYPPVLMAIIFSAISFSVLYFVNMTIEYDYSRSPYNFKPLFVGLLYIPNSVTYII 477

Query: 460 GSLIAGRGSDVNTRLLAAH--NHGIYEPEFRL-FMVLPAVLCNAIGLLGFGWSLERQDHW 516
            ++  G+  D    LL  +   +GI  PE R+ + ++ AV    + LL FGW L+++ HW
Sbjct: 478 AAIYGGKWVD---SLLKRYKVKYGILAPEARISWNLVTAVAIFPVSLLIFGWCLDKKCHW 534

Query: 517 IIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCL 576
           + P I   + GF S M     ++Y VDS        +   N+V+ IL     F       
Sbjct: 535 VTPLIGTALFGFASMMTIGATVSYLVDSLPGRGATGVALNNLVRQILAAVAVFVTEPMLK 594

Query: 577 HEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCR 609
             G   AFT  A I I      + L R+G   R
Sbjct: 595 GMGTGWAFTMLAFIIIGSSSVLLILKRYGDHWR 627

>KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 663

 Score =  128 bits (321), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 127/555 (22%), Positives = 223/555 (40%), Gaps = 58/555 (10%)

Query: 87  KKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAEL 146
           +  ++G++ N       KD   +P   +   ++ + +   +G   TS++      L A+ 
Sbjct: 82  RSERRGLLANLAIIPEYKDSREYPRHLKSFIVLIIAYGAVMGPMGTSIIFPAIGPLVADF 141

Query: 147 QVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNW 206
                 +   VG  +LSLG+  I+ S  + + G+R VY++   +    +IG A S + + 
Sbjct: 142 DTSTIMVDVSVGIYLLSLGIFPIWWSSLSEIEGRRTVYVLSFTLLTAFTIGSALSPNISA 201

Query: 207 LLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEH 266
            ++ R++ G   ++V+S+ + TI++++   ER   LG Y               +L+   
Sbjct: 202 FIVFRMLQGASSASVQSVGAGTISDLFIPEERGKNLGYYYLGTLMAPLLSPIIGALLVNR 261

Query: 267 LSTHWLFWILTIIAGSNFVLHLLFVPETFW------------------------------ 296
            S     W + I+A  N +L  L +PET                                
Sbjct: 262 WSWRSTQWFMVILAVVNVLLFTLLLPETLRRQDTSAAIAIMLAERKQKLNTSDIENNNGT 321

Query: 297 ---------DRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTR-LNPRESAGHVNDDG 346
                    D+  V + R L E   A Q     E   I +  ST   N  E+   V D  
Sbjct: 322 TIDAEAELPDQNQVDDARFLEEA--ASQYESQEELKKIRSHTSTICTNIPENNDAVYDTH 379

Query: 347 VPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTI-DNWCMVM------- 398
           VP      ++  + E   +    ++  ++ Q  +   I   +HT  D W   +       
Sbjct: 380 VPQLSKIRTHDTKIEERIRQNDLLRVQTQLQNEVE-KIESSKHTTSDRWKEELYVYLVKP 438

Query: 399 LRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAY-KDIYGFSSASVGLVYIAPFIGG 457
           L+     +YP +       A +   L +++  I++ Y +  Y F    +GL+YI   +  
Sbjct: 439 LKSLHFLAYPPVTLAIIFSAISFAILYVVNMTIEYCYTRPPYNFKPLYIGLLYIPNSVTY 498

Query: 458 CLGSLIAGRGSDVNTRLLAAHN--HGIYEPEFRL-FMVLPAVLCNAIGLLGFGWSLERQD 514
            + S+  GR  D    LL  +   HGI  PE R+ + V+ AV+   IGLL FGW L++++
Sbjct: 499 IIASIYGGRWVD---NLLKKYKEMHGIISPEARIGWNVVVAVVTFPIGLLVFGWCLDKKE 555

Query: 515 HWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKF 574
           HW+ P +   + GF S M     ++Y VDS        +   N+++ IL     F     
Sbjct: 556 HWVTPLVGTAIFGFASMMTIGATVSYLVDSLPGRGATGVALNNLIRMILAATSVFITTPM 615

Query: 575 CLHEGYKNAFTCYAL 589
               G    FT  A+
Sbjct: 616 LKGMGVGWTFTMLAI 630

>ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} similar
           to YBR043C, uniprot|P38227 Saccharomyces cerevisiae
           YBR043C (QDR3)
          Length = 684

 Score =  124 bits (312), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 133/582 (22%), Positives = 239/582 (41%), Gaps = 64/582 (10%)

Query: 87  KKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAEL 146
           +K ++GI+ +       KD  ++P   +   +  + +   +G   TS++      +  + 
Sbjct: 95  RKERRGILPHLSLIPEFKDARDYPPHIKKFIVFVIAFSSMMGPMATSIVYPAIDPIKEDY 154

Query: 147 QVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNW 206
           +     ++  VG   +SLGV  ++ S  + + G+R VY++  L+ +  ++G   S + N 
Sbjct: 155 KTTSIMVNVSVGVYQISLGVFPLWWSSISEMNGRRTVYVLSFLLLLAFNVGTGLSPNIND 214

Query: 207 LLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEH 266
            +I RV+SG   ++V+S+ + T+A++Y   ER   +GIY               + +   
Sbjct: 215 FIILRVLSGGAAASVQSVGAGTVADLYVPEERGTNIGIYYMGPLMAPLVSPIIGAALVSG 274

Query: 267 LSTHWLFWILTIIAGSNFVLHLLFVPETFWDR----------------TPVPN-----KR 305
                  W + I++G N +L +LF+PET   +                +P  N      +
Sbjct: 275 FPWKSTQWFMVILSGVNVILLVLFLPETLRKQDSGAAITAILQARRKGSPGVNANQTEDK 334

Query: 306 SLHETRIARQVRGLSENVSIATVRS-----------------TRLN---------PRESA 339
           S ++T+       +S+  SIAT                    TR N         P+ S 
Sbjct: 335 SGYQTQYNEDTHSISDP-SIATHEHGNDADLERVLSRTSNSMTRFNSNNDLDPIAPQLSK 393

Query: 340 GHVNDDGVPVGLTD------ESNAQEA----ETGSKTRAHIKSISEKQMAIGLGIYHGRH 389
            H  D      L +      E+N +E     ET +K+    +S  +K        Y  RH
Sbjct: 394 IHSYDPRQEQMLREYEAKRVENNLEEELSRMET-AKSNHTARSDGDKIEQTRFQKY--RH 450

Query: 390 TIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAY-KDIYGFSSASVGL 448
               + +  L+      YP +L      A +   L  ++  +++ Y +  Y FS   +GL
Sbjct: 451 LAYLYLIRPLKSLYFLEYPPVLLAITFSAISFAVLYFVNMTLEYGYSRPPYNFSPMLIGL 510

Query: 449 VYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRL-FMVLPAVLCNAIGLLGFG 507
           +YI   +   L S+  G  +D N  L     HG   PE R+ + ++ AV+   I LL FG
Sbjct: 511 MYIPNSVTYLLASVFGGMWTD-NLLLKYKAKHGEMVPEARISWNIVTAVIAFPISLLIFG 569

Query: 508 WSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAV 567
           W L++ +HW  P +   + G+ + M     ++Y VDS        +   N+V+ +L  A 
Sbjct: 570 WCLDKGEHWETPLVGTALFGYANMMTIGATVSYLVDSLPGKGATGVALNNLVRQVLAAAA 629

Query: 568 SFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCR 609
            F       +     +FT  A I I      + L ++G   R
Sbjct: 630 VFVTDPMLDNMTIGWSFTMLAFIIIGATSVLVVLKKYGDHWR 671

>Ecym_4506 Chr4 complement(1013521..1015467) [1947 bp, 648 aa] {ON}
           similar to Ashbya gossypii ACL172C
          Length = 648

 Score =  110 bits (274), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 118/518 (22%), Positives = 211/518 (40%), Gaps = 53/518 (10%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
           KD   +P   +   +  V + C +G   T+++      +  E       +S  +G  +  
Sbjct: 96  KDARKYPKTTKGFIVFFVAFACSMGPMGTNIIYPVLVPIEKEFNTTPFMVSLSMGIYLAF 155

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
           LG+  ++ S  +   G+R VY+V   + ++ +IG A S      ++ R++ G   ++V+S
Sbjct: 156 LGLLPLWWSSFSERKGRRSVYVVSFTLTLVFTIGAALSKDITTFIVLRMLCGASSASVQS 215

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + + TIA++Y   ER   LG +               S++    S     W L I+AG+N
Sbjct: 216 VGAGTIADLYIPEERGRSLGYFYLGPLLCPLIAPIVGSILVNFWSWRSTQWFLVILAGAN 275

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVR------GLSENVSIATVRSTRLNPRE 337
            VL + F+PET   +        + + ++ R            ++ S    R   + P  
Sbjct: 276 IVLIVCFLPETLRTQDNKAIIAKILQEKLKRNANTSELGGSTCDDSSQTEGRRNAIAPNV 335

Query: 338 SAGHVNDD------------------GVP------------VGLTDESNAQEAETGSKTR 367
              H + D                  GVP            VG   E + Q A   S   
Sbjct: 336 DLPHSSQDVERIMTHISDSIHIHRDPGVPELSLICSHDPRVVGNVLEGDLQRAR--SNVE 393

Query: 368 AHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV---LFSYPAILFGAWLYAYAVVSL 424
            H+  ++++   +G+    G+       + +L+P        YP +       A    +L
Sbjct: 394 KHLDKLADEGSNVGILKRMGKLGY----LYLLQPLNSLHFLRYPPVFLAIIYSAITFATL 449

Query: 425 IIISQVIDHAYKD-IYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAH--NHG 481
             ++  I ++Y +  Y F    +GL+YI   +   + S+  GR  D    LL  +   HG
Sbjct: 450 YFVNMTISYSYSNPPYNFKPLYIGLLYIPLSLAYIITSIYGGRLID---ELLKRYKEKHG 506

Query: 482 IYEPEFRL-FMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITY 540
              PE RL + ++ A +   I L   GW L+++ HW +P I   + GF S +     +TY
Sbjct: 507 FLAPESRLSWNMVFAAIAFPISLSICGWCLDKKVHWALPLIGTALFGFASMVTIGAIVTY 566

Query: 541 AVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHE 578
            VDS       A+   N+V+ +L  AV+ F  +  L++
Sbjct: 567 LVDSLPGKGATAIALNNLVRMLLA-AVAVFVTEPMLNK 603

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score =  108 bits (270), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 128/557 (22%), Positives = 217/557 (38%), Gaps = 46/557 (8%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
           +D   +P   + + LV V + C +G   TS++      +  +       +S  VG  + +
Sbjct: 84  RDARLYPPRVKKLILVIVAFACILGPMGTSIIYPAIGTIMQDFGTSRFLVSVSVGTYLAA 143

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
           LG+  I+ S  A   G+R VY++   + ++ S+G A S +    +I R++ G   ++V+S
Sbjct: 144 LGIFPIWWSSLADKNGRRTVYVLSFALLVVFSVGTAFSRNIETFIILRILCGAASASVQS 203

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + + TIA++Y   ER   LG Y               SL+    S     W + I+A   
Sbjct: 204 VGAGTIADLYVPEERGRNLGYYYLGPLMAPLLSPIVSSLLVNRWSWRSTQWFMVILAALT 263

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           F+L +  +PET   +    NK  +   RI R+ R      + AT   + L P   + H +
Sbjct: 264 FLLLVFALPETLRTQD---NKELV--ARILRECRKQGSASAPATPADSALPPSLHSTHAD 318

Query: 344 -----------------------------DDGVP-VGLTDESNAQ-EAETGSKTRAHIKS 372
                                        D G P +     SN + E     + R  +++
Sbjct: 319 LASLDSAAADLASQLTDTVALYDAQRNFVDLGAPSLSRIHSSNPRVEGRILQQDRERLRT 378

Query: 373 ISEKQMAIGLGIYHGR--HTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQV 430
             E+ ++      H R    +  + +  LR      YP +L           ++ +++  
Sbjct: 379 GLERAISQQAPRPHQRLARELHFYLLRPLRSLYFLRYPPVLLAVLYNGACFAAVYVVNLT 438

Query: 431 IDHAY-KDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRL 489
           I++ Y +D Y      +GL+YI         ++  GR  D   R      HG+  PE RL
Sbjct: 439 IEYCYSRDPYNMRPLYLGLLYIPNAATYIFSAIYGGRWVDALLRRY-TRRHGVGVPEARL 497

Query: 490 -FMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEF 548
            + V  A     + LL  GW L  +  W +P I     G  + +       Y VDS    
Sbjct: 498 SWNVALAAALLPLSLLAIGWPLHCKAPWPVPLIGTAFFGLAAMLIIGAITAYLVDSLPAR 557

Query: 549 SQEALVTLNMVKNILGFAVSFFNVKFCLHE-GYKNAFTCYALIEIFIGLWAIPLYRWGKL 607
               +   N+++ +L  AV  F +   LH  G     T +A + +  GL   PLY   + 
Sbjct: 558 GATGVALNNLIRMLLA-AVCVFVLDAMLHRMGPGWTMTLFAALLVCSGL---PLYILKRK 613

Query: 608 CRSWTNRKNLLQFSYRV 624
              W    +L     RV
Sbjct: 614 SSYWREHYDLQHLYDRV 630

>NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570
          Length = 530

 Score =  102 bits (253), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 110/470 (23%), Positives = 186/470 (39%), Gaps = 40/470 (8%)

Query: 126 FVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYL 185
           F+G    ++       L  +  V  + I+  V   M    VG +F    A + G++++Y+
Sbjct: 79  FLGPLSGNIYIPALPTLQKDFNVSSTVINATVSVFMAVFAVGPLFWGLFADVGGRKVLYI 138

Query: 186 VGILIFMIGSIGCAC-STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGI 244
             IL+ +I +I  A      + L + R+V  FG S+V +L + T+ +I    +R   +G 
Sbjct: 139 CSILLMVIVNILLASIPAHISSLFVLRIVQAFGSSSVITLGAGTVTDITPPKQRGRAIGY 198

Query: 245 YTXXXXXXXXXXXXXXSLVFEHLST-HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPN 303
           +                L+    +   WLF +  I+ G   +L + F+PET   R  V N
Sbjct: 199 FMIGPNMGPVLAPIIAGLILMKGNYWRWLFGLTGIMGGVGLLLIVAFLPETL--RCIVGN 256

Query: 304 KRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETG 363
                + R  +    L  +  I   R  R  PR +     D G+             +  
Sbjct: 257 ADPGWDERRLK----LRRDDDIEFSRPIRKTPRWT--FFTDLGI-------------QKP 297

Query: 364 SKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVS 423
             T    K +  K     +  Y        W M+   P V+ S    L  +  YA +V  
Sbjct: 298 RNTTTEFKELYPKPPRPNVHFY--------WDMLKFPPVVIASVSTALLFSNYYALSVS- 348

Query: 424 LIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSD-VNTRLLAAHNHGI 482
                  + H  +  Y  S   +GL Y+ P +    GS + G  SD +  R +  H    
Sbjct: 349 -------LSHFLERDYKLSMLKIGLSYVCPGVCMIFGSQLGGHLSDHLRARWIKTHEGQS 401

Query: 483 YEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAV 542
           +  E RL + +  +L N  G +G+GW++++  H  I  +F G++ FG + CS T +TY  
Sbjct: 402 FPLESRLVLHICGILINTAGCIGYGWAIQKHFHLAIVLLFSGLMAFGLTWCSNTTMTYLS 461

Query: 543 DSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEI 592
           +     +  A+   +  +N+     S   +  C H G    FT   L  I
Sbjct: 462 ELMTTKTAGAIALSSFFRNVGAAISSSIILILCKHMGIGWCFTGLGLCNI 511

>ZYRO0F14652g Chr6 complement(1207106..1208806) [1701 bp, 566 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 566

 Score = 98.6 bits (244), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 120/516 (23%), Positives = 201/516 (38%), Gaps = 47/516 (9%)

Query: 87  KKTKKGIILNPQPSECKKD------PLN-WPIWRRDIALVCVGWHCFVGGGQTSMLASGF 139
           +  KK   L+P P    KD      P   +   +R +    V +  F+G    ++     
Sbjct: 64  ESVKKVSSLSPTPQNGLKDFALDDEPYTCFTRLQRMVIFAIVIFIGFLGPMAGNIYIPAL 123

Query: 140 SKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCA 199
             L  +  V  + I+  V   M    VG +F    A   G++ +Y+  IL+ +I +I  A
Sbjct: 124 PLLQQKFNVGSTTINSTVSAFMAVFSVGPLFWGMFADSTGRKFLYITSILLLIIVNILLA 183

Query: 200 -CSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXX 258
               +   L + RV   FG S+  SL + T+ +I     R   +G +             
Sbjct: 184 SVPANIGALYVLRVFQAFGSSSAISLGTGTVTDITPPKHRGKAIGYFMMGPNMGPILAPI 243

Query: 259 XXSLVF-EHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVR 317
              L+  E  +  WLF   +I++G  F+  +L +PET        ++R    +     V 
Sbjct: 244 ISGLILMESDAWRWLFGFTSIMSGIAFIAVVLILPETLRCIVGNGDQRWKKSSNFGTMVD 303

Query: 318 GLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQ 377
              EN+      + RL P             VG+    N         T    + +  + 
Sbjct: 304 EDVENLGHVEPPAWRLFPD------------VGIQKPVN---------TGPRFQFLYPRP 342

Query: 378 MAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKD 437
               L IY        W M+ + P  + S    L  A  YA++V         + H  + 
Sbjct: 343 SKPSLRIY--------WNMMKMMPVTISSISTALLFANYYAFSVT--------LSHFLQT 386

Query: 438 IYGFSSASVGLVYIAPFIGGCLGSLIAGRGSD-VNTRLLAAHNHGIYEPEFRLFMVLPAV 496
            Y  S+  VG  Y+ P I   +GS   G  SD +  R +  H +  +  EFRL + +  +
Sbjct: 387 DYNMSNLQVGASYVCPGIAMLIGSQSGGHLSDYMRQRWMKNHENQKFPLEFRLILQIFGI 446

Query: 497 LCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTL 556
           L N +G +G+GWS++R  H  +  +F  +  FG + CS T +TY  +     +  A+   
Sbjct: 447 LINMLGCIGYGWSIDRHYHLAVILVFSALSAFGLTWCSNTTMTYLSELLTRRTAGAIAVS 506

Query: 557 NMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEI 592
           ++ +N+     S   +K C   G    FT   L  +
Sbjct: 507 SLFRNVGATISSAIIIKLCRAMGIGWCFTGLGLCNL 542

>Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON}
           (117855..119801) [1947 nt, 649 aa]
          Length = 648

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 94/428 (21%), Positives = 171/428 (39%), Gaps = 37/428 (8%)

Query: 142 LSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC- 200
           L     V  + I+  V   M    +G +     A + G++ +YL  +L+  I +I  A  
Sbjct: 198 LQKAFNVSTTTINSTVSVFMAVFAIGPLIWGHFADICGRKWLYLCSLLLMTIVNILLASL 257

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
                 L   R+   F  S+V S+ + T+ +I     R   +  +               
Sbjct: 258 PAKIGLLYFLRIFQAFSSSSVMSMGAGTVTDITAPKHRGKAIAYFMMGPNMGPIVAPIIA 317

Query: 261 SLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKR-----SLHETRIARQ 315
            ++  + +  WLF   +I++G  F L L+F+PET        +KR     + +  +   +
Sbjct: 318 GVILINDNWRWLFGFTSIMSGVAFFLVLVFLPETLRCMVGNGDKRWIKHKNNNNNQYKNE 377

Query: 316 VRGLSENVS-IATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSIS 374
              + +N S ++ + S  +    +    ++ G+   +TD+   Q            K   
Sbjct: 378 KMAMKDNKSDLSAIESQTIQKDSNWQFFSNIGIQKPVTDDPTFQ------------KLYP 425

Query: 375 EKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHA 434
             Q A       G HT           F L  YP +L  +   A    +    S    + 
Sbjct: 426 RPQKA-------GIHTY----------FSLLKYPPVLITSIGTALLFANYYAFSVTFSYY 468

Query: 435 YKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSD-VNTRLLAAHNHGIYEPEFRLFMVL 493
            +  YG+SS   GL YI P +   +GS   G  SD +  R +  H +  +  EFRL++ +
Sbjct: 469 LQTQYGYSSFKTGLAYICPGVAMLIGSQTGGHLSDYIRARWIKTHENRRFPSEFRLYLQI 528

Query: 494 PAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEAL 553
             ++ N  G +G+GW++++ +  I   +F  +  FG + CS T +TY  +     +  A+
Sbjct: 529 WGIVINTAGCIGYGWTIQKHNSIIWSYVFAAMNAFGLTWCSNTTMTYLTELLARRAATAV 588

Query: 554 VTLNMVKN 561
               M +N
Sbjct: 589 ALSTMFRN 596

>KAFR0I00710 Chr9 (139612..141339) [1728 bp, 575 aa] {ON} Anc_8.570
           YBR180W
          Length = 575

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 116/477 (24%), Positives = 192/477 (40%), Gaps = 43/477 (9%)

Query: 142 LSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIF-MIGSIGCAC 200
           L  E  V  + I+  V   M    VG +F    A + G++++YL+ +L+  +I  +    
Sbjct: 124 LQIEYNVSSTTINATVSVFMAVFAVGPLFWGMFADVGGRKILYLISLLLMTLINVLLSVL 183

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
            T+   L + R++  F  S+V +L + TI +I     R   +G +               
Sbjct: 184 PTNIAALFVLRILQAFSSSSVITLGAGTITDITPPKHRGKAIGYFMIGPNMGPIVAPIIA 243

Query: 261 SLVFEHLST-HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGL 319
            L+    +   WLF   +I++G  F++ L+F+PET   R  V N       R  +   G 
Sbjct: 244 GLILMKGNYWRWLFGFTSIMSGVAFIVVLIFLPETL--RCKVGNGDP--GWRSTQADSGS 299

Query: 320 SENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMA 379
            E + +   R+      +     +D GV   ++     +E        +           
Sbjct: 300 EEGIDLP--RALYAPEYKRWTFFSDIGVRKPVSSHPQFKEQYPAPPKPS----------- 346

Query: 380 IGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIY 439
             L +Y        W ++ + P  L S    L  A  YA++V           H  KD Y
Sbjct: 347 --LTLY--------WHLIKIAPVTLTSISTALLFANYYAFSVT--------FSHFLKDEY 388

Query: 440 GFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYE-P-EFRLFMVLPAVL 497
            FS  ++G  Y+ P I   LGS I G  SD  TR +   NH   E P E RL + +  ++
Sbjct: 389 NFSQLAIGAAYVCPGIAMLLGSQIGGHLSD-KTRSIWIKNHEGQEFPLELRLALQMWGII 447

Query: 498 CNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLN 557
            N +G +G+GWS++ + H  I  +F   L  G +  S T +TY  +   + +   +   +
Sbjct: 448 LNTVGCIGYGWSIQHKYHIAIILMFSAFLALGMTWTSNTTMTYLTELLAQRAASTVALSS 507

Query: 558 MVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNR 614
             +NI     S   VK     G    FT   L  +   ++   L R+  L   W N+
Sbjct: 508 FFRNIAAAIGSAIIVKLYTIMGVGWCFTGLGLCNLISLMFNWYLVRYSGL---WQNK 561

>Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138C
           (TPO2) -  [contig 96] FULL
          Length = 597

 Score = 96.7 bits (239), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 106/516 (20%), Positives = 201/516 (38%), Gaps = 79/516 (15%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
           +DP NWP  ++    + +G  CF     ++++       +A   V +  +   V  M+  
Sbjct: 110 EDPRNWPTRQKWNYTILLGIICFDVAMMSAIITGDMDSPAAYFGVSMEVMCLCVSLMVWG 169

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
            G+G +F +P +  FG+  VYL+ +LI ++  + C  + +   LL  R + G   S    
Sbjct: 170 FGIGPMFFAPLSEEFGRNPVYLITLLIAVVFIVPCGAAKNIGTLLAFRFLDGLAFSAPMC 229

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           L   ++++++   ER   + +++              SL+  + S  W++W + I++G  
Sbjct: 230 LIGGSLSDMWRNKERGVAMSLFSAAPFLGPVMGPIVGSLLSVYCSWRWVYWFMVILSGCL 289

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           + +  +F+PET             H+T + ++ + L E     + R+             
Sbjct: 290 YAVMAVFMPETH------------HQTLLKKRAKKLREITGDPSYRAL------------ 325

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISE--KQMAIGLGIYHGRHTIDNWCMVMLRP 401
                                 +   ++SI+E  K+ A+   I           +  L  
Sbjct: 326 ----------------------SEIKVRSINEIVKETALRPAI----------LLTELIV 353

Query: 402 FVLFSYPAILFG---AWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGC 458
           F++  Y ++++G    + +AY +V            Y +   F      +++I   +G  
Sbjct: 354 FLITMYMSVIYGLLYMFFFAYPMV------------YTEGKHFGPVKTSIMFIPIGVGVI 401

Query: 459 LGSLIAG-RGSDVNTRLLAAHNHGIYEP-EFRLFMVLPAVLCNAIGLLGFGWSLERQDHW 516
             ++IA    +D   R     + G   P E RL  ++        GL  + WS   +  W
Sbjct: 402 CSTVIAPFLNNDYLKRAQRYLDRGEIPPAELRLIPMMIGCWFVPAGLFSYAWSSFPRLSW 461

Query: 517 IIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCL 576
             P       G G +M    A  Y VDSY+ ++   L     V+++ G AV  F ++   
Sbjct: 462 AGPCFSGFACGLGFNMLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGGAVPLFTIQMYH 521

Query: 577 HEGYKNAFTCYALIEIFIGLWAIP--LYRWGKLCRS 610
              Y+ A T  A I   +   AIP   Y +G   R 
Sbjct: 522 RLNYEWASTLMAFIS--LACCAIPYLFYFYGARIRQ 555

>TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.570
           YBR180W
          Length = 653

 Score = 95.9 bits (237), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 122/544 (22%), Positives = 205/544 (37%), Gaps = 57/544 (10%)

Query: 113 RRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFAS 172
           +R +    V +  F+G    ++       L        + I+  V   M    VG IF  
Sbjct: 108 QRMVMFFIVIYVGFLGPMSGNIYIPALPTLQKAFHTNTTVINATVSAFMGVFAVGPIFWG 167

Query: 173 PTAVLFGKRLVYLVG-ILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAE 231
             A + G++ +YL   IL+ +I  +      +   L + RV   FG S+V +L S T+ +
Sbjct: 168 VYADVCGRKWLYLCSLILVTVINLLLAVLPANLASLFVLRVFQAFGSSSVITLGSGTVTD 227

Query: 232 IYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST-HWLFWILTIIAGSNFVLHLLF 290
           I     R   +  +                L+  +     WLF    I++   F+L L+F
Sbjct: 228 ITPMKHRGKAIAYFMLGPNMGPILGPIIAGLILINGDYWRWLFGFTCIMSAIGFLLVLIF 287

Query: 291 VPETF----------WDRTPVPNKRSLHETRI------ARQVRGLSENVSI----ATVRS 330
           +PET           W  +   ++++   TR        +Q   +  N ++     T+ S
Sbjct: 288 LPETLRCIVGNGDPRWRNSKEISQQTKSGTRADSLVESEKQPETVVTNSNVESKSTTLSS 347

Query: 331 TRLNPR------ESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGI 384
             LNP+      E      DD       +++N   +E  S   A  K +  +  A+ LG 
Sbjct: 348 LNLNPKKMTNSSEQVFGTGDD------KEDNNKPISEEMSACVAGEKDLEAQGHAVKLGD 401

Query: 385 -YHG----------RHTIDNWCMVMLRP----------FVLFSYPAILFGAWLYAYAVVS 423
            YH           +   D+     L P          + +F  P +   +   A    +
Sbjct: 402 NYHKWQLFANIGIQKPVCDDEIFKALYPRPTKPTLVAYYNIFKSPPVFISSIGTALLFAN 461

Query: 424 LIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDV--NTRLLAAHNHG 481
               S        D Y FS    GL +I P +    GS I G  SD   N  LL      
Sbjct: 462 YYAFSVTFAKFLTDYYHFSRLGSGLAFICPGVAMIFGSQIGGHLSDYLRNRWLLKNSTDC 521

Query: 482 IYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYA 541
            Y  E RL + + A++ N++G++G+GWS+E++   ++   F   + F  + CS T +TY 
Sbjct: 522 KYPIEKRLQLQIIAIVVNSLGIIGYGWSIEKRLDIVLVFFFAACISFSLTWCSNTTMTYL 581

Query: 542 VDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPL 601
            +     +  A+   +  +N      S   V  C   G    FT   L+ I   L  + L
Sbjct: 582 TELLARRTSAAISISSFFRNTAAAISSVIIVILCDKMGIGWCFTGLGLLNIVPFLGVLYL 641

Query: 602 YRWG 605
            ++G
Sbjct: 642 LQYG 645

>Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 102/448 (22%), Positives = 178/448 (39%), Gaps = 44/448 (9%)

Query: 142 LSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGI-LIFMIGSIGCAC 200
           L  E  V  + I+  V   M    VG +F    A   G++ +Y+V + L+  +  I  A 
Sbjct: 137 LQREFDVSATTINSTVSAFMAVFSVGPLFWGALADFGGRKFLYMVSLSLMLAVNIILAAV 196

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
             +   L + RV   F  S+V SL + T+ ++     R   +  +               
Sbjct: 197 PANIAALFVLRVFQAFASSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPNMGPIIAPIVA 256

Query: 261 SLVFEHLST-HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGL 319
            L+    +   WLF   +I+AG   +L    +PET   R  V N     + +   + +G+
Sbjct: 257 GLILMKGNYWRWLFGFTSIMAGIALILVTALLPETL--RCIVGN----GDPKWCERKKGV 310

Query: 320 SENVSIATVRSTRLNPRESAGHVNDD-GVPVGLTDESNAQEAETGSKTRAHIKSISEKQM 378
              V  ++ R        S  H+  D G+   +T++   Q+                K  
Sbjct: 311 EGKVLPSSQRRGL-----SRWHLFPDMGIRKPVTNDPFFQQKY-------------PKPP 352

Query: 379 AIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDI 438
             G  +Y        W MV   P ++ S    L  +  YA++V           +  ++ 
Sbjct: 353 KAGFTLY--------WKMVKCPPVIITSVSTALLFSSYYAFSVT--------FSYYLEND 396

Query: 439 YGFSSASVGLVYIAPFIGGCLGSLIAGRGSD-VNTRLLAAHNHGIYEPEFRLFMVLPAVL 497
           Y F+   +G  Y+ P +   LGS   G  SD + +R +  H    +  EFRL + L  +L
Sbjct: 397 YHFTMLEIGAAYVCPGVAMLLGSQSGGHLSDYLRSRWIKTHPEKKFPAEFRLILNLVGIL 456

Query: 498 CNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLN 557
               G +G+GWS+    H+++  +F  +  FG + CS T++TY  + + + +   +   +
Sbjct: 457 LTMGGTVGYGWSIFFHHHFVVLLVFSSLTAFGMTWCSNTSMTYLTELFPKRAAGTVAVSS 516

Query: 558 MVKNILGFAVSFFNVKFCLHEGYKNAFT 585
             +NI     S   +K C   G    FT
Sbjct: 517 FFRNIGAAISSAIILKLCKAMGTGWCFT 544

>TPHA0E03200 Chr5 complement(677352..679232) [1881 bp, 626 aa] {ON}
           Anc_5.180
          Length = 626

 Score = 93.2 bits (230), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 120/559 (21%), Positives = 214/559 (38%), Gaps = 103/559 (18%)

Query: 103 KKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMML 162
           + DP  W    +    V +G  CFV    ++++    +  +A   V    I   V  M+ 
Sbjct: 141 RDDPRTWDARIKWNITVLLGIICFVVAMMSAVVTGDINAPAAHFGVSEEVIILTVSLMVW 200

Query: 163 SLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVE 222
             G+G +  +P +   G+  +Y   + + +I  I CA + +   LL  R + G   S   
Sbjct: 201 GFGLGPLVFAPLSEELGRNWIYCTTLFVAVIFIIPCAVAQNIGTLLAFRFLDGLAFSAPM 260

Query: 223 SLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGS 282
            +   ++++I+   ER   + I++              SL+  +    W++  + I++G 
Sbjct: 261 CIIGGSLSDIWRTEERGIAMSIFSAAPFLGPVMGPIVGSLLTVYCGWRWVYIFMIILSGC 320

Query: 283 NFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHV 342
            + +  +F+PET             H+T + R+ + L                R+  G  
Sbjct: 321 LYAVLFVFLPETH------------HQTILKRRAKKL----------------RKLTG-- 350

Query: 343 NDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPF 402
                     D+S    +E   +T   I + S                       +LRP 
Sbjct: 351 ----------DQSYRAVSEIKVRTLKEIANDS-----------------------LLRPL 377

Query: 403 VLFS---------YPAILFG---AWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVY 450
           +L S         Y AIL+G    + +AY VV            Y +  G+S     +++
Sbjct: 378 ILLSELIVFLVTMYMAILYGLLYMFFFAYPVV------------YSEGKGWSDIKTSIMF 425

Query: 451 IAPFIGGCLGSLIAGR-GSDVNTRLLAAHNHGIYEP-EFRLFMVLPAVLCNAIGLLGFGW 508
           I   +G  +G+ ++     D N R     + G   P E RL  ++       IGL  + W
Sbjct: 426 IPIGVGVLIGTAVSPLFNMDYNRRAQRFIDKGEIPPAELRLIPMMYGCAFVPIGLFCYAW 485

Query: 509 SLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVS 568
           +      W  P       G G  +    A  Y VDSY+ ++   L     V+++ G +V 
Sbjct: 486 TSFPHVSWAGPCFSGFACGLGFVLLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGGSVP 545

Query: 569 FFNVKFCLHEGYKNAFTCYALIEIFIGL--WAIP--LYRWGKLCR-----SWTNRKNLLQ 619
            F ++     GY+ A T  A    FIGL   AIP   YR+G   R     +++   ++++
Sbjct: 546 LFTIQMYHRLGYEWASTLMA----FIGLACCAIPFLFYRYGATIRKRSKYAYSPSVDVVK 601

Query: 620 FSYR-VNDDGKDEKDNHTE 637
            +   V ++   E  N+TE
Sbjct: 602 VTAEDVENNSNKETTNNTE 620

>Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]
           {ON} YBR180W (DTR1) - dityrosine transporter MFS-MDR
           [contig 22] FULL
          Length = 567

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 102/446 (22%), Positives = 184/446 (41%), Gaps = 48/446 (10%)

Query: 151 SQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIG-CACSTSFNWLLI 209
           + I+  V   M    VG +  +  A   G++++Y++ +L+ +I ++   A   +   L  
Sbjct: 146 TTINATVSVFMAVFAVGPLIWASFADFGGRKILYMISLLLTVIVNVLLAAVPVNTGALFF 205

Query: 210 SRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST 269
            RV+  F  S+V +L + T+++I     R   +  +                L+    S 
Sbjct: 206 LRVMQAFASSSVMALGAGTVSDIRPPQVRGKAIAYFMLGPNMGPILAPIIAGLILMRGSY 265

Query: 270 -HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATV 328
             WLF   +I++G   +  ++F+PET   R  V N        I  +   + EN+ I T 
Sbjct: 266 WRWLFGFTSILSGIGLIAVIVFLPETL--RCIVGNG---DPKWIDTEDEVVGENLGITTG 320

Query: 329 RSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGR 388
                +         D GV   L   S + E           + +  +     L +Y   
Sbjct: 321 NMKLFS---------DIGV---LKPVSKSPE----------FQKLYPRPPKPSLTVY--- 355

Query: 389 HTIDNWCMVMLRPFVLFSYP-AILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVG 447
                W ++   P  + S   AILF A+ YA++V           H  +  Y  S+  +G
Sbjct: 356 -----WVLLKYLPVTICSVTTAILFAAY-YAFSVT--------FSHFLRQDYSLSNLQIG 401

Query: 448 LVYIAPFIGGCLGSLIAGRGSDVNTRL-LAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGF 506
             Y+ P +   LGS++ G  SD    + +  HN   +  E RLF+ +  +L NA G +G+
Sbjct: 402 ACYVCPGVALLLGSVLGGHMSDHFRHMWIKRHNGAEFPSEKRLFLQIWGLLLNAGGCIGY 461

Query: 507 GWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFA 566
           GWS++   H  +  +F  ++ FG + CS T++TY  +   + +   +   +  +N+    
Sbjct: 462 GWSIQFHHHLAVVLVFSFLMAFGMTWCSNTSMTYLTECIPKRAAGTVAVGSFFRNLAAGI 521

Query: 567 VSFFNVKFCLHEGYKNAFTCYALIEI 592
            S   +K C   G    FT  A  ++
Sbjct: 522 SSVIVMKLCSEMGIGWCFTGLAFCDV 547

>CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180w DTR1
          Length = 542

 Score = 89.0 bits (219), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 112/532 (21%), Positives = 206/532 (38%), Gaps = 60/532 (11%)

Query: 77  QESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIA------------LVCVGWH 124
           QE   SD ++ K     +   Q    K+ PL    + RDI              + V ++
Sbjct: 34  QEVDLSDPNIDKNDTFEL--RQQVSIKESPL---YYLRDIPYSAYTSFQVSLIFLIVIYN 88

Query: 125 CFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVY 184
            F+G    ++       L  E  V  + I+  V   M +  +  +F    A   G++++Y
Sbjct: 89  GFLGPLAGNVFIPALPLLQKEFNVSETTINATVSVFMATFSISPLFWGALADKGGRKILY 148

Query: 185 LVGI-LIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLG 243
           ++ I L+ +I  +  +       L+  R++  F  S+V SL + T+A++    +R   + 
Sbjct: 149 IISISLMVIINILLASVPKKIGSLIFLRIIQAFASSSVISLGAGTVADLTPPKDRGKAMA 208

Query: 244 IYTXXXXXXXXXXXXXXSLVF-EHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVP 302
            +                L+  ++ +  WLF  L I++G   ++ +L +PET   R  V 
Sbjct: 209 YFMLGPNLGPILAPIIAGLILLDNNNWRWLFGFLCIVSGLGLIMVILLLPETL--RCIVG 266

Query: 303 NKRSLHETRIARQVRGLSENVSIATVRSTRLN-PRESAGHVNDDGVPVGLTDESNAQEAE 361
           N          RQ    S+N +  + +    + P      V+D G               
Sbjct: 267 NGD--------RQWENWSQNENDMSTQPVDFSSPISRWSFVSDIG--------------- 303

Query: 362 TGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAV 421
                   +  I++  +  GL  +  + ++  +  +M       ++P ++  +   A   
Sbjct: 304 -------FLNPITQDSIFKGLYPHPPKFSVWTYLRIM-------TFPPVILTSIANALLF 349

Query: 422 VSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHG 481
            +   IS  + H     Y +S+  +G  Y+ P +   LGS I G  SD   +     N+ 
Sbjct: 350 CTYYSISVTLSHFLATEYSYSNLKIGACYVCPGVCMLLGSQIGGHLSDSMRKSWKKENYN 409

Query: 482 IYEP-EFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITY 540
              P EFRL + +  VL    G +G+GW ++   H     +F G++ FG + C+ T +TY
Sbjct: 410 TEYPLEFRLILTVCGVLLAIGGSIGYGWCIQFHYHISAVLVFAGLMAFGLTWCNNTIMTY 469

Query: 541 AVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEI 592
             +        A+   +  +NI     S    K C   G    F    LI +
Sbjct: 470 LSELLSLRVSSAIAVSSFFRNIAAAISSALIAKLCQKMGIGFCFLGLGLINL 521

>KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 566

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 95/445 (21%), Positives = 177/445 (39%), Gaps = 45/445 (10%)

Query: 151 SQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCA-CSTSFNWLLI 209
           + I+  V   M    VG +  +  A   G++++Y++ +L+ ++ ++  A    +   L  
Sbjct: 144 TAINATVSVFMAVFAVGPLIWASFADFGGRKILYMISLLMTVVVNVLLASVPVNVGALFT 203

Query: 210 SRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST 269
            RVV  F  S+V +L + T+++I     R   +  +                L+  H S 
Sbjct: 204 LRVVQAFASSSVMALGAGTVSDIRPPKVRGKAIAYFMLGPNMGPILAPIIAGLILMHGSY 263

Query: 270 -HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATV 328
             WLF    I++G   ++ ++ +PET   R  V N           + R   E  +I   
Sbjct: 264 WRWLFGFTCILSGFGLLMVVVLLPETL--RCIVGNGDI--------KWRDCEEKDNIGPT 313

Query: 329 RSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGR 388
           R+  +                GL   S+    +  S      + +  +     L +Y   
Sbjct: 314 RTISV---------------AGLLIFSDIGVVKPAS-VSPQFQKLYPRPPKPSLAVY--- 354

Query: 389 HTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGL 448
                W ++   P  + S    +  A  YA++V           H  ++ YG ++  +G 
Sbjct: 355 -----WKLLKFLPVTICSITTAILFATYYAFSVT--------FSHFLREDYGLTNLQIGA 401

Query: 449 VYIAPFIGGCLGSLIAGRGSDVNTRL-LAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFG 507
            Y+ P +   LGS+I G  SD   +L +  HN   +  E RL + +  +L N  G +G+G
Sbjct: 402 CYVCPGVALLLGSIIGGHLSDYFRKLWVKRHNGEKFPSEKRLVLQIWGLLLNICGCVGYG 461

Query: 508 WSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAV 567
           WS++   H ++  +F     FG + CS T++TY  +     +   +   +  +N+     
Sbjct: 462 WSVQFHHHLVVVLVFSFFTAFGMTWCSNTSMTYLTECVPRRAAGTVAVGSFFRNLAAGIS 521

Query: 568 SFFNVKFCLHEGYKNAFTCYALIEI 592
           S   +K C   G    FT  A  ++
Sbjct: 522 SVIVMKLCDKMGVGWCFTGLAFCDL 546

>SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 667

 Score = 87.0 bits (214), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 102/209 (48%)

Query: 87  KKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAEL 146
           +K ++G++         KDP ++P   +   ++ + +   +G   TS++      ++++ 
Sbjct: 71  RKKRRGLLSQFSLIPEYKDPRDYPSILKKFIVLLIAYASMMGPMGTSIVFPAIGLITSDY 130

Query: 147 QVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNW 206
                 ++  VG  ++SLGV  ++ S  + L G+R VYLV   +     IG A S +   
Sbjct: 131 NTSTIMVNVSVGIYLISLGVFPLWWSSISELKGRRTVYLVSFTLLFAFCIGTAVSPNIQA 190

Query: 207 LLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEH 266
            +I RV+ G   ++V+S+ + TIA++Y   ER   LG +               SL+  H
Sbjct: 191 FIILRVLCGASSASVQSVGAGTIADLYAPEERGKNLGYFYLGALTAPLLSPIIGSLLVNH 250

Query: 267 LSTHWLFWILTIIAGSNFVLHLLFVPETF 295
            S     W + I+AG+N +L +LF+PET 
Sbjct: 251 WSWRSTQWFMVILAGANVILIVLFLPETL 279

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 91/205 (44%), Gaps = 3/205 (1%)

Query: 388 RHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAY-KDIYGFSSASV 446
           + T+  + +  L+      YPA+       A +  +L  ++  I++ Y +  Y F    +
Sbjct: 432 KKTLYIYLIRPLKSLHFLRYPAVSLAISFSAISFAALYFVNITIEYRYSRPPYNFKPLYI 491

Query: 447 GLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRL-FMVLPAVLCNAIGLLG 505
           GL+YI   +     S+  GR  D N        HGI  PE R+ + V+ AV+C  I LL 
Sbjct: 492 GLLYIPNSVTYIFASIYGGRWVD-NLLKSYKEKHGILAPEARISWNVVTAVICFPISLLI 550

Query: 506 FGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGF 565
           FGW L++++HW+ P +   + GF S M     ++Y VDS        +   N+++ I   
Sbjct: 551 FGWCLDKKEHWVTPLVGTALFGFASMMTIGATVSYLVDSLPGRGATGVALNNLIRQIFAA 610

Query: 566 AVSFFNVKFCLHEGYKNAFTCYALI 590
              F         G   AFT  A +
Sbjct: 611 TAVFVTEPMLEGMGTGWAFTMLAFV 635

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 87.0 bits (214), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 125/528 (23%), Positives = 203/528 (38%), Gaps = 101/528 (19%)

Query: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC 200
           +L  +  V  + ++  V   +L  G+    +   A  FG+R + L G+LI++I SIG AC
Sbjct: 126 QLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVIASIGLAC 185

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
           + S+  ++  R +   G+S   ++ S  + +    HER    G +               
Sbjct: 186 APSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHER----GTFVGATSGFVLLGQCFG 241

Query: 261 SLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQV 316
           SL+   L+  W    +FW LTI  GS F++  L +PET                      
Sbjct: 242 SLIGAVLTARWDWRAIFWFLTIGCGSCFLIAFLILPET---------------------K 280

Query: 317 RGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEK 376
           R ++ N+SI   R     P    G       PV    + +  + ET   T   +   S  
Sbjct: 281 RTIAGNLSIKPKRFINRAPIFLLG-------PVRRRFKYDNPDYETLDPTIPKLDLSSAG 333

Query: 377 QMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPA-ILFGAWLYAYAVVSLIIISQVIDHAY 435
           +                  +++L   +L  +P+ +LF  W         +++S +     
Sbjct: 334 K------------------ILVLPEIILSLFPSGLLFAMW--------TLMLSSISSGLS 367

Query: 436 KDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRL------------LAAHNHGIY 483
              Y +    +G+ Y+   IGG +GS   GR  D+  +             L   +  I 
Sbjct: 368 VAPYNYHLVIIGVCYLPGGIGGLMGSFFTGRIIDMYFKRKIKKFEQDKANGLIPQDAEIN 427

Query: 484 EPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCS----TTAIT 539
             + RL  +LP      +  L FGWS+++   W I SI   +  F  S C+    +T+ T
Sbjct: 428 MFKVRLVCLLPQNFLAVVAYLLFGWSIDK--GWRIESIL--ITSFVCSYCAMSTLSTSTT 483

Query: 540 YAVDSYKEFSQEALVTLNMVKNILG--FAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLW 597
             VD Y   S  A    N V+  L   F   F  +K  +  G    F C AL+  F  L 
Sbjct: 484 LLVDLYPTKSSTASSCFNFVRCSLSTIFMGCFAKMKAAMTVGGTFTFLC-ALVFFFNFLM 542

Query: 598 AIPL-----YRWGKLCR----SWTNRKNLLQFSYRVNDDGK-DEKDNH 635
            IP+     +R  +L +    SW N       + +     K D+ DNH
Sbjct: 543 FIPMKYGMKWREDRLLKQQRQSWLN-----TLAVKAKKGTKRDQNDNH 585

>AGR195W Chr7 (1120597..1122456) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR180W (DTR1)
          Length = 619

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 112/497 (22%), Positives = 191/497 (38%), Gaps = 46/497 (9%)

Query: 113 RRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFAS 172
           +R +    + +  F+G    ++       L  +  V  + I+  V   M    VG +  +
Sbjct: 157 QRSVIFAVIIFIGFLGPMAGNIYIPALPILEQDFAVSTTTINGTVSVFMAVFSVGPLLWA 216

Query: 173 PTAVLFGKRLVYLVGILIFMIGSIGCAC-STSFNWLLISRVVSGFGLSTVESLPSATIAE 231
             A   G++L+Y++ + + +I ++  A        L + RVV  F  S+  SL + T+++
Sbjct: 217 LHADFGGRKLLYVLSMGLNVIVNVLLAVMPARIGALFVLRVVQAFASSSALSLGAGTVSD 276

Query: 232 IYFAHERAYRLGIYTXXXXXXXXXXXXXXSLV-FEHLSTHWLFWILTIIAGSNFVLHLLF 290
           I     R   +  +                L+ F++    WLF   +I+AG  F+L  +F
Sbjct: 277 ITPPKNRGKAIAYFMLGPNAGPILAPIIAGLILFDNDRWRWLFGFTSIMAGIGFLLVCVF 336

Query: 291 VPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVG 350
           +PET   R  V N        +  ++ G +E       R  RL   +S G  +    PV 
Sbjct: 337 LPETL--RCIVGNGD------VRWRLAGFAEGRFDDYTRQPRLLLMKSFGIQH----PV- 383

Query: 351 LTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAI 410
                          T    + +  +     L  Y        W +V      + S    
Sbjct: 384 --------------STSPEFRRLYPRPPKPSLKTY--------WEIVKEPNLTICSLSTA 421

Query: 411 LFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDV 470
           L  A  Y ++V           H  K  YGFS+ ++G  Y  P +   +GSL+ G  SD 
Sbjct: 422 LMFATYYGFSVT--------FAHYLKLDYGFSNLAIGACYACPGVALMMGSLLGGHISDR 473

Query: 471 NTRLLAAHNHGIYEPEF-RLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFG 529
             R   A N G   P + RL   +  +  +  G +G+GW ++   H  I   F  ++  G
Sbjct: 474 FRRKWVAKNPGKTFPSYNRLISQVFGICVSMAGCIGYGWGIQFHYHIAIVLFFSFLMALG 533

Query: 530 SSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYAL 589
            + CS + +T+  +S  + +   +   N  +NI     S    K C   G    FT   L
Sbjct: 534 MTWCSNSTMTFLTESNPKRAAGTIAVSNSFRNIAAAISSAIIFKLCNAMGVGWCFTGLGL 593

Query: 590 IEIFIGLWAIPLYRWGK 606
           I++   L    L R G+
Sbjct: 594 IDLLSMLSVYYLIRNGR 610

>Skud_2.306 Chr2 (557166..558884) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 104/463 (22%), Positives = 183/463 (39%), Gaps = 60/463 (12%)

Query: 142 LSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGI-LIFMIGSIGCAC 200
           L  E  V  + I+  V   M    VG +F    A   G++ +Y+V + L+  +  +  A 
Sbjct: 137 LQREFDVSSTTINATVSAFMAVFSVGPLFWGALADFGGRKFLYMVSLSLMLTVNILLAAV 196

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
             +   L + RV   F  S+V SL + T+ ++     R   +  +               
Sbjct: 197 PANIAALFVLRVFQAFSSSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPNMGPIIAPIVA 256

Query: 261 SLVFEHLST-HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPN-------KRSLHETRI 312
            L+    +   WLF   +I+ G   +L   F+PET   R  V N       K+S  + + 
Sbjct: 257 GLILMKGNYWRWLFGFTSIMTGIALILVSAFLPETL--RCIVGNGDPKWGEKKSEADDKE 314

Query: 313 AR--QVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHI 370
               Q +G+S+          RL P        D G+   ++++   Q+           
Sbjct: 315 LSLPQKKGVSDR---------RLFP--------DMGIRKPVSNDPFFQQK---------- 347

Query: 371 KSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQV 430
                K    GL +Y        W M+   P ++ S    L  +  YA++V         
Sbjct: 348 ---FPKPPKAGLTLY--------WKMIKCLPILVTSISTALLFSSYYAFSVT-------- 388

Query: 431 IDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSD-VNTRLLAAHNHGIYEPEFRL 489
             +  ++ Y F+   +G  Y+ P +   LGS   G  SD + +R +  H    +  EFRL
Sbjct: 389 FSYYLENDYHFNMLEIGAAYVCPGVAMLLGSQSGGHLSDYLRSRWIKTHPKKRFPAEFRL 448

Query: 490 FMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFS 549
            + L  +L    G +G+GWS+    H+++  +F  +  FG + CS T++TY  + + + +
Sbjct: 449 LLNLIGILLTICGTVGYGWSIFFHYHFVVLLVFSALTAFGMTWCSNTSMTYLTELFPKRA 508

Query: 550 QEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEI 592
              +   +  +NI     S   +K C   G    FT  A+  +
Sbjct: 509 AGTVAVSSFFRNIGAAISSAIILKLCKAMGIGWCFTGLAICNL 551

>YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putative
           dityrosine transporter, required for spore wall
           synthesis; expressed during sporulation; member of the
           major facilitator superfamily (DHA1 family) of multidrug
           resistance transporters
          Length = 572

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 95/430 (22%), Positives = 173/430 (40%), Gaps = 43/430 (10%)

Query: 142 LSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGI-LIFMIGSIGCAC 200
           L  E  V  + I+  V   M    VG +F    A   G++ +Y+V + L+ ++  +  A 
Sbjct: 137 LQREYDVSATTINATVSVFMAVFSVGPLFWGALADFGGRKFLYMVSLSLMLIVNILLAAV 196

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
             +   L + R+   F  S+V SL + T+ ++     R   +  +               
Sbjct: 197 PVNIAALFVLRIFQAFASSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPNMGPIIAPIVA 256

Query: 261 SLVFEHLST-HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGL 319
            L+    +   WLF   +I+ G   +L    +PET   R  V N       +   +    
Sbjct: 257 GLILMKGNYWRWLFGFTSIMTGIALILVTALLPETL--RCIVGNGDPKWGDKKDERENNE 314

Query: 320 SENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMA 379
           S       +   RL P        D G+   + +++  QE                K   
Sbjct: 315 SPFFEGNKISHRRLFP--------DIGIRKPVNNDAFFQEN-------------FPKPPK 353

Query: 380 IGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIY 439
            GL +Y        W M+   P ++ S    L  +  YA++V      S  ++H Y+   
Sbjct: 354 AGLTLY--------WKMIKCPPIIITSVSTALLFSSYYAFSVT----FSYYLEHDYR--- 398

Query: 440 GFSSASVGLVYIAPFIGGCLGSLIAGRGSD-VNTRLLAAHNHGIYEPEFRLFMVLPAVLC 498
            F+   +G  Y+ P +   LGS   G  SD + +R + +H    +  EFRL + L  +L 
Sbjct: 399 -FTMLEIGAAYVCPGVAMLLGSQSGGHLSDYLRSRWIKSHPKKKFPAEFRLLLNLIGILL 457

Query: 499 NAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNM 558
              G +G+GW++    H+++  +F  +  FG + CS T++TY  + + + +   +   + 
Sbjct: 458 TICGTIGYGWAIFFHYHFVVLLVFSALTAFGMTWCSNTSMTYLTELFPKRAAGTVAVSSF 517

Query: 559 VKNILGFAVS 568
            +N+ G A+S
Sbjct: 518 FRNV-GAAIS 526

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 127/555 (22%), Positives = 216/555 (38%), Gaps = 91/555 (16%)

Query: 75  KGQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRR-------DIALVCVGWHCFV 127
           K  E  GS          I      +    +P NWP+W R        I ++CV +    
Sbjct: 137 KETEKSGSSGEENDLDPDIEFVTFVTNDPDNPHNWPLWLRWVYTVILSILVICVAYG--- 193

Query: 128 GGGQTSMLASGFSKLSAELQVPLSQISYL-VGPMMLSLGVGSIFASPTAVLFGKRLVYLV 186
               ++ +  G   +S +  V  S+++ L V  M+L    G +  SP + LFG+R+ Y V
Sbjct: 194 ----SACITGGLGLVSEKFHVG-SEVAILSVSLMVLGFSFGPLLWSPVSDLFGRRVAYFV 248

Query: 187 GILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYT 246
            + +++I +I CA S +   L+I R   G   S+   L   +IA+++ +  R   +  + 
Sbjct: 249 SMGLYVIFNIPCAVSKNVQTLMICRFFCGVWSSSGLCLVGGSIADMFPSETRGRAIAFFA 308

Query: 247 XXXXXXXXXXXXXXSLVFEHLST---HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPN 303
                           +   +ST     +FW+    AG  +++  L +PETF    PV  
Sbjct: 309 YAPYCGPVFGPLVNGFI--SVSTGRMDLIFWVNMAFAGVMWLVVAL-IPETF---APVIL 362

Query: 304 KRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETG 363
           KR                       R+ +L          + G P  +T+    QEA+  
Sbjct: 363 KR-----------------------RAAKLR--------KETGNPKIMTE----QEAQ-- 385

Query: 364 SKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVS 423
                    IS K++     +      +    +V++  +V   Y A+L+ A+ +A+ V+ 
Sbjct: 386 --------GISVKELMKSCCVRPLYFAVTEPVLVLVCFYVCLIY-ALLY-AFFFAFPVI- 434

Query: 424 LIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIY 483
                      + ++YG+    VGL++I   IG    S+          + LA       
Sbjct: 435 -----------FGELYGYRDNLVGLMFIPILIG---ASMALATTFYCENKYLAITKRRKP 480

Query: 484 EPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVD 543
            PE RL   +      AI L   G + ER   W+ P+      GFG  +   +   Y +D
Sbjct: 481 TPEDRLLGAMIGAPFAAIALWMLGATAERHVIWVGPASSGLAFGFGMVLIYYSLNNYIID 540

Query: 544 SYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIP--L 601
            Y +F+  AL T   +++  G A   F  +   + G   A    A I     + AIP   
Sbjct: 541 CYAQFASSALATKVFLRSAGGAAFPLFTNQMYHNLGLHWASWLLAFIS--TAMVAIPFAF 598

Query: 602 YRWGKLCRSWTNRKN 616
           Y +GK  R   ++K+
Sbjct: 599 YYYGKTLRGKLSKKD 613

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 114/484 (23%), Positives = 187/484 (38%), Gaps = 86/484 (17%)

Query: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC 200
           +L  +  V  + I+  V   +L  GV    +   A  FG+R + L G+LI+++ SIG AC
Sbjct: 126 QLEKQFNVDENMINITVVVYLLFQGVSPTISGGLADCFGRRPIILAGMLIYVVASIGLAC 185

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
           + S+  ++  R +   G+S   ++ S  + +    HER    G +               
Sbjct: 186 APSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHER----GTFVGATSGFVLLGQCFG 241

Query: 261 SLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQV 316
           SL+   L+  W    +FW LTI  GS F++  L +PET                      
Sbjct: 242 SLIGAVLTARWDWRSIFWFLTIGCGSCFLIAFLVLPET---------------------K 280

Query: 317 RGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEK 376
           R ++ N+SI   +     P    G       PV    + +  + ET  +T   +   S  
Sbjct: 281 RTIAGNLSIRPKKFINRAPIFLLG-------PVRRRFKYDNPDYETLDRTVPKLDLSSAG 333

Query: 377 QMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPA-ILFGAWLYAYAVVSLIIISQVIDHAY 435
           +                  +++L   +L  +P+ +LF  W         +++S +     
Sbjct: 334 K------------------ILVLPEIILSLFPSGLLFAMW--------TLMLSSISSGLS 367

Query: 436 KDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRL------------LAAHNHGIY 483
              Y +    +G+ Y+   IGG +GS   GR  D+  +             L   +  I 
Sbjct: 368 VAPYNYRLVIIGVCYLPGGIGGLMGSFFTGRVIDMYFKRKLKKFELDKANGLIPQDAEIN 427

Query: 484 EPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCS----TTAIT 539
               RL  +LP      +  L FGWS+++   W I S+   +  F  S C+    +T+ T
Sbjct: 428 MFRVRLVCLLPQNFLAVVAYLLFGWSIDK--GWRIESVL--ITSFVCSYCAMSTLSTSTT 483

Query: 540 YAVDSYKEFSQEALVTLNMVKNILG--FAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLW 597
             VD Y   S  A    N V+  L   F   F  +K  +  G    F C AL+  F  L 
Sbjct: 484 LLVDLYPTKSSTASSCFNFVRCSLSTIFMGCFAKMKASMTVGGTFTFLC-ALVFFFNFLM 542

Query: 598 AIPL 601
            IP+
Sbjct: 543 FIPM 546

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 126/496 (25%), Positives = 194/496 (39%), Gaps = 87/496 (17%)

Query: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC 200
            L  E  V    ++  V   +L  GV     S  A  +G+R V L+G+LIF++ SIG AC
Sbjct: 95  NLQREFGVSEDLVNIAVVVYLLFQGVAPTVCSGLADTYGRRPVILMGMLIFIVSSIGIAC 154

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
           S SF  ++  R +   G+S + ++ S  + +     ER    G +               
Sbjct: 155 SNSFALVIALRCIQSSGISPIIAINSGVVGDFTLKSER----GTFIGAVSGLTLLGQAFG 210

Query: 261 SLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQV 316
           SL+   L+  +    +FW +TI  G  F+ + LF+PET                      
Sbjct: 211 SLIGASLTAAYNWRAVFWFMTIGCGVCFLANFLFLPETH--------------------- 249

Query: 317 RGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEK 376
           R +  N+S        L P+      N +  PV L      Q     S    H  S+ + 
Sbjct: 250 RCIVGNLS--------LKPKR-----NINFSPVLLLPVIRRQF----SLQHPHYSSLDDT 292

Query: 377 QMAIGLGIYHGRHTIDNWCMVMLRPFVLFS-YPAIL-FGAWLYAYAVVSLIIISQVIDHA 434
               GL I      I         P +L +  PA L F  W      +SL  +SQ +   
Sbjct: 293 --VAGLDIVAALKIIAC-------PEILLTLLPAGLQFSLW-----TLSLTSLSQALQ-- 336

Query: 435 YKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLA-------AHNHGIYEP-- 485
             D Y +   +VGL Y+   I G LGS + G+  D+  R  A       A++ G   P  
Sbjct: 337 -SDPYNYPLTTVGLCYLPSGICGLLGSFLTGKLIDIWYRYFADRFQRRSANSSGPSAPFN 395

Query: 486 --EFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVD 543
             E R+   LP    + +  + FGWS++   H  +P +  GV  F      +T+ T  +D
Sbjct: 396 VLEARIVAGLPQNFISVMAFIIFGWSIQGGWHISVPLVASGVGTFCVMSTLSTSSTLLID 455

Query: 544 SYKEFSQEALVTLNMVKNILG--FAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAI-- 599
            Y   +  A    N ++  L   F   F  +K  +  G    F C     IF+G  A+  
Sbjct: 456 LYPNRASTASSCYNFIRCTLSALFLAVFARMKASMTIGGTFTFLCSL---IFVGNCALIF 512

Query: 600 PLYRWGKLCRSWTNRK 615
           P+    K   +W +R+
Sbjct: 513 PM----KYGMTWRDRR 524

>ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 649

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 109/226 (48%), Gaps = 4/226 (1%)

Query: 73  DMKGQESGGSDDHL---KKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGG 129
           D+KG  S   D  L   +  ++G++ N       KD  ++P   +   +  + +   +G 
Sbjct: 47  DLKGL-SKLKDRQLWVTRNERRGVVANLSLIPEFKDSRDYPESVKKSIVFVIAFSSMMGP 105

Query: 130 GQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGIL 189
             TS++     ++  +       ++  VG   +SLGV  ++ S  + + G+R VY+V  +
Sbjct: 106 MATSIIFPSIHEIEKDFSTTSMVVNVSVGVYQISLGVFPLWWSSISEMNGRRTVYVVSFM 165

Query: 190 IFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXX 249
           + +  +IGCA S +    +  R +SG   ++V+S+ + T++++Y + +R   LGIY    
Sbjct: 166 LLLGFNIGCALSPNIGAFIALRFLSGAASASVQSVGAGTVSDLYVSEQRGRNLGIYYLGP 225

Query: 250 XXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETF 295
                      + +  H S     W L I+AG+N ++ +LF+PET 
Sbjct: 226 LLAPLISPIIGAALVSHWSWRSTQWFLVILAGANVLILILFLPETL 271

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 87/198 (43%), Gaps = 7/198 (3%)

Query: 399 LRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAY-KDIYGFSSASVGLVYIAPFIGG 457
           ++      YP ++      + +   L  ++  +++ Y +  Y F    VGL+YI   +  
Sbjct: 425 IKSVYFLKYPPVMLAIIFSSVSFSILYFVNMTLEYDYSRSPYNFPPMLVGLMYIPNSVTY 484

Query: 458 CLGSLIAGRGSDVNTRLLAAHN--HGIYEPEFRL-FMVLPAVLCNAIGLLGFGWSLERQD 514
            L +++ G+  D    LL  +   HGI  PE R+ + ++ AV+   I L+ FGW +++ +
Sbjct: 485 ILAAILGGKWVDY---LLIQYKAKHGILAPEARISWNIVTAVISFPISLVIFGWCIDKGE 541

Query: 515 HWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKF 574
           HW  P +   + G+ S M     ++Y VDS        +   N+++ +L     F     
Sbjct: 542 HWETPLVGTALFGYASMMTIGATVSYLVDSLPGRGATGVALNNLIRQLLAAVAVFVTEPL 601

Query: 575 CLHEGYKNAFTCYALIEI 592
               G    FT  A I I
Sbjct: 602 IKGMGTGWLFTMLAFIII 619

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 99/437 (22%), Positives = 169/437 (38%), Gaps = 69/437 (15%)

Query: 138 GFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIG 197
              +L  +  V    ++  V   ++  G+    +   A ++G+R V L+G+LI++  SIG
Sbjct: 109 ALKQLEKKFNVSEEMVNITVVVYLIFQGIAPTISGGLADVYGRRPVILMGMLIYVCASIG 168

Query: 198 CACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXX 257
            ACS S+  ++  R +   G+S + ++ S  + +    HER   +G  +           
Sbjct: 169 LACSQSYGVIVFLRCLQSAGISPIIAINSGVVGDFTLKHERGTFVGAVSGFTLMGQAFGS 228

Query: 258 XXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVR 317
              + +        +FW LTI  G+  +++ L +PET         KR+L      R  R
Sbjct: 229 LIGAALTAAFDWRAIFWFLTIGCGTCMIINFLILPET---------KRTLVGNLSIRPKR 279

Query: 318 GLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQ 377
            L     I  ++S R        H ++              + ET    +  +  IS  +
Sbjct: 280 -LINRAPILLLKSVR-----RKLHFDNP-------------DYETLDPNKGKVDPISAFK 320

Query: 378 MAIGLGIYHGRHTIDNWCMVMLRPFVLFS-YPAIL-FGAWLYAYAVVSLIIISQVIDHAY 435
                              ++L P ++ S  PA L F  W    A +S    SQ+    Y
Sbjct: 321 -------------------IILHPEIILSLMPAGLQFALWTITLASIS----SQLSVTPY 357

Query: 436 KDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVN-----TRLLAAHNHGI--YEPEF- 487
                F    +G+ Y+   IGG +GS + G+  D+       R       GI   + +F 
Sbjct: 358 N----FKLTIIGICYLPSGIGGLIGSFVTGKVIDIYYRRALRRFEEKKEQGIIPIDSKFN 413

Query: 488 ----RLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVD 543
               RLF  +P      I    FGWS+ER  +  +P I   +  F +    +++ T  VD
Sbjct: 414 TLRARLFTSIPQNFLAVIAFTLFGWSVERGWNIAVPLITSAIGSFCAMSTLSSSSTLLVD 473

Query: 544 SYKEFSQEALVTLNMVK 560
            Y   S  A    N ++
Sbjct: 474 LYPSKSSTATSCYNFIR 490

>ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} similar
           to uniprot|Q2UJ53 Aspergillus oryzae AO090003001353
           Synaptic vesicle transporter SVOP and related
           transporters and weakly similar to YBR008C
           uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 542

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 106/490 (21%), Positives = 184/490 (37%), Gaps = 91/490 (18%)

Query: 160 MMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLS 219
            +++ G G    +P +  +G+ +V  + +L   I  I    + +F  ++++R + G   +
Sbjct: 103 FLVAYGFGCELWAPWSEEYGRWIVMQLSLLFSNIWQILGGKAPNFGAIIVARGLCGLSQA 162

Query: 220 TVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTII 279
              S+    +A+++   E  Y +                   L+ EHLS HW FWI  I 
Sbjct: 163 G-GSVTLGVVADLWDPSEHGYAVAYIVLASVGGSVLGPVFGGLMQEHLSWHWNFWIQLIF 221

Query: 280 AGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESA 339
            G + +LH   VPET                                  R+T L  RE+ 
Sbjct: 222 NGVSQILHFFLVPET----------------------------------RATILVNREAK 247

Query: 340 GHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVML 399
              N    P       N +                     IGL     R  +  W     
Sbjct: 248 RRRNTGEDPYCYGPSENHR---------------------IGL-----RELLVTWA---- 277

Query: 400 RPFVLF-SYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGC 458
           RPF +F   P +LF + L  +A   + I +Q     +K  +GFS  S GL++++  I   
Sbjct: 278 RPFYMFLCEPIVLFCSLLSGFADHLIFICNQAFTPIFKQ-WGFSPTSQGLIFLSMVIAYL 336

Query: 459 LGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDH--W 516
           +G L+         + +         PE RL ++L      +IGL GF W+    ++  W
Sbjct: 337 IGWLLHCFDISFQMKKIDQILRSPRGPERRLLLLLFLAPLLSIGLFGFAWTSMGPEYTPW 396

Query: 517 IIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCL 576
           I P+IF  V+G  +       I Y V +Y  ++  A     M +++L    + +      
Sbjct: 397 IAPAIFSSVIGIANYSIYIATIDYMVAAYGPYASSATGGNGMARDVLSGIAAMYATPLYD 456

Query: 577 HEGYKNAFT-------CYAL---IEIFIGLWAIPLYRWGKLCRSWTNRKNLLQFSYRVND 626
           + G+K  +        C  +   + I+I  W  P  R          +K+  +F+  ++ 
Sbjct: 457 NIGHKFHYQWASTLLGCLGILCTVPIYIFYWKGPEIR----------KKS--KFAQELSA 504

Query: 627 DGKDEKDNHT 636
           D  ++K N T
Sbjct: 505 DFDEQKKNRT 514

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 89/200 (44%), Gaps = 9/200 (4%)

Query: 394 WCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAP 453
           W ++   P  + S    L  A  YA++V         + H  K+ Y  SS  VG  Y+ P
Sbjct: 385 WSLIKFLPVTICSVCTALLFATYYAFSVT--------LSHFLKEQYNLSSFQVGAAYVCP 436

Query: 454 FIGGCLGSLIAGRGSD-VNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLER 512
            +   LGSL  G  SD    R L  +    + P  RL + +  +L +  G +G+GWS+ER
Sbjct: 437 GVALLLGSLTGGHLSDYFRKRWLKKNEDQKFSPARRLKLQVWGLLISMCGCIGYGWSIER 496

Query: 513 QDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNV 572
             H ++  +F  ++ FG + CS   +TY  ++  + +   +   +  +NI     +   +
Sbjct: 497 HYHLVVVLVFSFLIAFGMTWCSNATMTYLTETIPKRAAGTVAVSSFFRNIAAAISAVIIM 556

Query: 573 KFCLHEGYKNAFTCYALIEI 592
           K C   G    FT   L ++
Sbjct: 557 KLCERMGIGWCFTGLGLCDL 576

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 77/185 (41%), Gaps = 2/185 (1%)

Query: 113 RRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFAS 172
           +R I  + + +  F+G    ++       L     V  + I+  V   M    VG +F +
Sbjct: 137 QRLIIFLVIIYVGFLGPLSGNIYIPALPLLQESFNVSATTINATVSVFMAVFSVGPLFWA 196

Query: 173 PTAVLFGKRLVYLVGILIFMIGSIG-CACSTSFNWLLISRVVSGFGLSTVESLPSATIAE 231
             A   G++ +Y+V +L+ +I +I   A  T+   L   R+   FG S+V SL   T+++
Sbjct: 197 LFADFGGRKFLYIVSLLLTIIVNILLSAVPTNIGALFFLRIAQAFGSSSVMSLGIGTVSD 256

Query: 232 IYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST-HWLFWILTIIAGSNFVLHLLF 290
           I     R   +  +                L+    +   WLF  + II+G    L +L 
Sbjct: 257 ITPPKSRGRAVSYFMLGPNMGPILAPIIAGLILMSSNNWRWLFGFICIISGIALFLVVLL 316

Query: 291 VPETF 295
           +PET 
Sbjct: 317 LPETL 321

>KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.570
           YBR180W
          Length = 538

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 95/416 (22%), Positives = 166/416 (39%), Gaps = 46/416 (11%)

Query: 151 SQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGI-LIFMIGSIGCACSTSFNWLLI 209
           S I+  V   M    VG +     A + G++++YL+ + L+F++  +  + S +   L I
Sbjct: 112 STINATVSVFMAVFAVGPLLWGAYADVGGRKILYLLSLALMFIVNVLLASLSPNIVALFI 171

Query: 210 SRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST 269
            R+   F  S+V +L + T+ ++     R   +G +                L+  +   
Sbjct: 172 LRIAQAFASSSVIALGAGTVTDLIVPSARGKAIGYFMMGPNMGPVIAPIVAGLILINTDR 231

Query: 270 -HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATV 328
             WLF    I++G   +   +F+PET   R  V N             +G S  + I   
Sbjct: 232 WRWLFGFCAIMSGVALLCVWIFLPETL--RCIVGNGDP--------SWKGESP-LDIEAQ 280

Query: 329 RSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGR 388
                 P +      D G+   +++E+  +E       RA +K+                
Sbjct: 281 ELVECQPAKWQ-FCADIGIQKPVSNETTFKELYV-RPPRAGLKTY--------------- 323

Query: 389 HTIDNWCMVMLRP-FVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVG 447
                W M+  RP FV  S  A+LF  + YA++V           H  +  Y +S   +G
Sbjct: 324 -----WSMIKFRPIFVTASCNALLFANY-YAFSVT--------FSHFLEVSYHYSMLKIG 369

Query: 448 LVYIAPFIGGCLGSLIAGRGSD-VNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGF 506
             Y+ P I   LGS   G  SD +  R    +    Y  E RL + +  ++ N  G +G+
Sbjct: 370 AAYVCPGITMILGSQSGGHLSDFLRKRWKKKNPEKDYPLELRLRLNIVGIVINTAGCIGY 429

Query: 507 GWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNI 562
           GW++ R  H  +   F  +L FG +  + T +TY  +     +   +   +M +NI
Sbjct: 430 GWAISRHFHVALVLFFSALLAFGLTWVNNTTMTYMTELMAHRASAGVAVNSMFRNI 485

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 116/497 (23%), Positives = 188/497 (37%), Gaps = 78/497 (15%)

Query: 138 GFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIG 197
              +L  +  V  + ++  V   ++  G+   F    A LFG+R V L G+LI+ + SIG
Sbjct: 114 ALKQLEKQFDVDENMVNVTVVVYLIFQGLSPTFCGGLADLFGRRPVILTGMLIYTVASIG 173

Query: 198 CACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXX 257
            ACS S+  ++  R +   G+S   S+ S  + +     ER   +G  +           
Sbjct: 174 LACSNSYGVIVFLRCLQSAGISPTISISSGAVGDFTVKSERGTFVGAVSGLVLLGQAFGS 233

Query: 258 XXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVR 317
              + +    +   +FW LTI  G + ++    +PET   RT V N              
Sbjct: 234 LIGAALAASFNWRAIFWFLTIGCGVSMMVAFFVLPET--KRTIVGN-------------L 278

Query: 318 GLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQ 377
            +  N+ I  ++   LN  + +             D  + +  E  +     I +     
Sbjct: 279 SIRPNIYIIELQFLALNSVQKSFRY----------DNPDTETLEVNTSKYDPIAAFK--- 325

Query: 378 MAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKD 437
                              ++  P +  S   +L G  ++A   + L  IS  +  A   
Sbjct: 326 -------------------ILASPEIFLS---LLPGGMIFAQWTLMLSAISSELSTA--- 360

Query: 438 IYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVN-----TRLLAAHNHGI--YEPEF--- 487
            Y +    +G+ Y+   IGG LGSLI GR  D        +      +GI   + EF   
Sbjct: 361 PYNYKLTIIGVCYLPAGIGGLLGSLITGRVIDYYYKRSLRKFEEDKMNGIIPMDAEFNAI 420

Query: 488 --RLFMVLPAVLCNAIGLLGFGWSL---ERQDHWIIPSIFFGVLGFGSSMCSTTAITYAV 542
             RL   LP +L + I  + FGW L   E  +  +I S F     F +    +T+ T  V
Sbjct: 421 KIRLTASLPQILLSVIVYIIFGWCLGEGEPVESMLIVSFF---CSFCTMSTLSTSSTLLV 477

Query: 543 DSYKEFSQEALVTLNMVKNILG--FAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIP 600
           D Y   S  A    N ++  L   F   F ++K  +  G    F    ++ I IGL   P
Sbjct: 478 DLYPGKSSTATSCFNFIRCSLSAMFMGCFADMKAAMTLGGTFTFLS-GIVCISIGLLYFP 536

Query: 601 LYRWGKLCRSWTNRKNL 617
           +Y        W NR+ L
Sbjct: 537 MYHG----MEWRNRRAL 549

>TDEL0A05130 Chr1 complement(910315..912114) [1800 bp, 599 aa] {ON}
           Anc_8.570 YBR180W
          Length = 599

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 95/395 (24%), Positives = 154/395 (38%), Gaps = 40/395 (10%)

Query: 207 LLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEH 266
           L + RV   FG S+V +L + T+++I    +R   +  +                L+   
Sbjct: 227 LFVLRVFQAFGSSSVIALGTGTVSDISPPKDRGKAIAYFMMGPNMGPILAPIISGLILIR 286

Query: 267 LST-HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSI 325
                WLF   +I++G   +L L  +PET   R  V N     + R     RG   + S 
Sbjct: 287 GDYWRWLFGFTSIMSGIALLLVLALLPETL--RCIVGNG----DQRWRSAERGSKNSASD 340

Query: 326 ATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIY 385
             +  T   P+            + L  +   Q+   GS   +    +  K     L +Y
Sbjct: 341 REIGETIQTPK------------INLFQDIGMQKPVNGS---SQFSRLYPKPPKPSLIMY 385

Query: 386 HGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSAS 445
                   W M+   P  + S    L  A  YA++V              +  Y  S  +
Sbjct: 386 --------WHMIKFLPLTVASLSTALLFASYYAFSVT--------FARFLQTDYNLSMLA 429

Query: 446 VGLVYIAPFIGGCLGSLIAGRGSD-VNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLL 504
           VG  Y+ P +   LGS + G  SD +  R L +H   +Y  E+RL + +  ++ N  G +
Sbjct: 430 VGAAYVCPGVAMLLGSQVGGHLSDYLRKRWLLSHQGLLYPLEYRLILQVWGIIINTAGCI 489

Query: 505 GFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILG 564
           G+GWS+ER     +  +F  +  FG + CS T +TY  +   + +  A+   +  +N+  
Sbjct: 490 GYGWSIERHYPLAVVLVFSALNAFGLTWCSNTTMTYISELMAKRTAGAIAVSSFFRNVGA 549

Query: 565 FAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAI 599
              S    K  L  G    F+   L  I I L AI
Sbjct: 550 TISSAIISKLYLSMGIGWCFSGLGLCNI-ISLAAI 583

>Smik_2.320 Chr2 (575945..577663) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 97/448 (21%), Positives = 178/448 (39%), Gaps = 44/448 (9%)

Query: 142 LSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGI-LIFMIGSIGCAC 200
           L  E  V  + I+  V   M    VG +F    A   G++ +Y+  + L+ ++  +  A 
Sbjct: 137 LQREFGVSATTINATVSVFMAVFSVGPLFWGALADFGGRKFLYMASLSLMLIVNILLAAV 196

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
             +   L + RV   F  S+V SL + T+ ++     R   +  +               
Sbjct: 197 PVNIAALFVLRVFQAFASSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPNMGPIIAPIVA 256

Query: 261 SLVFEHLST-HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGL 319
            L+        WLF    IIAG   +L    +PET   R  V N     + R + + +  
Sbjct: 257 GLILMKGDYWRWLFGFTAIIAGIALILVSALLPETL--RCIVGNG----DPRWSEK-KNE 309

Query: 320 SENVSIATVRSTRLNPRESAGHVNDD-GVPVGLTDESNAQEAETGSKTRAHIKSISEKQM 378
           S+N   ++V+   +       H+  D G+   +T++                +    K  
Sbjct: 310 SKNKEHSSVKGNEI----LRWHLFPDMGIRKPVTNDQ-------------FFRQKFPKPP 352

Query: 379 AIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDI 438
             G+ +Y        W M+   P ++ S    L  +  YA++V           +  ++ 
Sbjct: 353 KAGITLY--------WKMIKCPPILITSISTALLFSSYYAFSVT--------FSYYLEND 396

Query: 439 YGFSSASVGLVYIAPFIGGCLGSLIAGRGSD-VNTRLLAAHNHGIYEPEFRLFMVLPAVL 497
           Y F+   +G  Y+ P +   LGS   G  SD + +R + +H    +  E RL + L  +L
Sbjct: 397 YHFTMLEIGAAYVCPGVAMLLGSQSGGHLSDYLRSRWIKSHPEKKFPAECRLLLNLVGIL 456

Query: 498 CNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLN 557
               G +G+GWS+    H+++  +F  +  FG + CS T++TY  + + + +   +   +
Sbjct: 457 LTICGTVGYGWSIFFHYHFVVLLVFSALTAFGMTWCSNTSMTYLTELFPKRAAGTVAVSS 516

Query: 558 MVKNILGFAVSFFNVKFCLHEGYKNAFT 585
             +NI     S   ++ C   G    FT
Sbjct: 517 FFRNIGAAVSSAIILQLCRAMGVGWCFT 544

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 120/531 (22%), Positives = 195/531 (36%), Gaps = 101/531 (19%)

Query: 104 KDPLNWPIWRR-------DIALVCV--GWHCFVGGGQTSMLASGFSKLSAELQVPLSQIS 154
           ++P NWP+W R          ++CV  G  C  GG  T       S+ +A L   L  I 
Sbjct: 169 QNPHNWPLWIRWGYTILLSCLVICVAYGSSCITGGFGTVEDKFHVSQEAAILSCSLMVIG 228

Query: 155 YLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVS 214
           + VGP++ S         P + L+G+R+ Y V + ++ I +I CA + +   LL+ R + 
Sbjct: 229 FAVGPLLWS---------PVSDLYGRRVAYFVSMGLYTIFNIPCALAPNLGCLLVCRFLC 279

Query: 215 GFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST---HW 271
           G   ++   L   +IA+++ +  R   +  +                  F  +ST     
Sbjct: 280 GVFSASGLCLVGGSIADMFPSATRGKAIAFFAWAPYAGPCTGPLVNG--FISVSTGRMDL 337

Query: 272 LFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRST 331
           +FW+    AG  +++    +PET+    PV  KR   + R                    
Sbjct: 338 IFWVNMAFAGVMWIVSSA-IPETY---APVILKRRAAKLR-------------------- 373

Query: 332 RLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTI 391
                       + G P  +T+    QEA+ G   +  +K+                   
Sbjct: 374 -----------KETGNPKIMTE----QEAQ-GVNFQDMVKA------------------- 398

Query: 392 DNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYK-DIYGFSSASVGLVY 450
              C+V  RP        +L     Y   + SL+            ++Y +    VGL+ 
Sbjct: 399 ---CLV--RPLEFCVTEPVLVMTCFYVCLIYSLLYAFFFAFPVVFGELYDYGDNYVGLMM 453

Query: 451 IAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSL 510
           I   IG C   L           L+         PE RL   +      AI L   G + 
Sbjct: 454 IPILIGACFALLFTFYCEKKYLSLIEKRRP---TPEDRLLGAMIGAPFAAIALWILGATS 510

Query: 511 ERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFF 570
           E+   W+ P+      GFG  +   +   Y +D Y +F+  AL T   +++  G A   F
Sbjct: 511 EKSVMWVGPASSGLSFGFGMVLIYYSLNNYIIDCYVQFASSALATKVFLRSAGGAAFPLF 570

Query: 571 NV----KFCLH-EGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNRKN 616
                 K  LH   +  AF C A+I +  G  A     WGK  R   ++K+
Sbjct: 571 TTQMYHKLGLHWASWLLAFICTAMIALPFGFAA-----WGKKLRHKLSKKD 616

>ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 549

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 124/579 (21%), Positives = 224/579 (38%), Gaps = 123/579 (21%)

Query: 73  DMKGQESGGSDDHLKKTKK---------GIILNPQP-------SECKKDPLNWPIWRRDI 116
           D++   S GS DH ++ K+         G+     P        +  + P+NWP+ ++ I
Sbjct: 47  DLEANGSNGSIDHDEREKRETGGNIELGGVPQQKDPFLVEYTGPDDPERPVNWPLSKKAI 106

Query: 117 A------LVCV---GWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVG 167
                  L CV   G   +  G +    A G   + A L + +    Y++G      G+G
Sbjct: 107 VAFQVQLLTCVTYMGTAIYTPGQEEIQKAFGVGHVVATLNLSM----YILG-----FGLG 157

Query: 168 SIFASPTA--VLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLP 225
            +F SP +   +FG++ +Y++ + +F +  IGCA   +   L+I R ++G   S   S  
Sbjct: 158 PMFFSPLSEFAIFGRQQLYIITLFLFSMLQIGCALVDNIAGLVILRFITGILCSPSLSTG 217

Query: 226 SATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFV 285
           +ATI+EI         +G+++              + +    +  ++FW+L  I     +
Sbjct: 218 AATISEIVTPPFVPVMIGMWSIGAVAAPAIGPILGAAMLVAKNWRFMFWLLMWITSGALI 277

Query: 286 LHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDD 345
           +  LF PET+             E  + R+ + + +                        
Sbjct: 278 ILSLFFPETY------------EENVLYRRCKRIQKT----------------------- 302

Query: 346 GVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLF 405
                 T ++    A++  +++  IK I+   +   + I            ++  P VL 
Sbjct: 303 ------TGDNRYFTAKSKEESKLSIKDITINALWRPIEI------------IVKEPIVLA 344

Query: 406 --SYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLI 463
             +Y A+ +G +   +    ++ +          IY F+   +GL Y    +G  + S I
Sbjct: 345 LDTYLALAYGTFYLFFEAFPIVFLR---------IYHFTPVELGLSY----LGFVVSSFI 391

Query: 464 AGRGSDVNTRLLAAH--NHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP-- 519
           A   S    RL        G + PE  L + +    C    L  FGW+     HWI+P  
Sbjct: 392 AYGVSLSFFRLFLPRIIKKGEFRPEKLLILAMWVCWCGPAALFIFGWT--ASVHWILPIM 449

Query: 520 -SIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHE 578
             +F+G+  F          +Y   SY +++        + ++  GFA SF      +++
Sbjct: 450 SELFWGLFLFN---LFQAIFSYLAMSYPKYTASVFAGNGLFRS--GFACSFPLFGQAMYD 504

Query: 579 -----GYKNAFTCYALIEIFIGLWAIP--LYRWGKLCRS 610
                GY  A+    L  I IGL  +P  LY+ G   RS
Sbjct: 505 NLAIKGYPVAWGSSLLGFITIGLGFLPFILYKTGPYLRS 543

>ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} similar
           to gnl|GLV|DEHA0A14894g Debaryomyces hansenii
           DEHA0A14894g and weakly similar to YLL028W
           uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton- motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 595

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 99/458 (21%), Positives = 174/458 (37%), Gaps = 69/458 (15%)

Query: 110 PIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSI 169
           P+WR+   +  +G         TS+     S +S +  +     +      +++   G  
Sbjct: 111 PVWRKWSVIAVIGVCQLSMNFNTSVYPHAISLISEDFHISKQAANTSQMIFLVAYAFGCE 170

Query: 170 FASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATI 229
             +P +  +G+ +V    +    +  I    + +F  ++++R + G  L+   S+     
Sbjct: 171 LWAPWSEEYGRWIVMQCSLFSSNVWQILGGLAPNFGSIIVARFLGGISLAG-GSVTLGVA 229

Query: 230 AEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLL 289
           A+++   +  Y +                   L+ EHLS HW FWI  I  G   VLH  
Sbjct: 230 ADMWDPADHGYAVAFVVLCSVGGTVIGPIFGGLMEEHLSWHWNFWIQLIFNGVTQVLHFF 289

Query: 290 FVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPV 349
            VPET   R+ V   RS  + R                 +S R +P     HV   G   
Sbjct: 290 IVPET---RSTVIMDRSAKKMR-----------------KSGR-DP-----HVYGPG--- 320

Query: 350 GLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLF-SYP 408
                               +K+ S K++            +  W    +RPF +F   P
Sbjct: 321 -------------------EVKAFSVKEL------------LKTW----IRPFHMFVCEP 345

Query: 409 AILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGS 468
            +LF + L  +A   + I +Q     ++  + FS+ + GL +I   I   +G ++     
Sbjct: 346 IVLFCSLLSGFADHLIFICNQAFGPIFEQ-WNFSTTAQGLTFITLVIAYLIGYMLHLIDI 404

Query: 469 DVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSL--ERQDHWIIPSIFFGVL 526
               +++    H    PE RL ++L      ++GL GF W+    R   WI P+IF  V+
Sbjct: 405 RQQRKIMDKMLHSSRGPERRLLLLLFLAPLLSLGLFGFAWTTMGPRYTPWIAPAIFSTVI 464

Query: 527 GFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILG 564
           G G+       I Y V +Y  +S  A       +++L 
Sbjct: 465 GIGNYSIYMATIDYMVSAYGPYSASATGGNGFARDLLA 502

>Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W
           (REAL)
          Length = 522

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 92/444 (20%), Positives = 161/444 (36%), Gaps = 69/444 (15%)

Query: 161 MLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLST 220
           +  LG+G +F SP + L+G+R+ +L  +++ +I       S +   ++  R +SGF  S 
Sbjct: 126 VFGLGIGPLFLSPLSELYGRRITFLYALMLSIIWQCLTIWSGTIAGVMFGRFLSGFFGSA 185

Query: 221 VESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIA 280
             S+    IA+I+   +    + IYT                ++ H S  W F  L I +
Sbjct: 186 FLSVAGGAIADIFDKDQIGIPMAIYTTSAFLGPSLGPIIGGALY-HESYKWTFITLLITS 244

Query: 281 GSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAG 340
           G   VL +  +PET+    PV   R                       ++ RL   ES G
Sbjct: 245 GCCLVLIIFTIPETY---KPVLLIR-----------------------KAKRLRKEESNG 278

Query: 341 HVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLR 400
                 + V  T E  +  +     TR     +   +M   L  Y G             
Sbjct: 279 RRYYAALEV--TREQTSLLSAVFLSTRRPFGLLLRDRMMGVLCFYTGLEL---------- 326

Query: 401 PFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLG 460
                        A +Y Y V           + +K +Y F    +   YI   +G  L 
Sbjct: 327 -------------AIIYLYFV--------AFPYVFKKLYNFGPMEIACSYIGIMVGMLLS 365

Query: 461 S---LIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWI 517
           +   L+  +      +     N+G+  PE R   +        IGL  F ++  +  HWI
Sbjct: 366 APTCLLFQKTFQWRVK----RNNGVKTPEMRFEPLFYGAFLTPIGLFIFAFTCYKHVHWI 421

Query: 518 IPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLH 577
            P I   + G G     T    Y VD+Y++++   +     V+ I+      F ++  ++
Sbjct: 422 APVIGSAIFGSGVYFVFTGVFAYTVDAYRKYAASGMACNTFVRCIMAGVFPLFGLQ--MY 479

Query: 578 EGYKNAFTCYALIEIFIGLWAIPL 601
           E     +  + L  + + +  +P 
Sbjct: 480 EAMGVNWAGFLLAMVTVAMIPVPF 503

>NDAI0C05670 Chr3 complement(1310115..1311617) [1503 bp, 500 aa]
           {ON} Anc_8.570
          Length = 500

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 103/470 (21%), Positives = 177/470 (37%), Gaps = 35/470 (7%)

Query: 126 FVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYL 185
           F+G    ++       L  E +V  + I+  V   M    VG +F    A   G++++Y+
Sbjct: 43  FLGPMSGNIYIPALPLLQNEFKVNSTTINATVSVFMAVFSVGPLFWGLFADFGGRKILYI 102

Query: 186 VGILIFMIGS-IGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGI 244
           + I I +  + I  A  +    L   RVV  FG S+V +L + T+ +I     R   +  
Sbjct: 103 ISISIMIAANVILAAVPSHIGALFAMRVVQAFGSSSVITLGAGTVTDITPPKHRGKAIAY 162

Query: 245 YTXXXXXXXXXXXXXXSLVFEHLST-HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPN 303
           +                L+        WLF    I++G      ++F+PET        +
Sbjct: 163 FMMGPNIGPVIAPIIAGLILMKGDYWRWLFGFTAIMSGIGLFAIIIFLPETLRCIVGNYD 222

Query: 304 KRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETG 363
            R      +A     + +   ++   +TR   R S    +D G+             +  
Sbjct: 223 PRWRKTEYLAVTTEKVEDIELVSEQPTTR---RPSWPFFSDIGL-------------QKP 266

Query: 364 SKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVS 423
             T    K+   K    GL  Y        W ++   P ++ S    L     YA++V  
Sbjct: 267 RSTSDEFKTRYPKPPKTGLKTY--------WQLIKCPPVLIASVSTSLLFTNYYAFSVS- 317

Query: 424 LIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSD-VNTRLLAAHNHGI 482
                    H     Y  S   +G  Y+ P I   +GS + G  SD + +R L  H    
Sbjct: 318 -------FAHYLARDYHLSPLKIGACYVCPGISMLVGSQVGGHLSDYLRSRWLKRHEAET 370

Query: 483 YEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAV 542
           +  E+RL + +  +L N  G +GFG+S+    H  +  +F G++ FG + CS T +TY  
Sbjct: 371 FPLEYRLVLHIFGILMNTAGCIGFGFSISFHYHLALILMFSGLMAFGMTWCSNTTMTYLT 430

Query: 543 DSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEI 592
           +     +   +   +  +N+     S   +  C   G    F    L+ I
Sbjct: 431 ELMTNKAAATIALSSFFRNVGAAISSAIIITLCDQMGVGWCFMGLGLVNI 480

>Skud_2.121 Chr2 complement(233273..234913) [1641 bp, 546 aa] {ON}
           YBR008C (REAL)
          Length = 546

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 96/423 (22%), Positives = 166/423 (39%), Gaps = 72/423 (17%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
           ++P NWP+ ++   +  +     V    +S+   G   +  E +V     +  +   +L 
Sbjct: 91  ENPQNWPLVKKSWVVAQIMLLTCVTYMGSSIYTPGQEYIQEEFRVGHVVATLNLSVYVLG 150

Query: 164 LGVGSIFASPTAVL--FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTV 221
            G+G I  SP + +  +G+  +Y+V +  FMI  IGCA   +   L++ R +SG   S  
Sbjct: 151 YGLGPIIFSPLSEIARYGRLNLYMVTLFFFMIFQIGCATVHNIGGLIVMRFISGVLCSPS 210

Query: 222 ESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAG 281
            +    T+A+I         LG+++              + + E  +  ++FW+L  ++ 
Sbjct: 211 LATGGGTVADIISPEMVPLVLGMWSAGAVAAPILAPLLGAAMVEAKNWRFIFWLLMWLSA 270

Query: 282 SNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGH 341
           + FVL   F PET                          ++ +I   R+ +L  R+  G 
Sbjct: 271 ATFVLLAFFFPET--------------------------QHHNILYRRAMKL--RKETG- 301

Query: 342 VNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRP 401
             DD        E +  + E  +KT                        I+     + RP
Sbjct: 302 --DD----RYYTEQDKLDREVETKT----------------------FLINT----LYRP 329

Query: 402 F-VLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLG 460
           F ++   PAIL      A A     +  +     +  IY FS   VGL Y    +G C+G
Sbjct: 330 FKMIIKEPAILAFDLYIAVAYGCFYLFFEAFPIVFVGIYHFSLIEVGLAY----MGFCVG 385

Query: 461 SLIA-GRGSDVNTRLLAAH-NHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWII 518
            + A G    +N R++     +G + PE  L + +    C    L  FGW+   + HWI+
Sbjct: 386 CVFAYGLFGILNMRIIVPRFRNGTFTPEAFLIVAMSVCWCLPFSLFLFGWT--AKVHWIL 443

Query: 519 PSI 521
           P I
Sbjct: 444 PVI 446

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 106/460 (23%), Positives = 177/460 (38%), Gaps = 35/460 (7%)

Query: 142 LSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC- 200
           L  E QV  + I+  V   M       +     A   G++ +Y++ + IF + +I  A  
Sbjct: 161 LQEEFQVTTTTINGTVSIFMGLFAFMPLVWGMFADFGGRKFLYIISLFIFTVANILLASL 220

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
             +   L + RV+   G S   SL + T+A+I     R   + ++               
Sbjct: 221 PANIIALYLVRVLQVVGASAAISLGTGTVADISPPKHRGKSVALFMLGPNMGPIIAPIIA 280

Query: 261 SLVFEHLST-HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGL 319
            L+  + +   WLF    I  G   ++ ++ +PET   R  V N    ++ + +R  RG 
Sbjct: 281 GLILMNSNQWRWLFGFSAICTGVALMIVIVILPETL--RCIVGN----NDPKWSRSQRGT 334

Query: 320 SE-NVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQM 378
           S+ N S       R   RE             L D      +  G +     K +S+ + 
Sbjct: 335 SQYNESKEKFEGDREEIREIES----------LNDPRWNLCSNLGIQ-----KPVSDDEQ 379

Query: 379 AIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDI 438
              L     + T+  +         LF YP I   +   A+   S    S    H  K+ 
Sbjct: 380 FKQLYPKPPKPTLKQYGK-------LFIYPPITLVSTSIAFLFSSYYGFSVTFAHFLKED 432

Query: 439 YGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEP-EFRLFMVLPAVL 497
           Y +    +G  Y  P I   LGS   G  SD   +     N G   P E RL +    ++
Sbjct: 433 YNYGMLQIGGAYSCPGICMILGSQSGGWLSDNLRKRWLKKNEGQNFPIERRLVLQFIGIV 492

Query: 498 CNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLN 557
            + IG +G+GWS+++  H  I  +F G L FG + C+ T +TY  +         +   +
Sbjct: 493 LSIIGSIGYGWSIKKHYHIAIVLMFSGFLAFGLTWCNNTTMTYLTELIPRRVSGVIAVCS 552

Query: 558 MVKNILGFAVSFFNVKFCLHEGYKNAFTCYA---LIEIFI 594
             +N+     +  ++K     G +  FT +    LI +FI
Sbjct: 553 FFRNVGAAVSAAISMKLVDKIGVEWTFTYFGVCNLIPLFI 592

>Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON}
           (29969..31474) [1506 nt, 502 aa]
          Length = 501

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 87/416 (20%), Positives = 164/416 (39%), Gaps = 68/416 (16%)

Query: 161 MLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLST 220
           +  LGVG +  SP + L+G+RL ++  + + +I       S +   ++  R +SGF  S+
Sbjct: 106 IFGLGVGPLILSPLSELYGRRLTFIFSLALSIIWQCLTTWSKTIEGVMFGRFLSGFFGSS 165

Query: 221 VESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIA 280
             S+   +I++I+   +    + I+T                + +  S  W F +L I +
Sbjct: 166 FLSVAGGSISDIFEKKDIGIPMAIFTTSPMLGPSIGPIIGGALHKD-SYKWTFIVLLIAS 224

Query: 281 GSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLS-ENVSIATVRSTRLNPRESA 339
           G   VL  L VPET+         + +   R A+++R  + ++   A +  TR   + ++
Sbjct: 225 GVCLVLITLTVPETY---------KPMLLIRKAKRLRQETGDDKYYAPLEITRKETKLTS 275

Query: 340 GHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVML 399
             +     P GL                     + +  MA+ L  Y G            
Sbjct: 276 AIILSARRPFGLL--------------------VRDPMMAV-LTFYTG------------ 302

Query: 400 RPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL 459
                               A+V L  ++    + ++ ++ F+   V   YI   + G L
Sbjct: 303 -----------------LVLAIVYLFFVA--FPYIFETVFKFTVMEVACAYIG-MLSGIL 342

Query: 460 GSLIAGRGSDVNTRLL--AAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWI 517
             L++     +  R      +N+G+  PE R   +        IGL+ F W+   Q HWI
Sbjct: 343 --LVSPTALIIQKRYAKKVENNNGVSTPEMRFEALFYGAFLTPIGLMIFAWTCYPQVHWI 400

Query: 518 IPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVK 573
            P I  G+ G G     T   +Y VD+Y++++  A+   + V++ +      F ++
Sbjct: 401 GPVIGSGIFGSGVFFVFTGVFSYTVDAYRKYAASAMACNSFVRSTMSAVFPLFGLQ 456

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 111/514 (21%), Positives = 186/514 (36%), Gaps = 97/514 (18%)

Query: 73  DMKGQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHC-FVGGGQ 131
           D  G  SG   D  +   +G     QP E    P     + +   +V V   C F     
Sbjct: 75  DESGSPSGIKQDGHESEDEG-----QPEEVSTAPYTLLSYSQKWGMVAVLTMCGFWSSLG 129

Query: 132 TSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIF 191
           + +      +L  E  +  SQ++  V   +L  G+   F+   A  +G+R + L G+L++
Sbjct: 130 SPIYYPALRQLEKEFHLNESQVNVTVVVYLLFQGIAPTFSGGLADRYGRRPIILGGMLVY 189

Query: 192 MIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXX 251
           ++ SIG A + S+  ++  R+V   G+S   ++ S  +++     ER   +G  +     
Sbjct: 190 VVASIGLARAPSYGVIVFLRIVQSIGISPTIAISSGVVSDYTLKRERGTFVGATSGFVLI 249

Query: 252 XXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETR 311
                    +++        +FW L I  G++ ++    +PET                 
Sbjct: 250 GQGIGPLLGAVIAARWDWRAIFWFLVIGCGTSMLIAFFLLPET----------------- 292

Query: 312 IARQVRGLSENVSIATVRSTRLNP-------RESAGHVNDDGVPVGLTDESNAQEAETGS 364
                R +  N+SI   +    NP       R    + N D               ET  
Sbjct: 293 ----KRTIVGNLSIEPKKLINKNPLFLLPGVRRRFKYDNPD--------------YETLD 334

Query: 365 KTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFS-YPA-ILFGAWLYAYAVV 422
            T   +  +S  +                   +  RP +  S +PA + F  W       
Sbjct: 335 PTIPELDLVSAFK-------------------ITARPEIFLSLFPAGMQFAMW------- 368

Query: 423 SLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDV-NTRLLAAHNHG 481
             +++S +        Y +    VG+ Y+   IGG  GS   GR  D+   R++      
Sbjct: 369 -TLMLSCIASQLSIAPYNYHLTIVGVCYLPAGIGGLCGSFFTGRIIDLYYRRVVRKFQQD 427

Query: 482 IYE---PE--------FRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGS 530
             E   PE         RL  VLP      +  L FGWS+++   W IP+    +    S
Sbjct: 428 KAEGKIPENQVFNIFRVRLMCVLPQNFIAVVSFLLFGWSVDK--GWKIPAAL--ITSCVS 483

Query: 531 SMCS----TTAITYAVDSYKEFSQEALVTLNMVK 560
           S C+    +T  T  VD Y + S  A    N V+
Sbjct: 484 SYCAMSTLSTMTTLLVDLYPKKSSTASSCFNFVR 517

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 112/518 (21%), Positives = 206/518 (39%), Gaps = 77/518 (14%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYL-VGPMMLS 163
           +P NWPI RR    V +          ++ +A G   +S +  V  S+++ L V  M++ 
Sbjct: 163 NPHNWPIARRWFFTVVLSTLVICVAYGSACIAGGLFTVSEKYHVG-SEVAVLSVSLMVIG 221

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +G +  SP + L+G+R+ Y V + +++I +I CA S + + L++ R + G   S+   
Sbjct: 222 FSLGPLLWSPVSDLYGRRVAYFVSMGLYVIFNIPCAISPNISGLMVCRFLCGVWASSGLC 281

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTH---WLFWILTIIA 280
           L   +IA+++ +  R   +  +                 +   +ST     +FW+    A
Sbjct: 282 LVGGSIADMFPSETRGKAIAFFAFAPYVGPVFGPLVNGFI--SVSTRRMDLIFWVNMAFA 339

Query: 281 GSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAG 340
           G  +++ + F+PET+    PV  KR                       R+ +L       
Sbjct: 340 GVMWIV-VAFIPETY---APVILKR-----------------------RAIKLR------ 366

Query: 341 HVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLR 400
              + G P  +T+    QEA+ G      +K+   + +   +        +D  C     
Sbjct: 367 --KETGNPKIMTE----QEAQ-GVSFNEMMKTCLLRPLYFAV----TEPVLDATCF---- 411

Query: 401 PFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLG 460
            +V   Y   L  A+ +AY V+            + ++YG+     GL++I   IG  + 
Sbjct: 412 -YVCLIYS--LLYAFFFAYPVI------------FSELYGYKDNLCGLMFIPIMIGALMA 456

Query: 461 SLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPS 520
                       +L+         PE RL   +      AI L   G +  +   W+ P+
Sbjct: 457 LATTFWCESKYLQLIKTRKP---TPEDRLLGAMIGAPFAAIALWILGATSYKHIIWVGPA 513

Query: 521 IFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGY 580
                 G+G  +   +   Y +D Y +F+  AL T   +++  G A   F  +     G 
Sbjct: 514 SSGIAFGYGMVLIYYSLNNYIIDCYVQFASSALATKVFLRSAGGAAFPLFTTQMYHKLGL 573

Query: 581 KNAFTCYALIEIFIGLWAIP--LYRWGKLCRSWTNRKN 616
           +  +  + L  I   + A+P   YRWGK  R   ++K+
Sbjct: 574 Q--WASWLLAFIATAMIALPFGFYRWGKGLRHKLSKKD 609

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 120/552 (21%), Positives = 204/552 (36%), Gaps = 103/552 (18%)

Query: 89  TKKGIILNPQPSECKK------------DPLNWPIWRR-------DIALVCVGW--HCFV 127
           +KKG    P P+E +K            +P NWPIW R          +VCV +   C  
Sbjct: 100 SKKG--EEPYPAEPEKLRFVTFVTGDPANPHNWPIWIRWLYTIILSTLVVCVAYGSACIT 157

Query: 128 GGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVG 187
           GG  T           A L V L         M+L    G +  SP + ++G+R  Y V 
Sbjct: 158 GGLSTVSDTYHVGNEVAILSVSL---------MVLGFAFGPLIWSPFSDIYGRRAAYFVS 208

Query: 188 ILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTX 247
           + +++I +I CA S + +  +I R + G   S+   L   +IA+++ A  R   +  +  
Sbjct: 209 LGLYVIFNIPCAISPNISGHMICRFLCGVYASSGLCLVGGSIADMFPAETRGKAIAFFAF 268

Query: 248 XXXXXXXXXXXXXSLVFEHLST---HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNK 304
                          V   +ST    ++ W     AG  ++L  L +PET+    PV   
Sbjct: 269 APYCGPVFGPLVNGFV--SVSTGRMDYIIWFNMAFAGVMWLLVAL-IPETY---APV--- 319

Query: 305 RSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGS 364
                               I + R+ +L  R+  G          L  E+ AQ      
Sbjct: 320 --------------------ILSRRAKKL--RKETGDSR-------LVTETEAQ------ 344

Query: 365 KTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSL 424
                   +S K M     +     ++    +V+   ++   Y   L  A+ +AY V+  
Sbjct: 345 -------GVSFKDMLRACLVRPLYFSVTEPVLVLTSGYICLIYS--LLYAFFFAYPVI-- 393

Query: 425 IIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYE 484
                     + ++YG+    +GL++I   IG C+          +  +L+         
Sbjct: 394 ----------FNELYGYKDNLIGLMFIPILIGACMALCTTFWCEHLYLKLIKQRRPC--- 440

Query: 485 PEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDS 544
           PE RL   +      AI L   G +  +   W+ P+      G+G  +   +   Y +D 
Sbjct: 441 PEDRLLGAMIGAPFAAIALWMLGATSYKHLIWVAPASSGLAFGYGMVLIYYSLNNYIIDC 500

Query: 545 YKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRW 604
           Y +++  AL T   +++  G A   F  +   + G + A    A I   + +      RW
Sbjct: 501 YAKYASSALATKVFLRSAGGAAFPLFTTQMYHNLGLQWASWLLAFIATGMIIIPFAFKRW 560

Query: 605 GKLCRSWTNRKN 616
           GK  R+   R +
Sbjct: 561 GKSLRARLGRAD 572

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 116/519 (22%), Positives = 198/519 (38%), Gaps = 77/519 (14%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMM-L 162
           ++P NWP+W R +  + +          ++ +  G   +S +  V   ++S L   +M +
Sbjct: 186 QNPHNWPLWLRWVYTILLSILVIAVAYGSACITGGLFTVSDKFHVS-QEVSILTCSLMVI 244

Query: 163 SLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVE 222
              +G +  SP + LFG+R+ Y V + +++I +I CA + +   LL+ R + G   S+  
Sbjct: 245 GFSLGPLIWSPVSDLFGRRVAYFVSLGLYVIFNIPCALAPNIGCLLVCRFLCGVWSSSGL 304

Query: 223 SLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTH---WLFWILTII 279
            L   +IA+++    R   +  +                  F  +STH    +FW+    
Sbjct: 305 CLVGGSIADMFPPETRGRAIAFFAYAPYCGPVFGPLVNG--FISVSTHRMDLIFWVNMAF 362

Query: 280 AGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESA 339
           AG  + L +  +PETF    PV  KR                    A +R    NP+   
Sbjct: 363 AGVMW-LVVACIPETF---APVILKR------------------RAAKLRRETGNPK--- 397

Query: 340 GHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVML 399
                      +  E  AQ    G    A +  +    +A+          +D  C    
Sbjct: 398 -----------IMTEQEAQGLSVGEMVNACV--LRPLYLAV------TEPVLDLMCF--- 435

Query: 400 RPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL 459
             +V   Y   L  A+ +AY V+            + ++YG+    +GL+ I   IG   
Sbjct: 436 --YVCLIYS--LLYAFFFAYPVI------------FGELYGYKDNLIGLMLIPILIG--- 476

Query: 460 GSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP 519
            S+     S   T+ L         PE RL   +      AI L   G +      W+ P
Sbjct: 477 ASVALATTSFCETQYLKITKRRNPTPEDRLLGAMIGAPFAAIALWILGATAYHHIIWVGP 536

Query: 520 SIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEG 579
           +    V G+G  +   +   Y +D Y  ++  AL T   +++  G A   F  +     G
Sbjct: 537 ASSGLVFGYGMVLIYYSLNNYIIDCYAMYASSALATKVFLRSAGGAAFPLFTEQMYHKLG 596

Query: 580 YKNAFTCYALIEIFIGLWAIP--LYRWGKLCRSWTNRKN 616
            + A    A I     + AIP   Y +GK  R+  ++KN
Sbjct: 597 LQWASWLLAFIS--TAMVAIPFAFYYYGKGLRAKLSKKN 633

>CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P38776 Saccharomyces cerevisiae
           YHR048w
          Length = 498

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 92/456 (20%), Positives = 171/456 (37%), Gaps = 74/456 (16%)

Query: 161 MLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLST 220
           +  LG G +F SP + L+G+R+ ++  + + +I       S +   +L  R +SGF  S 
Sbjct: 103 IFGLGFGPLFLSPISELYGRRITFVSSLFLSIIWQCLTTWSKTIEGVLFGRFLSGFFGSV 162

Query: 221 VESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIA 280
             S+    I++I+   +    + IYT                ++ H +  W F  L I +
Sbjct: 163 FLSVAGGAISDIFSKKQIGIPMAIYTTAAFLGPSLGPIISGALY-HANYKWTFVTLLIAS 221

Query: 281 GSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAG 340
           G    L ++ VPET+                                             
Sbjct: 222 GVCLTLIVISVPETY--------------------------------------------- 236

Query: 341 HVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLR 400
                  PV L  ++     ETG         I+ K+ +I            +  +   R
Sbjct: 237 ------APVLLIKKAQRLREETGDDRYYAPLEITRKETSI----------FKSVVLSAKR 280

Query: 401 PFVLFSYPAILFGAWLYAYAVVSLIIISQV-IDHAYKDIYGFSSASVGLVYIAPFIGGCL 459
           PF L     ++     Y   V++++ +  V   + ++ +Y F+   VG  YI    G  +
Sbjct: 281 PFGLLLRDPMMGVLCFYTGLVLAIVYLYFVAFPYVFETLYHFTVMEVGCSYI----GLMV 336

Query: 460 GSLIAGRGSDVNTRLLAA---HNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHW 516
           G L+A   S +  +   A    N G+  PE R   +     C  IGL+ F W+     HW
Sbjct: 337 GMLLASPTSYIFQKRYDAKVERNGGVRTPEMRFEPLYYGAFCTPIGLMIFAWTCYSHVHW 396

Query: 517 IIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCL 576
           I P I   + G G          Y VD+Y++++   +   + V++++      F ++  +
Sbjct: 397 IGPQIGSAIFGVGVYFVFVGVFGYTVDAYRKYAASGMACNSFVRSVMSGVFPLFGLQ--M 454

Query: 577 HEGYKNAFTCYALIEIFIGLWAIPLY--RWGKLCRS 610
           ++G    +  + +  + + +  +P    R+G   RS
Sbjct: 455 YKGMGVNWAGFLIAMVTVLMIPVPFLFDRYGPYLRS 490

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 112/548 (20%), Positives = 203/548 (37%), Gaps = 95/548 (17%)

Query: 108 NWPIWRR----DIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
            +P W++     +  VC     F G    S+     S +S E  V     +       ++
Sbjct: 73  EFPQWKKWSIVTVIFVCQLSMNFNG----SVYPHALSLISKEFHVSSQAANTSQMIFKVA 128

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
            G G    +P +  +G+R +  + +    I  I    + +F  ++++R + G   +   S
Sbjct: 129 YGFGCELWAPWSEEYGRRNIMQLSLFFTNIWQILGGKAPNFGTIIVARFLGGISQAG-GS 187

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +    +A+++   +  Y +                   L+ EHLS HW FWI  I  G  
Sbjct: 188 VTLGVVADMWQPQDHGYAVAYVVLASVLGAVIGPVFGGLMEEHLSWHWNFWIQLIFGGVT 247

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
            +LH   VPET         + S+   R A++ R   E+  I         P E      
Sbjct: 248 QLLHFFLVPET---------RASVLTDREAKRRRKSGEDPEI-------YGPHE------ 285

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
                                     +KS+  K++            +  W    LRPF 
Sbjct: 286 --------------------------VKSLDFKEI------------MRTW----LRPFY 303

Query: 404 LF-SYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSL 462
           +F   P +LF + L  +A   + I +Q     +K  + FS+ + GL++I   +   +   
Sbjct: 304 MFLCEPIVLFCSLLSGFADHLIFICNQSFTPIFKQ-WHFSTTACGLIFITLVVSYAIAYP 362

Query: 463 IAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDH--WIIPS 520
           +         + +    H    PE RL ++L      +IGL GF W+     +  WI P+
Sbjct: 363 LHLIDIYYMRKKMDELMHSPRGPERRLLLLLYLAPLLSIGLFGFAWTSMGPSYTPWIAPA 422

Query: 521 IFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFF------NVKF 574
           IF  V+G  +       I Y V +Y  ++  A     + +++LG   + +      N+  
Sbjct: 423 IFSTVIGIANYSIYMATIDYMVAAYGPYASSATGGNGLARDLLGGIAAMYAGPLYNNIGG 482

Query: 575 CLHEGYKNAFT-CYAL---IEIFIGLWAIPLYRWGKLCRSWTNRKNLLQFSYRVNDDGKD 630
             H  + +    C ++   I I+I  W  PL R           K   + +  + D+ + 
Sbjct: 483 KFHYQWASTLLGCLSIICSIPIYIFYWKGPLIR--------KKSKFAQEIARSLEDEMEH 534

Query: 631 EKDNHTER 638
            +  HT++
Sbjct: 535 VQPGHTDK 542

>Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 86/415 (20%), Positives = 150/415 (36%), Gaps = 66/415 (15%)

Query: 161 MLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLST 220
           +  LG+G +F SP + L+G+R  ++  + + ++       S +   ++  R +SGF  S 
Sbjct: 119 VFGLGIGPLFLSPLSELYGRRTTFIYALTLSVVWQCLTIWSKTITGVMFGRFLSGFFGSA 178

Query: 221 VESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIA 280
             S+    IA+I+   +    + IYT                ++ H +  W F  L I +
Sbjct: 179 FLSVAGGAIADIFDKDQIGVPMAIYTTSAFLGPSLGPIIGGALY-HENYKWTFITLLITS 237

Query: 281 GSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAG 340
           G   V+ +L +PET+         + +   R A+++R                  +E   
Sbjct: 238 GCCLVVIMLTIPETY---------KPMLLMRKAKRLR------------------KEK-- 268

Query: 341 HVNDDGVPVGL--TDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVM 398
             ND+     L  T E  +  +     TR     +   QM   L  Y G           
Sbjct: 269 --NDERYYAALEVTREQTSLLSAILLSTRRPFGLLLRDQMMGVLCFYTGLEL-------- 318

Query: 399 LRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGC 458
                                A+V L  ++    + +K +Y F   +V   YI   +G  
Sbjct: 319 ---------------------AIVYLYFVA--FPYVFKKLYNFGPMAVACSYIGIMVGML 355

Query: 459 LGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWII 518
           L +           R +   N+G+  PE R   +        IGL  F ++  +  HWI 
Sbjct: 356 LSAPTCLLFQKTFERRV-KRNNGVKTPEMRFEPLFYGAFLTPIGLFIFAFTCYKHVHWIA 414

Query: 519 PSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVK 573
           P I   V G G     T    Y VD+Y+ ++   +     V+ I+      F ++
Sbjct: 415 PIIGSAVFGSGVYFVFTGVFAYTVDAYRRYAASGMACNTFVRCIMAGVFPLFGLQ 469

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 94/431 (21%), Positives = 168/431 (38%), Gaps = 63/431 (14%)

Query: 126 FVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYL 185
           F+G    ++       L +E     + I+  V   M    VG    +  A   G++ +Y+
Sbjct: 122 FLGPVTGNIYIPALPILQSEFNTSTTAINGTVAAFMGVFAVGPFLWAVHADFGGRKFLYI 181

Query: 186 VGILIFMIGSIG-CACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGI 244
             ++I +I ++   A       L I RV    G S V  L   T++++     RA  +  
Sbjct: 182 FSLMIALIANVLLAAVPKHLAALYILRVFQAIGTSAVIPLGVGTVSDLISPMNRAKGVSY 241

Query: 245 YTXXXXXXXXXXXXXXSLVFEHLST-HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPN 303
           +                L+  + +   WLF   +I  G   +L + F+PET   R  V N
Sbjct: 242 FMLGPNMGPILGPIFGGLILMNGNQWRWLFGFTSITTGVGLILIVTFLPETL--RCIVGN 299

Query: 304 KRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETG 363
                                         +PR       D   P  L+ E ++Q  E  
Sbjct: 300 G-----------------------------DPRWK----EDSEFPASLSIEESSQTKEE- 325

Query: 364 SKTRAHI---------KSISEKQMAIGLGIYHGRHTIDNWCMVML--RPFVLFSYPAILF 412
           S  + H+         K +++  +   L     + T  ++ +  L  R  +     AILF
Sbjct: 326 SVVKPHMQLFRDLGLQKPVNDTPVFAKLYPRPPKPTWRSYYLTFLELRVIICSISTAILF 385

Query: 413 GAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNT 472
            ++ Y ++V+        + H     +GF++  +G  Y+ P IG   GSL  G  SD   
Sbjct: 386 SSY-YCFSVI--------LSHELHSRFGFNNLQIGACYVCPGIGLLCGSLSGGHLSD--- 433

Query: 473 RLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSM 532
               A +   + PE+RL+  +  +  +  G  GFGW++E++ H ++  +F  +L FG + 
Sbjct: 434 -FFKAKSKK-WIPEYRLWFQIWGLAISMAGCCGFGWAIEKELHIVVILVFSFLLAFGMTW 491

Query: 533 CSTTAITYAVD 543
           CS   +T+  +
Sbjct: 492 CSNATMTFLTE 502

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 93/437 (21%), Positives = 168/437 (38%), Gaps = 69/437 (15%)

Query: 138 GFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIG 197
              +L  +  V    ++  V   ++  GV    +   A ++G+R V L+G+LI++  SIG
Sbjct: 109 ALKQLEKQFSVSEELVNITVVVYLIFQGVAPTISGGLADVYGRRPVILIGMLIYVCASIG 168

Query: 198 CACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXX 257
            ACS S+  ++  R +   G+S + ++ S  + +     ER   +G  +           
Sbjct: 169 LACSNSYGVIVFLRCLQSAGISPIIAINSGVVGDFTVKQERGTFVGAVSGFTLMGQAFGS 228

Query: 258 XXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVR 317
              + +        +FW LTI  G+  +++ L +PET   R+ V N     ++ + R   
Sbjct: 229 LIGAALTAAFDWRAIFWFLTIGCGTCMLVNFLLLPET--KRSIVGNMSIKPKSFVNRAPI 286

Query: 318 GLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQ 377
            L ++V             +   H +   VP          + +T   T+A +  IS  +
Sbjct: 287 FLLKSV-------------QRRFHYD---VP----------DYQTLDPTKAKVDPISAMK 320

Query: 378 MAIGLGIYHGRHTIDNWCMVMLRPFVLFS-YPAIL-FGAWLYAYAVVSLIIISQVIDHAY 435
                              ++  P ++ S  PA L F  W    A +S            
Sbjct: 321 -------------------ILAHPEIIMSLMPAGLQFALWTITLASIS--------SQLS 353

Query: 436 KDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVN-----TRLLAAHNHGIYEPEF--- 487
            + Y +    +G+ Y+   IGG +GS + G+  D+       R       G+   +    
Sbjct: 354 VEPYNYKLTIIGVCYLPSGIGGLVGSFVTGKIIDIYYKRAVRRFEEKKEKGLIPADTKFN 413

Query: 488 ----RLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVD 543
               RL+  +P    + I    FGWS+ER  H  +P I   +  F +    +++ T  VD
Sbjct: 414 TLRARLYTSIPQNFLSVIAFTLFGWSVERGWHIAVPLITSCIGSFCAMSTLSSSSTLLVD 473

Query: 544 SYKEFSQEALVTLNMVK 560
            Y   S  A    N ++
Sbjct: 474 LYPSKSSTATSCYNFIR 490

>CAGL0H06017g Chr8 complement(588556..590229) [1674 bp, 557 aa] {ON}
           similar to uniprot|P38124 Saccharomyces cerevisiae
           YBR008c FLR1
          Length = 557

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 121/545 (22%), Positives = 203/545 (37%), Gaps = 89/545 (16%)

Query: 82  SDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSK 141
           SD      K   ++     +    P NW   ++ + ++       V    +S+   G  +
Sbjct: 80  SDKEADTKKDPFLVTFNGEDDPLMPYNWSTNKKALIIIQTMLLTCVNYMGSSIYTPGQLE 139

Query: 142 LSAELQVPLSQISYLVGPMMLSL-----GVGSIFASPTAVL--FGKRLVYLVGILIFMIG 194
           +  E  V      ++VG + LSL     G+G I  SP   +   G+  VY++   +F + 
Sbjct: 140 IQNEFHV-----GHVVGTLNLSLYVLGYGLGPIVFSPLTEISSIGRLPVYMITFFLFTML 194

Query: 195 SIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXX 254
            IGCA + +F  L+I R ++G   S   S   AT+ +I   +  A  LG+++        
Sbjct: 195 QIGCALAPNFAGLVILRFITGVLCSPALSTGGATLGDIVSQNYLALVLGLWSIGAVAAPV 254

Query: 255 XXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIAR 314
                 + +       W+FW+L     +  +L   F PET  D         LH  R A 
Sbjct: 255 LAPLLGASMVVAKDWRWIFWLLFFCCCATMLLLTFFFPETSSDTV-------LH--RKAA 305

Query: 315 QVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSIS 374
           ++R L+ +    T                          E   +EA+           + 
Sbjct: 306 RIRKLTGDNRYYT--------------------------EKEREEAQ-----------LP 328

Query: 375 EKQMAIGLGIYHGRHTIDNWCMVMLRPFVL-FS-YPAILFGAWLYAYAVVSLIIISQVID 432
           +KQ  I             + M++  P VL F  Y A+ +GA+   +    ++       
Sbjct: 329 KKQFLI-------ETLYRPFSMMITEPIVLAFDLYIALCYGAFYLFFEAFPIV------- 374

Query: 433 HAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHN--HGIYEPEFRLF 490
             +  IY F+    GL Y     G C+G + A     V +  +AA    +  + PE  L 
Sbjct: 375 --FGGIYHFTLVEQGLAY----FGFCVGCIFAYIILLVFSIKVAAKRFANNTFTPETTLI 428

Query: 491 MVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQ 550
           + +    C  + L  FGW+   + HWI+P I       G       + +Y    Y ++  
Sbjct: 429 LAMCIGWCIPLALFMFGWT--AKVHWILPIISEVFFVLGCFNIFQASFSYLAICYPKYVA 486

Query: 551 EALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCY--ALIEIF-IGLWAIP--LYRWG 605
                    ++    A   F      + G KN    +  +L+  F IGLW IP  LY++G
Sbjct: 487 SVFAGNGFARSSFAAAFPLFGQAMYNNLGTKNYPVAWGSSLVGFFTIGLWVIPFVLYKYG 546

Query: 606 KLCRS 610
              RS
Sbjct: 547 PSLRS 551

>Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 86/415 (20%), Positives = 151/415 (36%), Gaps = 72/415 (17%)

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
           LG+G +F SP + L+G+R+ +L  + + +I       S +   ++  R +SGF  S   S
Sbjct: 122 LGIGPLFLSPLSELYGRRITFLYALTLSIIWQCLTIWSRTITGVMFGRFLSGFFGSAFLS 181

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +    IA+I+   +    + IYT                ++ H S  W F  L I +G  
Sbjct: 182 VAGGAIADIFDKDQIGIPMAIYTTSAFLGPSLGPIIGGALY-HESYKWTFITLLITSGCC 240

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
            VL +  +PET+         + +   R A+++R                  +E     N
Sbjct: 241 LVLIMFTIPETY---------KPMLLIRKAKRLR------------------KEK----N 269

Query: 344 DDG--VPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRP 401
           D+    P+ +  +  +  +     TR     +   +M   L  Y G              
Sbjct: 270 DERYYAPLEVVRDQTSLLSAIFLSTRRPFGLLFRDRMMSVLCFYTGLEL----------- 318

Query: 402 FVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGS 461
                       A +Y Y V           + +K +Y F    +   YI   +G  L +
Sbjct: 319 ------------AIIYLYFV--------AFPYVFKKLYNFGPMEIACSYIGIMVGMILSA 358

Query: 462 ---LIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWII 518
              L+  +  +   +     N+GI  PE R   +        IGL  F ++  +  HWI 
Sbjct: 359 PTCLLFQKTFEWRVK----RNNGIKTPEMRFEPLFYGAFLTPIGLFIFAFTCYKHVHWIA 414

Query: 519 PSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVK 573
           P I   + G G     T    Y VD+Y+ ++   +     V+ I+      F ++
Sbjct: 415 PIIGSAIFGSGVYFVFTGVFAYTVDAYRRYAASGMACNTFVRCIMAGIFPLFGLQ 469

>KLTH0C08074g Chr3 (688367..690295) [1929 bp, 642 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS- MDR)
          Length = 642

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 108/273 (39%), Gaps = 15/273 (5%)

Query: 322 NVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIG 381
            ++    R  +L  R   G +        L +E +  E E  S  +A +  + ++  +  
Sbjct: 353 QITRVQTRDPKLEMRMREGELKR--WKTNLENELDRMETEKTSD-KAEVLDLPKRSWSTT 409

Query: 382 LGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAY-KDIYG 440
           L IY          +  L+      YP +       A +   L  ++  ++++Y +  Y 
Sbjct: 410 LYIY---------LIKPLKSLHFLRYPPVTLAITFSAISFAILYFVNMTLEYSYSRSPYN 460

Query: 441 FSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRL-FMVLPAVLCN 499
           F    VGL+YI   +   + S+  G+  D N        HG   PE R+ + V+ AV+  
Sbjct: 461 FKPLYVGLLYIPNSVTYVIASIYGGKWVD-NLLRQYKKKHGTLAPEARISWNVVTAVVTF 519

Query: 500 AIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMV 559
            I LL FGW L+++ HW+ P +   + G+ S M     + Y VDS        +   N++
Sbjct: 520 PISLLIFGWCLDKKQHWVTPLVGTALFGYASMMTIGATVAYLVDSLPGRGATGVALNNLI 579

Query: 560 KNILGFAVSFFNVKFCLHEGYKNAFTCYALIEI 592
           +        F         G   AFT  A I I
Sbjct: 580 RQAFAATAVFVTEPMLEGMGPGWAFTMLAFIVI 612

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 91/197 (46%)

Query: 87  KKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAEL 146
           +K ++GI+ N       KD  N+P   +   +  + +   +G   TS++    + +S + 
Sbjct: 64  RKQRRGILANLSVVPEYKDARNYPGKLKAGIIFLIAYAAMMGPMGTSIIYPSINPISEDY 123

Query: 147 QVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNW 206
           +     ++  VG  +LSLGV  ++ S  + L G+R VY++   +     +G A + +   
Sbjct: 124 KTTTMMVNVSVGIYLLSLGVLPLWWSSLSELRGRRTVYVLSFSLLCAFCVGSALAPNIQA 183

Query: 207 LLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEH 266
            ++ R++ G   ++V+S+ + T+A+++   +R   LG Y               SL+   
Sbjct: 184 FIVFRMLCGACSASVQSVGAGTVADLFKPEDRGKMLGYYYLGALMAPLLAPIIGSLLVSR 243

Query: 267 LSTHWLFWILTIIAGSN 283
            S     W + I+AG N
Sbjct: 244 WSWRSTQWFMVILAGVN 260

>TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa]
           {ON} 
          Length = 566

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 96/416 (23%), Positives = 160/416 (38%), Gaps = 70/416 (16%)

Query: 160 MMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLS 219
            ++S G G    +P +  +G+  V  + +L   I  I    + +F  ++++R + G  L+
Sbjct: 105 FLVSYGFGCELWAPWSEEYGRWRVMQLSLLFSNIWQILGGLAPNFGTIIVARFLGGMSLA 164

Query: 220 TVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTII 279
              S+    +A+++   +  Y +                   L+ EHLS HW FWI  I 
Sbjct: 165 G-GSVTLGVVADMFDPIDHGYAVAFIVLSSVCGSVIGPIFGGLMQEHLSWHWNFWIQLIF 223

Query: 280 AGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESA 339
            G   +LH   VPET         + S+   R A++ R   E+ +I         P E  
Sbjct: 224 NGVAQILHFFIVPET---------RSSVLVDREAKRRRESGEDPTI-------YGPGE-- 265

Query: 340 GHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVML 399
                                              +K+M          H    W    +
Sbjct: 266 -----------------------------------DKKMDF-------HHVFTTW----V 279

Query: 400 RPFVLF-SYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGC 458
           RPF +F   P +LF + L  +A   + I +Q     +   +GFS  + GL++IA  IG  
Sbjct: 280 RPFHMFVCEPIVLFCSLLSGFADHLIFICNQSFGPIFMQ-WGFSITAQGLIFIAVLIGYL 338

Query: 459 LGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDH--W 516
           L  +          R +    +    PE RL ++L  V   AIGL GF W+     +  W
Sbjct: 339 LAYVFHVVDVFYQKRDVEKIANSPRGPERRLLLLLYLVPWLAIGLFGFAWTSMGPAYTPW 398

Query: 517 IIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNIL-GFAVSFFN 571
           I P+IF  ++G  +       I Y V +Y  ++  A     + +++L G A  + N
Sbjct: 399 IAPAIFAALIGIANYSIYMATIDYMVAAYGPYASSATGGNGLARDVLSGIAAMYAN 454

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 94/434 (21%), Positives = 163/434 (37%), Gaps = 77/434 (17%)

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESL 224
           GV    +   A ++G+R + L G+LI+++ SIG ACS S+  ++  R V   G+S + ++
Sbjct: 147 GVAPTISGGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFLRCVQSAGISPLIAI 206

Query: 225 PSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIA 280
            S  + +     ER    G +               SL+   L+  +    +FW LTI  
Sbjct: 207 SSGVVGDFTTKSER----GSFVGAVSGFALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC 262

Query: 281 GSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAG 340
           G+ FV++   +PET                      R ++ N+SI   R     P  +  
Sbjct: 263 GTCFVINFFLLPET---------------------KRTITGNLSIKPKRMINRAPILALP 301

Query: 341 HVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLR 400
           +     +     D  +   +E      + +K I+  ++ + L                  
Sbjct: 302 YFQRR-LKYDNPDYDSLDHSEVKIDLISALKIIAHPEIIMSL------------------ 342

Query: 401 PFVLFSYPAIL-FGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL 459
                  PA L F  W      +S    SQ+ +  Y     +S   +G+ Y+   I G +
Sbjct: 343 ------MPAGLQFALWTLTLTSIS----SQLAEAPYN----YSLTIIGICYLPAGISGLI 388

Query: 460 GSLIAGRGSDVN-----TRLLAAHNHGIYEPE-------FRLFMVLPAVLCNAIGLLGFG 507
           GS   G+  D+       +       G+  P+        RL   LP    + +    FG
Sbjct: 389 GSFCTGKVIDIYYKSALRKFQQRQEQGLIAPDARFNILKARLITALPQNFVSVVAFTIFG 448

Query: 508 WSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILG--F 565
           WS+++  H  +P +  G+  F +    +T+ T  VD Y   S  A    N ++  L   F
Sbjct: 449 WSVQKGWHIAVPLVTSGIGSFCAMSTLSTSSTLLVDLYPSKSSTATSCYNFIRCSLSAIF 508

Query: 566 AVSFFNVKFCLHEG 579
              F  +K  +  G
Sbjct: 509 MACFAKMKASMTVG 522

>SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]
           {ON} weakly similar to uniprot|Q06451 Saccharomyces
           cerevisiae YPR156C TPO3 Polyamine transport protein
          Length = 621

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 96/496 (19%), Positives = 177/496 (35%), Gaps = 73/496 (14%)

Query: 103 KKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMML 162
           + DP  W   ++      +G  CF     ++++            V L  I   V  M+L
Sbjct: 127 RDDPRTWNTRQKWNLTALLGIVCFDVAMMSAVVTGDMESPREYFGVSLEVIILTVTLMVL 186

Query: 163 SLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVE 222
             G+G +  +P +  FG+  VY   + + ++  + C  + +   LL  R + G   S   
Sbjct: 187 GFGLGPLVFAPLSEEFGRNWVYHPTLFVAIVFIVPCGAAKNIGTLLAFRFLDGLAFSAPM 246

Query: 223 SLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGS 282
            L   ++++++   ER   + +++              SL+    S  W++W + I +  
Sbjct: 247 CLIGGSLSDMWRNKERGVAMSVFSAAPFMGPVMGPIVGSLLSVKCSWRWVYWFMLIFSAC 306

Query: 283 NFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHV 342
            + + ++F+PET             H+T + R+ + L +     + R+            
Sbjct: 307 LYGVMVVFLPETH------------HQTLLKRRAKKLRKLTGDPSYRAI----------- 343

Query: 343 NDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPF 402
                                    + IK  S K++  G                +LRP 
Sbjct: 344 -------------------------SEIKVRSLKEVVEG---------------TLLRPI 363

Query: 403 VLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYG----FSSASVGLVYIAPFIGG- 457
            L +   I+F   LY   +  L+ +      AY  +Y     +      L++I   +G  
Sbjct: 364 TLLT-ELIVFLITLYMSVIYGLLYM---FFFAYPVVYSEGKHWGDIKTSLMFIPVGVGVI 419

Query: 458 CLGSLIAGRGSDVNTRLLAAHNHGIYEP-EFRLFMVLPAVLCNAIGLLGFGWSLERQDHW 516
           C  ++      D   R     + G   P E RL  ++        GL  + WS      W
Sbjct: 420 CSTAISPLLNRDYLKRAQRYLDRGEVPPAELRLIPMMVGCWFIPAGLFAYAWSSYPHVSW 479

Query: 517 IIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCL 576
             P       G G +M    A  Y VDSY+ ++   L     V+++ G AV  F ++   
Sbjct: 480 AGPCFSGFACGLGFNMLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGAAVPLFTIQMYH 539

Query: 577 HEGYKNAFTCYALIEI 592
             G + A +  A I +
Sbjct: 540 RLGNQWATSLMAFISL 555

>NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON}
           Anc_5.284
          Length = 528

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 96/466 (20%), Positives = 172/466 (36%), Gaps = 83/466 (17%)

Query: 161 MLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLST 220
           +  LG G +F SP +  +G+R  ++  + + +I       S +   ++  R +SGF  ST
Sbjct: 133 IFGLGFGPLFLSPISEFYGRRPTFIFSLTVSIIWQCLTTWSRTIEGMMFGRFLSGFFGST 192

Query: 221 VESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIA 280
             S+   +I++I+        + IYT                +++ +   W F  L I +
Sbjct: 193 FLSVAGGSISDIFDKDSITVPMAIYTTSAMLGPELGPIISGALYK-VDYKWTFVTLLIAS 251

Query: 281 GSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAG 340
           G    L ++ VPET+  +  +   + L                            RE  G
Sbjct: 252 GVCLALIIVTVPETYEPKLLIKKAQRL----------------------------REETG 283

Query: 341 HVNDDGVPVGLTDESNAQEAETGSKTRAHIKSI--SEKQMAIGLGIYHGRHTIDNWCMVM 398
                       DE      E   K  + + S+  S K                      
Sbjct: 284 ------------DERWVAPLEITKKETSFMSSVFLSSK---------------------- 309

Query: 399 LRPFVLFSYPAILFGAWLYAYAVVSLIIISQV-IDHAYKDIYGFSSASVGLVYIAPFIG- 456
            RPF+L     ++     Y   V++++ +  V   + +K +YGF    V   YI   +G 
Sbjct: 310 -RPFLLLVRDPMMGVLCFYTGLVLAIVYLFFVAFPYIFKKLYGFHEMEVACAYIGMLVGM 368

Query: 457 --GCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQD 514
              C  S+I  +  ++  +     N+G   PE R   +      + +GLL F W+     
Sbjct: 369 LVACPTSIIFQKRYELKVK----ANNGERTPEMRFEPLFYGAFLSPVGLLIFAWTCYSHV 424

Query: 515 HWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKF 574
           HWI P I  GV G G          Y VD+Y+ F+   +   + V++ +      F ++ 
Sbjct: 425 HWIGPIIGSGVFGTGVFFVFVGVFNYTVDAYRRFAASGMACNSFVRSTMSGVFPLFGLQ- 483

Query: 575 CLHEGYKNAFTCYALIEIFIGLWAIPL-------YRWGKLCRSWTN 613
            ++EG    +  + L  + + +  +P        Y  GK   +WT+
Sbjct: 484 -MYEGMGINWASFLLAMVTMLMIPVPFLFTKYGAYLRGKSPYAWTD 528

>Smik_2.161 Chr2 complement(302754..304823) [2070 bp, 689 aa] {ON}
           YBR043C (REAL)
          Length = 689

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 85/194 (43%), Gaps = 3/194 (1%)

Query: 399 LRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAY-KDIYGFSSASVGLVYIAPFIGG 457
           L+      YP +       A +  ++  ++  +++ Y +  Y F    +GL+YI   +  
Sbjct: 465 LKSLYFLQYPPVALAITFSAISFSTVYFVNMTVEYKYSRPPYNFKPLYIGLLYIPNSVTY 524

Query: 458 CLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRL-FMVLPAVLCNAIGLLGFGWSLERQDHW 516
              S+  GR  D+  R      +GI  PE R+ + V+ +V+   I LL FGW L+++ HW
Sbjct: 525 FFASIYGGRWVDMLLRRYK-EKYGILAPEARISWNVVTSVISFPIALLIFGWCLDKKCHW 583

Query: 517 IIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCL 576
           + P I   + G+ + M     ++Y VDS        +   N+++ IL     F       
Sbjct: 584 VTPLIGTALFGYAAMMTIGATLSYLVDSLPGKGATGVALNNLIRQILAATAVFVTTPMLN 643

Query: 577 HEGYKNAFTCYALI 590
             G   AFT  A I
Sbjct: 644 GMGTGWAFTLLAFI 657

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 103/218 (47%), Gaps = 6/218 (2%)

Query: 82  SDDHL--KKTKKGIILNPQPSECK--KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLAS 137
           S+D++  K  ++G++  PQ +     KD  ++P   + + +  + +   +G   TS++  
Sbjct: 72  SNDYVVPKNERRGLL--PQLAIVPEFKDARDYPPKMKKMIVFLIAFSSMMGPMGTSIIFP 129

Query: 138 GFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIG 197
             + ++ E +  +  ++  +G  +LSLGV  ++ S  + L G+R  Y+    +    +IG
Sbjct: 130 AINAITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSSLSELEGRRTTYITSFALLFAFNIG 189

Query: 198 CACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXX 257
            A +   N  +  R++ G   ++V+S+ + T+A++Y + +R   L  Y            
Sbjct: 190 SALAPDINSFIALRMLCGAASASVQSVGAGTVADLYISEDRGKNLSYYYLGPLLAPLLSP 249

Query: 258 XXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETF 295
              SL+          W + I++G N +L  + +PET 
Sbjct: 250 IFGSLLVNRWPWRSTQWFMVILSGCNVILLTVLLPETL 287

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 115/484 (23%), Positives = 187/484 (38%), Gaps = 86/484 (17%)

Query: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC 200
           +L  +  V  + ++  V   +L  G+    +   A  FG+R + L G+LI+++ SIG AC
Sbjct: 125 QLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASIGLAC 184

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
           + S+  ++  R +   G+S   ++ S  + +    HER    G +               
Sbjct: 185 APSYGVIIFLRCIQSIGISPTIAISSGVVGDFTLKHER----GTFVGATSGFVLLGQCFG 240

Query: 261 SLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQV 316
           SL+   L+  W    +FW LTI  GS F++  L +PET                      
Sbjct: 241 SLIGAVLTARWDWRSIFWFLTIGCGSCFLIAFLILPET---------------------K 279

Query: 317 RGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEK 376
           R ++ N+SI   R     P    G       PV    + +  + ET   T   +   S  
Sbjct: 280 RTIAGNLSIKPKRLINRAPIFLLG-------PVKRRFKYDNPDYETLDPTIPKLDLSSAG 332

Query: 377 QMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPA-ILFGAWLYAYAVVSLIIISQVIDHAY 435
           +                  +++L   +L  +P+ +LF  W         +++S +     
Sbjct: 333 K------------------ILVLPEIILSLFPSGLLFAMW--------TLMLSSISSGLS 366

Query: 436 KDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRL------------LAAHNHGIY 483
              Y +    +G+ Y+   IGG LGS   GR  D+  +             L   +  I 
Sbjct: 367 VAPYNYHLVIIGVCYLPGGIGGLLGSFFTGRVIDMYFKRKVKKFEQDKANGLIPQDAEIN 426

Query: 484 EPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCS----TTAIT 539
               RL  +LP      +  L FGWS+++   W I SI   +  F  S C+    +T+ T
Sbjct: 427 MFRVRLVCLLPQNFLAVVAYLLFGWSIDK--GWRIESIL--ITSFVCSYCAMSTLSTSTT 482

Query: 540 YAVDSYKEFSQEALVTLNMVKNILG--FAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLW 597
             VD Y + S  A    N V+  L   F   F  +K  +  G    F C AL+  F  L 
Sbjct: 483 LLVDLYPKKSSTASSCFNFVRCSLSTIFMGCFAKMKASMTVGGTFTFLC-ALVFFFNFLM 541

Query: 598 AIPL 601
            IP+
Sbjct: 542 FIPM 545

>TBLA0E02520 Chr5 complement(632027..633718) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 114/541 (21%), Positives = 205/541 (37%), Gaps = 88/541 (16%)

Query: 88  KTKKGIILNP-----QPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKL 142
           K K+G   +P        +  ++PLNW  W++ + +  V     +    +S+   G  ++
Sbjct: 87  KGKEGTEFDPFLVDWHGPDDPENPLNWKPWKKGLIMFEVMLLTSINYMGSSIYTPGQEEI 146

Query: 143 SAELQVPLSQISYLVGPMMLSLGVGSIFASPTA--VLFGKRLVYLVGILIFMIGSIGCAC 200
             E  V     +  +   +L  G+G +  SP +    FG+  +Y++ + +F I  IG A 
Sbjct: 147 QREFHVGHVVATLNLSMYVLGYGIGPMILSPLSEYARFGRLHIYIISMFLFTIFQIGAAT 206

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
             +   L++ R +SG   S   +    T+A+          +G+++              
Sbjct: 207 VHNIGGLIVIRFISGILCSPALATGGGTLADFLDPKTLPRYIGLWSLGFMSAPVSAPLLG 266

Query: 261 SLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLS 320
           + +       W+FW+L  ++ + FV+ + F PET             H   I  +     
Sbjct: 267 ACMVVAKDWRWIFWLLLFMSVALFVMLIFFFPET-------------HHGNILHR----- 308

Query: 321 ENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAI 380
                   R+ RL  R+  G  +D    + + +E+N                       +
Sbjct: 309 --------RAQRL--RKETG--DDRYYTLQIREEAN-----------------------L 333

Query: 381 GLGIYHGRHTIDNWCMVMLRPFVL-FS-YPAILFGAWLYAYAVVSLIIISQVIDHAYKDI 438
            LG +  +  +  + +++  P +L F  Y A+ +G +   +    L+ +          I
Sbjct: 334 TLGPFLKKCLLKPFKLIIQEPIILSFDLYLAVCYGIFYLFFEAFPLVFVG---------I 384

Query: 439 YGFSSASVGLVYIAPFIGGCLGSLIAGR--GSDVNTRLLAAHNHGIYEPEFRLFMVLPAV 496
           Y F+   +GL Y    +G C+G + A     +  N  +     +  + PE   FMVL   
Sbjct: 385 YNFTLIELGLSY----LGFCVGCVFAYPIFLTFFNKFITPKFANNTFTPEH--FMVLSKY 438

Query: 497 LC--NAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALV 554
           +C    + L  FGW+   + HWI+P I       G      T  +Y    Y E       
Sbjct: 439 ICWFLPLALFFFGWT--AKVHWILPIISEMFFVIGVFNLFQTLFSYLALCYTEHLSSVYA 496

Query: 555 TLNMVKNILGFAVSFFNVKFCLHEGYKN---AFTCYALIEIFIGLWAIP--LYRWGKLCR 609
                ++I   A   F      + G KN   A+    L  I IGL  IP  +Y++G   R
Sbjct: 497 GNGFFRSIFASAFPLFGQAMFNNLGTKNYPVAWGSSLLGFIAIGLTLIPIVIYKYGGYLR 556

Query: 610 S 610
           S
Sbjct: 557 S 557

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 83/167 (49%), Gaps = 10/167 (5%)

Query: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC 200
           +L  +  +  ++++  V   +L  G+    +   A +FG+R V L+G+LI+++ SIG AC
Sbjct: 116 QLEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASIGLAC 175

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
           + S+  ++  R++   G+S   ++ S  + +    HER    G +               
Sbjct: 176 APSYGVIVFLRIIQSIGISPTIAISSGVVGDFTLKHER----GTFVGATSGLVLLGQCFG 231

Query: 261 SLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPETFWDRTPVPN 303
           SL+   L+  W    +FW LTI  G++F++  L +PET   RT V N
Sbjct: 232 SLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPET--KRTLVGN 276

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 118/560 (21%), Positives = 205/560 (36%), Gaps = 99/560 (17%)

Query: 75  KGQE--SGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRR-------DIALVCVGWHC 125
           KG+E  S G++D        I      ++  ++P NWP W R        I ++CV +  
Sbjct: 137 KGKEGDSSGANDEAPGLDPEIEFVTFVTDDPENPHNWPGWIRWSYTVLLSILVICVAYG- 195

Query: 126 FVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYL 185
                 ++ ++ G   +  +  V L         M+L   +G +  SP + L+G+R+ Y 
Sbjct: 196 ------SACISGGLGTVQKKYHVGLEAAILSCSLMVLGFSLGPLIWSPVSDLYGRRVAYF 249

Query: 186 VGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIY 245
           V + +++I +I CA + +   LL+ R + G   S+   L   +IA+++ +  R   +  +
Sbjct: 250 VSMGLYVIFNIPCALAPNLGCLLVCRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIAFF 309

Query: 246 TXXXXXXXXXXXXXXSLVFEHLST---HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVP 302
                            +   +ST     +FW+    AG  +++    +PET+    PV 
Sbjct: 310 AFAPYVGPVVGPLVNGFI--SVSTGRMDLIFWVNMAFAGVMWIIASA-IPETY---APVI 363

Query: 303 NKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAET 362
            KR                    A +R    NP+              +  E  AQ    
Sbjct: 364 LKR------------------KAARLRKETGNPK--------------IMTEQEAQGISM 391

Query: 363 GSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVV 422
           G   +A                             +LRP        +L     Y   + 
Sbjct: 392 GEMMKA----------------------------CLLRPLYFSVTEPVLVATCFYVCLIY 423

Query: 423 SLI-IISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHG 481
           SL+          + ++YG+    VGL++I P + G L +L      +   + LA     
Sbjct: 424 SLLYAFFFAFPVIFGELYGYKDNLVGLMFI-PIVIGALWALATTFYCE--NKYLAIVKQR 480

Query: 482 IYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYA 541
              PE RL          AI L   G +  +   W+ P+      GFG  +   +   Y 
Sbjct: 481 KPTPEDRLMGAKIGAPFAAIALWILGATAYKHIIWVGPASAGLAFGFGMVLIYYSLNNYI 540

Query: 542 VDSYKEFSQEALVTLNMVKNILGFAVSFFNV----KFCLHEG-YKNAFTCYALIEIFIGL 596
           +D Y +++  AL T   +++  G A   F +    K  LH G +  AF   A+I +    
Sbjct: 541 IDCYVQYASSALATKVFLRSAGGAAFPLFTIQMYHKLNLHWGSWLLAFISTAMIAL---- 596

Query: 597 WAIPLYRWGKLCRSWTNRKN 616
                  WGK  R   ++K+
Sbjct: 597 -PFAFSYWGKDLRHKLSKKD 615

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 106/503 (21%), Positives = 187/503 (37%), Gaps = 90/503 (17%)

Query: 105 DPLNWPIWRR-------DIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLV 157
           +P NWP+W R          ++CV +        ++ +  GF  +  +  V L       
Sbjct: 180 NPHNWPLWIRWTYTILLSTLVICVAYG-------SACVTGGFGTIEKKFHVSLEAAILSC 232

Query: 158 GPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFG 217
             M++   VG +  SP + L+G+R+ Y   + +++I +I CA + +   LL  R + G  
Sbjct: 233 SLMVIGFSVGPLLWSPVSDLYGRRVAYFFSMGLYVIFNIPCAIAPNLGCLLACRFLCGVW 292

Query: 218 LSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST---HWLFW 274
            S+   L   +IA+++ +  R   +  +                 +   +ST     +FW
Sbjct: 293 SSSGLCLVGGSIADMFPSETRGKAIAFFAYSPYCGPVFGPLVNGFI--SVSTGRMDLIFW 350

Query: 275 ILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLN 334
           +    AG  +++    +PET+    PV  KR                       R+ +L 
Sbjct: 351 VNMAFAGVMWIISSA-IPETY---APVILKR-----------------------RAAKLR 383

Query: 335 PRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNW 394
                    + G P  +T+    QEA+           I+  +M     I   + +I   
Sbjct: 384 --------KETGNPKIMTE----QEAQ----------GITFNEMMSACVIRPLKFSITEP 421

Query: 395 CMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPF 454
            + M   +V   Y   L  A+ +AY V+            + ++YG+    +GL++I   
Sbjct: 422 VLFMTCFYVCLIYS--LLYAFFFAYPVI------------FGELYGYKDNMIGLMFIPIL 467

Query: 455 IGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQD 514
           IG     L          +L+         PE RL          AI L   G +     
Sbjct: 468 IGASFAVLTTFWCESQYLKLVKTRKP---TPEDRLLGAKIGAPFAAIALWMLGATTYNHR 524

Query: 515 HWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNV-- 572
            W+ P+      GFG  +   +   Y +D Y +++  AL T   +++  G A   F    
Sbjct: 525 MWLAPASSGMPFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTTQM 584

Query: 573 --KFCLH-EGYKNAFTCYALIEI 592
             K  LH   +  AF C A+I +
Sbjct: 585 YHKLGLHWASWLLAFICTAMIAL 607

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 105/504 (20%), Positives = 188/504 (37%), Gaps = 90/504 (17%)

Query: 104 KDPLNWPIWRR-------DIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYL 156
           ++P NWP+W R          ++CV +        ++ +  GF  +  +  V L      
Sbjct: 165 ENPHNWPLWIRWCYTILLSTLVICVAY-------GSACITGGFGTVEEKFHVSLEASILS 217

Query: 157 VGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF 216
              M++   VG +  SP + L+G+R+ Y   + +++I +I CA + +   LL  R + G 
Sbjct: 218 CSLMVIGFSVGPLLWSPVSDLYGRRVAYFFSMGLYVIFNIPCALAPNLGCLLACRFLCGV 277

Query: 217 GLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST---HWLF 273
             S+   L   +IA+++ +  R   +  +                 +   +ST     +F
Sbjct: 278 WSSSGLCLVGGSIADMFPSETRGKAIAFFAYSPYCGPVFGPLVNGFI--SVSTGRMDLIF 335

Query: 274 WILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRL 333
           W+    AG  +++    +PET+    PV  KR       A ++R  + N  I T +  + 
Sbjct: 336 WVNMAFAGVMWIISSA-IPETY---APVILKRR------AAKLRKETGNPKIMTEQEAQ- 384

Query: 334 NPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDN 393
                           G+T      E  T    R    S++E  +               
Sbjct: 385 ----------------GIT----FNEMMTACVVRPLKFSVTEPVL--------------- 409

Query: 394 WCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAP 453
            CM      +++S    L  A+ +AY V+            + ++YG+    +GL++I  
Sbjct: 410 -CMTCFYVCLIYS----LLYAFFFAYPVI------------FSELYGYKDNIIGLMFIPI 452

Query: 454 FIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQ 513
            IG     L          +L+         PE RL          A+ L   G +    
Sbjct: 453 LIGASFAVLTTFWCESQYLKLIKTRKP---TPEDRLLGAKIGAPFAALALWMLGATTYNH 509

Query: 514 DHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNV- 572
             W+ P+      GFG  +   +   Y +D Y +++  AL T   +++  G A   F   
Sbjct: 510 RMWLAPASSGMPFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTTQ 569

Query: 573 ---KFCLH-EGYKNAFTCYALIEI 592
              K  LH   +  AF C A+I +
Sbjct: 570 MYHKLGLHWASWLLAFICTAMIAL 593

>Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {ON}
           YBR043C (AQR2) - YBR043C [contig 184] FULL
          Length = 642

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 107/274 (39%), Gaps = 15/274 (5%)

Query: 319 LSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQM 378
           L+  ++    R  RL  R   G +        L +E      E  + T A   SI ++  
Sbjct: 350 LAPQITKIQTRDRRLEQRMREGEIQR--WKTNLENELEKMGTEK-NMTGAETASIPKRSW 406

Query: 379 AIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAY-KD 437
              L IY          +  L+      YP +       A +   L  ++  ++++Y + 
Sbjct: 407 GTSLYIY---------LVKPLKSLHFLRYPPVTLAITFSAISFAILYFVNMTVEYSYSRS 457

Query: 438 IYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRL-FMVLPAV 496
            Y F    VGL+YI   +   + S+  G+  D N        +G   PE R+ + V+ AV
Sbjct: 458 PYNFKPLYVGLLYIPNSVTYVIASIYGGKWVD-NLLRQYKKKYGTLAPEARISWNVVTAV 516

Query: 497 LCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTL 556
           +   I LL FGW L+++ HW+ P +   + G+ S M     + Y VDS        +   
Sbjct: 517 ISFPISLLIFGWCLDKKQHWVTPLVGTALFGYASMMTIGATVAYLVDSLPGRGATGVALN 576

Query: 557 NMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALI 590
           N+++        F         G   AFT  A++
Sbjct: 577 NLIRQAFAATAVFVTEPMLKGMGPGWAFTMLAIL 610

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 89/197 (45%)

Query: 87  KKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAEL 146
           +  ++G++ N       KD  ++P   +   +  + +   +G   TS++    + +  + 
Sbjct: 64  RNQRRGVLANFSLVPEYKDARDYPPKLKAFIIFLIAYAAMMGPMGTSIIFPSITSIEKDF 123

Query: 147 QVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNW 206
                 ++  VG  +LSLGV  ++ S  + L G+R VY++   +     IG A + +   
Sbjct: 124 DTTTMMVNVSVGIYLLSLGVLPLWWSSLSELRGRRTVYVLSFTLLCAFCIGSALAPNIEA 183

Query: 207 LLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEH 266
            ++ R++ G   ++V+S+ + T+A++Y   +R  RLG Y               SL+   
Sbjct: 184 FIVFRMLCGASSASVQSVGAGTVADLYKPEDRGKRLGYYYLGALMAPLLSPIIGSLLVNR 243

Query: 267 LSTHWLFWILTIIAGSN 283
            S     W + I+AG N
Sbjct: 244 WSWRSTQWFMVILAGVN 260

>KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {ON}
           weakly similar to uniprot|P53283 Saccharomyces
           cerevisiae YGR138C TPO2 Polyamine transport protein
          Length = 606

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 86/191 (45%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
           +DP NWP  ++    V +G  CF     ++++       +A   V +  +   V  M+  
Sbjct: 123 EDPRNWPTRQKWNYTVLLGIICFDVAMMSAIITGDMDSPAAYFGVSMEVMCLCVSLMVWG 182

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
            G+G +  +P +  FG+  VYLV + I ++  + C  + +   LL  R + G   S    
Sbjct: 183 FGLGPMLFAPLSEEFGRNPVYLVTLFIAVVFIVPCGAAKNIGTLLAFRFLDGLAFSAPMC 242

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           L   ++++++   ER   + +++              SL+    S  W++W + I +G  
Sbjct: 243 LIGGSLSDMWRNKERGVAMSLFSAAPFLGPVMGPIVGSLLSVKCSWRWVYWFMVIFSGCL 302

Query: 284 FVLHLLFVPET 294
           + +  +F+PET
Sbjct: 303 YAVMAVFLPET 313

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 95/245 (38%), Gaps = 18/245 (7%)

Query: 397 VMLRPFVLFSYPAILFGAWLYA---YAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAP 453
            + RP VL +   I+F   +Y    Y ++ +   +  + +     YG    S+  +   P
Sbjct: 353 TLFRPLVLLT-ELIVFLITMYMSVIYGLLYMFFFAYPMVYTEGKHYGAIKTSIMFI---P 408

Query: 454 FIGGCLGSLIAGR--GSDVNTRLLAAHNHGIYEP-EFRLFMVLPAVLCNAIGLLGFGWSL 510
              G +GS +A      D   R     + G   P E RL  ++        GL  + WS 
Sbjct: 409 VGAGVIGSTVAAPFLNKDYVKRAQRYLDRGEVPPAELRLIPMMIGCWFVPAGLFAYAWSS 468

Query: 511 ERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFF 570
             +  W  P       GFG +M    A  Y VDSY+ ++   L     V+++ G AV  F
Sbjct: 469 YPRLSWAGPCFSGFACGFGFNMLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGGAVPLF 528

Query: 571 NVKFCLHEGYKNAFTCYALIEIFIGLWAIP--LYRWGKLCRSWTNRKNLLQFSYRVNDDG 628
            ++      Y+ A T  A I   +   AIP   Y +G   R    +K+   +S  V+   
Sbjct: 529 TIQMYRRLNYEWASTLMAFIS--LACCAIPYLFYFYGARIR----QKSKYAYSPSVDTTN 582

Query: 629 KDEKD 633
               D
Sbjct: 583 TTRTD 587

>Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON}
           YBR043C (REAL)
          Length = 683

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 84/194 (43%), Gaps = 3/194 (1%)

Query: 399 LRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAY-KDIYGFSSASVGLVYIAPFIGG 457
           L+      YP +       A +  ++  ++  +++ Y +  Y F    +GL+YI   I  
Sbjct: 459 LKSLYFLQYPPVALAITFSAISFSTVYFVNMTVEYKYSRPPYNFKPLYIGLLYIPNSITY 518

Query: 458 CLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRL-FMVLPAVLCNAIGLLGFGWSLERQDHW 516
              S+  GR  DV  +      +GI  PE R+ + V+ +V+   I LL FGW L+++  W
Sbjct: 519 LFASIYGGRWVDVLLKRYK-EKYGILAPEARISWNVVTSVISFPIALLIFGWCLDKKCQW 577

Query: 517 IIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCL 576
           + P I   + G+ + M     ++Y VDS        +   N+++ IL     F       
Sbjct: 578 VTPLIGTALFGYAAMMTIGATLSYLVDSLPGKGATGVALNNLIRQILAATAVFVTTPMIN 637

Query: 577 HEGYKNAFTCYALI 590
             G   AFT  A I
Sbjct: 638 GMGTGWAFTMLAFI 651

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 89/192 (46%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
           KD  ++P   + + +  + +   +G   TS++    + ++ E +  +  ++  +G  +LS
Sbjct: 96  KDARDYPPMMKKMIVFLIAFSSMMGPMGTSIIFPAINAITTEFKTSVIMVNVSIGVYLLS 155

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
           LGV  ++ S  + L G+R  Y+    +    SIG A +   N  +  R++ G   ++V+S
Sbjct: 156 LGVFPLWWSSLSELEGRRTTYITSFAMLFAFSIGSALAPDINSFIALRMLCGAASASVQS 215

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + + T+A++Y + +R   L  Y               SL+          W + I++G N
Sbjct: 216 VGAGTVADLYISEDRGKNLSYYYLGPLLAPLLSPIIGSLLVNRWPWRSTQWFMVILSGCN 275

Query: 284 FVLHLLFVPETF 295
            +L  + +PET 
Sbjct: 276 VILLTVLLPETL 287

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 110/519 (21%), Positives = 200/519 (38%), Gaps = 77/519 (14%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMM-L 162
           ++P NWP+W R +  + +          ++ +  G   +S +  V   ++S L   +M L
Sbjct: 190 ENPHNWPLWLRWVYTILLSILVIAVAYGSACITGGLGTVSDKFHVS-QEVSILTCSLMVL 248

Query: 163 SLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVE 222
              +G +  SP + L G+R+ Y + + +++I +I CA + +   LL  R + G   S+  
Sbjct: 249 GFSLGPLIWSPVSDLLGRRVAYFISLGLYVIFNIPCALAPNIGCLLACRFLCGVWSSSGL 308

Query: 223 SLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTH---WLFWILTII 279
            L   +IA+++    R   +  +                  F  ++T+    +FW+    
Sbjct: 309 CLVGGSIADMFPPETRGRAIAFFAYAPYCGPVFGPLVNG--FISVATNRMDLIFWVNMAF 366

Query: 280 AGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESA 339
           AG  +++  L +PETF    PV  KR                       R+ RL      
Sbjct: 367 AGVMWIIVAL-IPETF---APVILKR-----------------------RAARLR----- 394

Query: 340 GHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVML 399
               + G P  +T+    QEA+ G   R  ++    + + + +        +D  C    
Sbjct: 395 ---KETGNPKIMTE----QEAQ-GLSVREMVQDCLLRPLYLAV----TEPVLDLMCF--- 439

Query: 400 RPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL 459
             +V   Y   L  A+ +AY V+            + ++YG+    +GL+ I   IG   
Sbjct: 440 --YVCLIYS--LLYAFFFAYPVI------------FGELYGYKDNLIGLMLIPILIG--- 480

Query: 460 GSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP 519
            S+     +    + +         PE RL   +      AI L   G +  +   W+ P
Sbjct: 481 ASVALATTTFCENQYIKITRRRKPTPEDRLLGAMIGAPFAAIALWILGATAYKHIIWVGP 540

Query: 520 SIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEG 579
           +      G+G  +   +   Y +D Y  ++  AL T   +++  G A   F  +     G
Sbjct: 541 ASSGLAFGYGMVLIYYSLNNYIIDCYAVYASSALATKVFLRSAGGAAFPLFTEQMYHKLG 600

Query: 580 YKNAFTCYALIEIFIGLWAIP--LYRWGKLCRSWTNRKN 616
              A    A I     + AIP   + WGK  R+  ++KN
Sbjct: 601 LHWASWLLAFIS--TAMVAIPFAFFHWGKDLRAKLSKKN 637

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 113/525 (21%), Positives = 198/525 (37%), Gaps = 89/525 (16%)

Query: 104 KDPLNWPIWRR---------DIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQIS 154
           ++P NWP+W R          +  V  G  C  GG  T       S+  A L   L  I 
Sbjct: 156 ENPHNWPLWIRWSYTILMSVLVIAVAYGSACITGGLFTVEEKFHVSQEVAILSCSLMVIG 215

Query: 155 YLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVS 214
           + +GP++ S         P + L+G+R+ Y + + +++I +I CA + +   LL+ R + 
Sbjct: 216 FSLGPLIWS---------PVSDLYGRRVAYFISLGLYVIFNIPCALAKNIGTLLVCRFLC 266

Query: 215 GFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTH---W 271
           G   S+   L   +IA+++ A  R   +  +                 +   +ST+    
Sbjct: 267 GVWSSSGLCLVGGSIADMFPAETRGRAIAFFAYAPYCGPVFGPLVNGFI--AISTNRMDL 324

Query: 272 LFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRST 331
           +FW+    AG  +++ +  +PET+    PV  K+     RI                   
Sbjct: 325 IFWVNMAFAGVMWII-VSCIPETY---APVILKKRAKRLRIELN---------------- 364

Query: 332 RLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTI 391
             NP+              +  E  AQ        RA +  +     A+          +
Sbjct: 365 --NPK--------------IMTEQEAQGMSVSELVRACL--LRPLYFAV------TEPVL 400

Query: 392 DNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYI 451
           D  C      +V   Y   L  A+ +AY V+            +  +YG+    +GL++I
Sbjct: 401 DLMCF-----YVCLIYS--LLYAFFFAYPVI------------FGKLYGYKDNIIGLMFI 441

Query: 452 APFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLE 511
            P + G  G+L     S   +R +A  +     PE RL   +      AI L   G +  
Sbjct: 442 -PILIGASGAL--ATTSWCESRYVALTHKRKPTPEDRLLGAMIGAPFAAIALWILGATSY 498

Query: 512 RQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFN 571
           +   W+ P+      G+G  +   +   Y +D Y  ++  AL T   +++  G A   F 
Sbjct: 499 KHIIWVGPASSGLAFGYGMVLIYYSLNNYIIDCYAMYASSALATKVFLRSAGGAAFPLFT 558

Query: 572 VKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNRKN 616
            +     G + A    A I   + L     Y +GK  R+  ++K+
Sbjct: 559 SQMYDRLGLQWASWLLAFISTAMILIPFAFYYYGKALRAKLSKKD 603

>TDEL0D06500 Chr4 (1166063..1167691) [1629 bp, 542 aa] {ON} 
          Length = 542

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 120/553 (21%), Positives = 212/553 (38%), Gaps = 95/553 (17%)

Query: 77  QESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLA 136
            ES  ++  + + K   ++     +  + P NW   +R   ++ V     V    +S+  
Sbjct: 60  SESQSAEKEVSQEKDPFLVEFSGPDDPEHPHNWSTGKRTAVIIQVMLLTSVTYMGSSIYT 119

Query: 137 SGFSKLSAELQVPLSQISYLVGPMMLSL-----GVGSIFASPTAVL--FGKRLVYLVGIL 189
            G  ++  E  V      ++VG + LS+     G+G IF SP +     G++ +Y++   
Sbjct: 120 PGQEQIQQEFNV-----GHVVGTLNLSMYVLGYGLGPIFFSPLSEFAKIGRQPLYIITFF 174

Query: 190 IFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXX 249
           +F +  IG A   +   L+I R ++G   S   +   AT+ +I         +G+++   
Sbjct: 175 LFAMLQIGTALVKNIAGLVILRFITGILCSPSLATGGATVGDIVPPDYVPLFIGLWSVGA 234

Query: 250 XXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHE 309
                      + + +     W+FW+L  +A +  ++ + F PET               
Sbjct: 235 VSAPVVGPLLGAAMVDAKDWRWIFWLLMWLASATLIVLVFFFPET--------------- 279

Query: 310 TRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAH 369
                     SE+ SI   R+ RL                 +T +     A+  S+ R  
Sbjct: 280 ----------SED-SILYRRAIRLR---------------RITGDDRYYTAKAKSEDRLS 313

Query: 370 IKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLY-AYAVVSLIIIS 428
           +K I    M I L                 RPF +     I+    +Y A    +  +  
Sbjct: 314 LKEI----MVIAL----------------YRPFEIIVKEPIVAAIDIYIALCYGTFYLFF 353

Query: 429 QVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAH--NHGIYEPE 486
           +     +  IY F+   +GL     F+G C+G +IA     V    + A    +  + PE
Sbjct: 354 EAFPIVFGGIYHFTLIEIGLA----FMGFCVGCVIAYAICIVFLMKVVAKKAKNDKFTPE 409

Query: 487 FRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSI--FFGVLGFGSSMCSTTAITYAVDS 544
             + + +   LC  + L  FGW+     HWI+P I   F V+G  +   ++ A  Y   S
Sbjct: 410 TFMILAMATCLCLPLSLFLFGWA--AGVHWILPIIAELFFVIGLFNLFQASFA--YLAIS 465

Query: 545 YKEFSQEALVTLNMVKNILGFAVSFFNVKFCLH-----EGYKNAFTCYALIEIFIGLWAI 599
           Y ++         + +   GFA +F      ++     +GY  A+    L    I L AI
Sbjct: 466 YPKYLASVFAGNGVCRA--GFACAFPLFGKAMYDNLAIDGYPVAWGSSILGFFSIALAAI 523

Query: 600 P--LYRWGKLCRS 610
           P  LY++G   RS
Sbjct: 524 PFLLYKYGPYLRS 536

>YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}
           QDR3Multidrug transporter of the major facilitator
           superfamily, has a role in polyamine homeostasis;
           expression is upregulated under polyamine stress;
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin
          Length = 689

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 90/208 (43%), Gaps = 6/208 (2%)

Query: 388 RHTIDNWCMVMLRPFV---LFSYPAILFGAWLYAYAVVSLIIISQVIDHAY-KDIYGFSS 443
           R   D + +  ++P        YP +       A +  ++  ++  +++ Y +  Y F  
Sbjct: 451 RKVWDTFFVYFIKPLKSLHFLEYPPVALAITFSAISFSTVYFVNMTVEYKYSRPPYNFKP 510

Query: 444 ASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRL-FMVLPAVLCNAIG 502
             +GL+YI   +     S+  GR  D+  +      +GI  PE R+ + V+ +V+   I 
Sbjct: 511 LYIGLLYIPNSVTYFFASIYGGRWVDMLLKRYK-EKYGILAPEARISWNVVTSVISFPIA 569

Query: 503 LLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNI 562
           LL FGW L+++ HW+ P I   + G+ + M     ++Y VDS        +   N+++ I
Sbjct: 570 LLIFGWCLDKKCHWVTPLIGTALFGYAAMMTIGATLSYLVDSLPGKGATGVALNNLIRQI 629

Query: 563 LGFAVSFFNVKFCLHEGYKNAFTCYALI 590
           L     F         G   AFT  A I
Sbjct: 630 LAATAVFVTTPMLNGMGTGWAFTMLAFI 657

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 89/192 (46%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
           KD  ++P   + + +  + +   +G   TS++    + ++ E +  +  ++  +G  +LS
Sbjct: 96  KDARDYPPMMKKMIVFLIAFSSMMGPMGTSIIFPAINSITTEFKTSVIMVNVSIGVYLLS 155

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
           LGV  ++ S  + L G+R  Y+    +    +IG A +   N  +  R++ G   ++V+S
Sbjct: 156 LGVFPLWWSSLSELEGRRTTYITSFALLFAFNIGSALAPDINSFIALRMLCGAASASVQS 215

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + + T+A++Y + +R   L  Y               SL+          W + I++G N
Sbjct: 216 VGAGTVADLYISEDRGKNLSYYYLGPLLAPLLSPIFGSLLVNRWPWRSTQWFMVILSGCN 275

Query: 284 FVLHLLFVPETF 295
            +L  + +PET 
Sbjct: 276 VILLTVLLPETL 287

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 124/564 (21%), Positives = 204/564 (36%), Gaps = 103/564 (18%)

Query: 73  DMKGQE--SGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRR-------DIALVCV-- 121
           + KG+E  S G++D        I      +   ++P NWP W R        I ++CV  
Sbjct: 135 NEKGKEGDSSGANDEAPDLDPEIEFVTFVTGDPENPHNWPAWIRWSYTVLLSILVICVAY 194

Query: 122 GWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKR 181
           G  C  GG  T          +A L V L  I + +GP++ S         P + L+G+R
Sbjct: 195 GSACISGGLGTVEKKYHVGMEAAILSVSLMVIGFSLGPLIWS---------PVSDLYGRR 245

Query: 182 LVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYR 241
           + Y V + +++I +I CA + +   LL  R + G   S+   L   +IA+++ +  R   
Sbjct: 246 VAYFVSMGLYVIFNIPCALAPNLGSLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKA 305

Query: 242 LGIYTXXXXXXXXXXXXXXSLVFEHLST---HWLFWILTIIAGSNFVLHLLFVPETFWDR 298
           +  +                 +   +ST     +FW+    AG  +++    +PET+   
Sbjct: 306 IAFFAFAPYVGPVVGPLVNGFI--SVSTGRMDLIFWVNMAFAGVMWIISSA-IPETY--- 359

Query: 299 TPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQ 358
            PV  KR                    A +R    NP+              +  E  AQ
Sbjct: 360 APVILKR------------------KAARLRKETGNPK--------------IMTEQEAQ 387

Query: 359 EAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYA 418
               G   RA                             +LRP        +L     Y 
Sbjct: 388 GVSMGEMMRA----------------------------CLLRPLYFSVTEPVLVATCFYV 419

Query: 419 YAVVSLI-IISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAA 477
             + SL+          + ++YG+    VGL++I P + G L +L      +   + L  
Sbjct: 420 CLIYSLLYAFFFAFPVIFGELYGYKDNLVGLMFI-PIVIGALWALATTFYCE--NKYLQI 476

Query: 478 HNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTA 537
                  PE RL          AI L   G +  +   W+ P+      GFG  +   + 
Sbjct: 477 VKQRKPTPEDRLLGAKIGAPFAAIALWILGATAYKHIIWVGPASAGLAFGFGMVLIYYSL 536

Query: 538 ITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNV----KFCLHEG-YKNAFTCYALIEI 592
             Y +D Y +++  AL T   +++  G A   F +    K  LH G +  AF   A+I +
Sbjct: 537 NNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTIQMYHKLNLHWGSWLLAFISTAMIAL 596

Query: 593 FIGLWAIPLYRWGKLCRSWTNRKN 616
                      WGK  R   ++K+
Sbjct: 597 -----PFAFSYWGKGLRHKLSKKD 615

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 99/443 (22%), Positives = 164/443 (37%), Gaps = 81/443 (18%)

Query: 138 GFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIG 197
              +L  +  +  + ++  V   +L  G+    +   A  FG+R V L+G+LI+++ SIG
Sbjct: 122 ALKQLEKQFDIDENMVNITVVVYLLFQGLAPTCSGGLADKFGRRPVLLIGMLIYVVASIG 181

Query: 198 CACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXX 257
            AC+ S+  ++  R V   G+S   ++ S  + +     ER    G +            
Sbjct: 182 LACAPSYGVIVFLRCVQSIGISPSIAISSGVVGDFTVKSER----GTFVGATSGFVLLGQ 237

Query: 258 XXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIA 313
              SL+   L+  W    +FW LTI  G++F +    +PET         KRS+      
Sbjct: 238 AFGSLIGAALAAAWDWRAIFWFLTIGCGASFAICFALLPET---------KRSIVGNLSI 288

Query: 314 RQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSI 373
           R    L  N++  T+       R    + N D               ET  KT+      
Sbjct: 289 RPKNPL--NIAPVTLLPAA---RRKLKYDNPD--------------YETLDKTKPVFDLT 329

Query: 374 SEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDH 433
           S  ++     I+           + L P      P + F  W         +++S +   
Sbjct: 330 SAFKICALPEIF-----------LSLLP------PGLAFAMW--------TLMLSAISSE 364

Query: 434 AYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVN----TRLLAAHNHGIYEPE--- 486
                Y +    +G+ Y+   IGG +GS   G+  D       ++          PE   
Sbjct: 365 LSAAPYNYKLTIIGVCYLPAGIGGLIGSFATGKIIDFQYKKKLKVFEEKKAAGIIPEDEK 424

Query: 487 -----FRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAI--- 538
                 RL  VLP      +  + FGWS ++   W IPSI   +    SS C+ + +   
Sbjct: 425 FNIMGARLQSVLPQNFLCVVTYILFGWSCDK--GWKIPSIL--ITSCVSSFCAMSTLSAM 480

Query: 539 -TYAVDSYKEFSQEALVTLNMVK 560
            T  VD Y   S  A    N ++
Sbjct: 481 STLLVDLYPGKSSTASSCFNFMR 503

>Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON}
           YBR043C (REAL)
          Length = 688

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 84/194 (43%), Gaps = 3/194 (1%)

Query: 399 LRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAY-KDIYGFSSASVGLVYIAPFIGG 457
           L+      YP +       A +  ++  ++  +++ Y +  Y F    +GL+YI   +  
Sbjct: 464 LKSLYFLQYPPVALAITFSAISFSTVYFVNMTVEYKYSRPPYNFKPLYIGLLYIPNSVTY 523

Query: 458 CLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRL-FMVLPAVLCNAIGLLGFGWSLERQDHW 516
              S+  GR  D+  +      +GI  PE R+ + V+ +V+   I LL FGW L+++ HW
Sbjct: 524 FFASIYGGRWVDMLLKRYK-EKYGILAPEARISWNVVTSVISFPIALLIFGWCLDKKCHW 582

Query: 517 IIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCL 576
           + P I   + G+ + M     ++Y VDS        +   N+++ IL     F       
Sbjct: 583 VTPLIGTALFGYAAMMTIGATLSYLVDSLPGKGATGVALNNLIRQILAATAVFVTTPMLN 642

Query: 577 HEGYKNAFTCYALI 590
             G    FT  A I
Sbjct: 643 GMGTGWTFTMLAFI 656

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 101/228 (44%), Gaps = 13/228 (5%)

Query: 80  GGSDDHLKKTKKGIILNPQPSECK------------KDPLNWPIWRRDIALVCVGWHCFV 127
           G  D+ L + K    + P+ SE +            KD  ++P   + + +  + +   +
Sbjct: 61  GHKDNQLDRLKSKDYIVPK-SERRGLLPHLALIPEFKDARDYPPMMKKMIVFLIAFSSMM 119

Query: 128 GGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVG 187
           G   TS++    + ++ E +  +  ++  +G  +LSLGV  ++ S  + L G+R  Y+  
Sbjct: 120 GPMGTSIIFPAINAITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSSMSELEGRRTTYITS 179

Query: 188 ILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTX 247
             +    +IG A +   N  +  R++ G   ++V+S+ + T+A++Y + +R   L  Y  
Sbjct: 180 FALLFAFNIGSAFAPDINSFIALRMLCGAASASVQSVGAGTVADLYISEDRGKNLSYYYL 239

Query: 248 XXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETF 295
                        SL+          W + I++G N +L  + +PET 
Sbjct: 240 GPLLAPLLSPIIGSLLVNRWPWRSTQWFMVILSGCNVILLTVLLPETL 287

>KAFR0K00100 Chr11 complement(10324..11913) [1590 bp, 529 aa] {ON} 
          Length = 529

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 107/552 (19%), Positives = 207/552 (37%), Gaps = 84/552 (15%)

Query: 78  ESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLAS 137
           E+  S D+ +K     +++    +   +P NWP  +++   + +     +    +S+   
Sbjct: 49  EAETSTDY-EKHADPFLVDWNGDDDPDNPQNWPQAKKNFITIEIMMLTCITYMGSSIYTP 107

Query: 138 GFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVL--FGKRLVYLVGILIFMIGS 195
           G   +  +  V     +  +   +L  G+G +F SP + +   G++ +Y++   +FM+  
Sbjct: 108 GQEGIQNDFHVGHVTATLNLSLYVLGYGLGQVFFSPLSEVAKIGRQQLYIITYFLFMVFQ 167

Query: 196 IGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXX 255
           IGCA   +   L+I R +SG   S   S   ATIA+I    +    + ++          
Sbjct: 168 IGCATVQNIEGLIILRFISGILCSPSLSTGGATIADIIRPEKLTPYIALWAVGAVASPTV 227

Query: 256 XXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQ 315
                + +       W FW+L  ++    ++ + F PE     T   N  S    RI +Q
Sbjct: 228 GPLLGASMVVSKDWRWTFWLLLWLSIPWLIIFIFFFPE-----TSAANILSRRAARIRKQ 282

Query: 316 VRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISE 375
             G S   +       +++P++    VN    P                     I+ I++
Sbjct: 283 T-GDSRYYTRQERSDAKVSPKQF--FVNTLYRP---------------------IEMIAK 318

Query: 376 KQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAY 435
           + + +   IY                       A+ +G +   +    ++ I+       
Sbjct: 319 EPIVMAFDIYL----------------------AVCYGTFYLFFEAFPIVFINN------ 350

Query: 436 KDIYGFSSASVGLVYIAPFIGGCLGS---LIAGRGSDVNTRLLAAHNHGIYEPEFRLFMV 492
              + F+   +GL Y+  FI GC  +   L+      V  R     ++G + PE  L + 
Sbjct: 351 ---WHFTIVELGLSYMG-FIAGCFIAFSILLFFTNKVVTPR----RDNGTFVPETFLLLA 402

Query: 493 LPAVLCNAIGLLGFGWSLERQDHWIIP---SIFFGVLGFGSSMCSTTAITYAVDSYKEFS 549
           +    C   GL  FGW+     HWI+P    IFF +  F     +    +Y    Y ++ 
Sbjct: 403 MSVSWCLPCGLFLFGWA--AMTHWIVPIIAEIFFCICVFNLFQAT---FSYLAMCYPKYV 457

Query: 550 QEALVTLNMVKNILGFAVSFFNVKFCLH---EGYKNAF--TCYALIEIFIGLWAIPLYRW 604
                   + ++    A   F      +   +GY  A+  +    + I + L    LY++
Sbjct: 458 ASVYAGNGLCRSAFACAFPLFGQAMFNNLAIDGYPVAWGTSILGFVSIVLALIPFVLYKY 517

Query: 605 GKLCRSWTNRKN 616
           G   RS ++ K+
Sbjct: 518 GADLRSRSSFKD 529

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 122/566 (21%), Positives = 202/566 (35%), Gaps = 107/566 (18%)

Query: 80  GGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRR-------DIALVCV--GWHCFVGGG 130
           G  D HL    + +      ++  ++P NWP+W R          +VCV  G  C  GG 
Sbjct: 146 GSEDQHLDPDIEFVTFV---TDDPQNPHNWPLWVRWSYTALLSTLVVCVAYGSACITGGL 202

Query: 131 QTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILI 190
            T       S  +A L   L  I + VGP++ S         P + L+G+++ Y   + +
Sbjct: 203 GTVEEKFHVSLEAAILSCSLMVIGFAVGPLLWS---------PVSDLYGRKVAYFFSMGL 253

Query: 191 FMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXX 250
           + I +I CA + +   LL  R + G   S+   L   +IA+++ ++ R   +  +     
Sbjct: 254 YTIFNIPCALAPNLGCLLACRFICGIFASSGLCLVGGSIADMFPSNSRGKAIAFFAWAPY 313

Query: 251 XXXXXXXXXXSLVFEHLST---HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSL 307
                        F  +ST     +FW+     G+ +++  L +PET+    PV  K+  
Sbjct: 314 AGPCIGPLVNG--FISVSTGRMDLIFWVNMAFCGTMWIVASL-IPETY---APVILKK-- 365

Query: 308 HETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTR 367
                 R VR          +R    NP+              +  E  AQ        R
Sbjct: 366 ------RAVR----------LRKETGNPK--------------IMTEQEAQGLSFNEILR 395

Query: 368 AHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLI-I 426
           A                             +LRP        +L     Y   + SL+  
Sbjct: 396 A----------------------------CLLRPLYFAVTEPVLVATCFYVCLIYSLLYA 427

Query: 427 ISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPE 486
                   + D+YG+    +GL++I   IG                +++         PE
Sbjct: 428 FFFAFPVIFGDLYGYKDNLIGLMFIPILIGATFALAFTFWCESKYMQIVKTRRP---TPE 484

Query: 487 FRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYK 546
            RL   +      AI L   G +  ++  W+ P+      GFG  +   +   Y +D Y 
Sbjct: 485 DRLLGAMIGAPFAAIALWILGATALKRIIWVGPASSGLAFGFGMVLIYYSLNNYIIDCYV 544

Query: 547 EFSQEALVTLNMVKNILGFAVSFFNV----KFCLHEG-YKNAFTCYALIEIFIGLWAIPL 601
           +F+  AL T   +++  G A   F      K  LH G Y  AF   A+I +         
Sbjct: 545 QFASSALATKVFLRSAGGAAFPLFTTQMYHKLNLHWGSYLLAFISTAMIAL-----PFAF 599

Query: 602 YRWGKLCRSWTNRKNLLQFSYRVNDD 627
             WG+  R   ++K+   +S    DD
Sbjct: 600 AYWGRDLRHKLSKKD---YSIDTIDD 622

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 111/529 (20%), Positives = 193/529 (36%), Gaps = 97/529 (18%)

Query: 104 KDPLNWPIWRR-------DIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYL 156
           ++P NWP W R        I ++CV +        ++ ++ G   +  +  V +      
Sbjct: 156 ENPHNWPAWIRWSYTVLLSILVICVAYG-------SACISGGLGTVQKKYHVGMEAAILS 208

Query: 157 VGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF 216
              M+L   +G +  SP + L+G+R+ Y V + +++I +I CA + +   LL+ R + G 
Sbjct: 209 CSLMVLGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLVCRFLCGV 268

Query: 217 GLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST---HWLF 273
             S+   L   +IA+++ +  R   +  +                  F  +ST     +F
Sbjct: 269 WSSSGLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVNG--FISVSTGRMDLIF 326

Query: 274 WILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRL 333
           W+    AG  +++    +PET+    PV  KR                    A +R    
Sbjct: 327 WVNMAFAGVMWIIASA-IPETY---APVILKR------------------KAARLRKETG 364

Query: 334 NPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDN 393
           NP+              +  E  AQ    G   +A                         
Sbjct: 365 NPK--------------IMTEQEAQGISMGEMMKA------------------------- 385

Query: 394 WCMVMLRPFVLFSYPAILFGAWLYAYAVVSLI-IISQVIDHAYKDIYGFSSASVGLVYIA 452
               +LRP        +L     Y   + SL+          + ++YG+    VGL++I 
Sbjct: 386 ---CLLRPLYFAVTEPVLVATCFYVCLIYSLLYAFFFAFPVIFGELYGYKDNLVGLMFI- 441

Query: 453 PFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLER 512
           P + G L +L      +   + LA        PE RL          AI L   G +  +
Sbjct: 442 PIVIGALWALATTFYCE--NKYLAIVKQRKPTPEDRLLGAKIGAPFAAIALWILGATAYK 499

Query: 513 QDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNV 572
              W+ P+      GFG  +   +   Y +D Y +++  AL T   +++  G A   F +
Sbjct: 500 HIIWVGPASAGLAFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTI 559

Query: 573 ----KFCLHEG-YKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNRKN 616
               K  LH G +  AF   A+I +           WGK  R   ++K+
Sbjct: 560 QMYHKLNLHWGSWLLAFISTAMIAL-----PFAFSYWGKGLRHKLSKKD 603

>TDEL0F01670 Chr6 complement(309067..310815) [1749 bp, 582 aa] {ON}
           Anc_4.30 YLL028W
          Length = 582

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 99/445 (22%), Positives = 169/445 (37%), Gaps = 73/445 (16%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYL-VGPMMLSL 164
           P NWPI  + I  V +G +C      +S+ ASG  ++ A   V +  ++ L V   +L  
Sbjct: 133 PFNWPIRTKLILCVVLGLNCISIAMASSIFASGVEQICAIYHV-IPVVAILGVSLFVLGF 191

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESL 224
               I  +P + L+G+R V ++    F +     A +     ++I R  +G   +   ++
Sbjct: 192 AASPIVYAPLSELYGRRGVLVISAFGFTLFHFAIATAKDLQTIMICRFFAGLIGAAPMAV 251

Query: 225 PSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNF 284
             A  A+++  + R   + ++               S + +H +  WL +++ I +G  F
Sbjct: 252 VPAAFADMFDTNTRGKSICLFALGVFVGPILAPVIGSYIVQHTTWRWLEYVMGIFSGCVF 311

Query: 285 VLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVND 344
           V   L   ET    T + NK        AR +R L+ N  I     T             
Sbjct: 312 VAIALLFKETH-HPTILVNK--------ARAMRKLTNNWGIHAAHET------------- 349

Query: 345 DGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVL 404
                                    IK I++K +A                    RP V+
Sbjct: 350 ---------------------VELSIKEIAQKTIA--------------------RPIVM 368

Query: 405 F-SYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL-GSL 462
             + P +LF     ++    L ++ +     +   YGF +    L YIA  IG    G+ 
Sbjct: 369 LCTEPVLLFVTIYNSFVYGILYLLLEAYPIVFVGGYGFQTNG-ELPYIALIIGMFFCGAF 427

Query: 463 IAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQD--HWIIPS 520
           I     D   R+      G   PE RL  ++ A +   IG+L F W+    D  HW++P+
Sbjct: 428 IWYFEVDYLKRV---AKKGGLVPEARLIPMVYAGVVFPIGILWFCWTGNYPDKVHWMVPT 484

Query: 521 IFFGVLGFGSSMCSTTAITYAVDSY 545
           +    +GFG        + Y ++SY
Sbjct: 485 VAGAFIGFGLIGIFLPCLNYIIESY 509

>KAFR0J00480 Chr10 (84206..85708) [1503 bp, 500 aa] {ON} Anc_5.284
           YHR048W
          Length = 500

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 92/441 (20%), Positives = 160/441 (36%), Gaps = 70/441 (15%)

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
           L  G +F SP + L+G+R+ ++  +++ MI       S +   ++  R +SGF  S+  S
Sbjct: 108 LACGPLFLSPISELYGRRITFIFSLVLSMIFQCLTTWSATIEGVMFGRFLSGFFGSSFLS 167

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +   TI++++  ++    +  +T                ++  +   W F +  I +G  
Sbjct: 168 VAGGTISDLFDKNQITVPMTFFTTAGLLGPSLGPLISGAMYT-VEYRWTFVLFLISSGVC 226

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           FVL +L VPET+        + SL   +  R      E+   A +  TR           
Sbjct: 227 FVLIILTVPETY--------QPSLLIAKAKRLRNSTGEDRYYAPLEITR----------- 267

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
                     E+N   A   +  R       +  M + L  Y G                
Sbjct: 268 ---------KETNLLSAMFLTCRRPFGLLFRDPMMGV-LCFYTGVEL------------- 304

Query: 404 LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLI 463
                           A+V L  ++    + +K +Y F        YI    G   G L 
Sbjct: 305 ----------------AIVYLFFVA--FPYTFKTLYKFGVMEQACAYI----GLMCGMLF 342

Query: 464 AGRGSDVNTRLL---AAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPS 520
           A   + +  +      A+N G+  PE R   +        IGL+ F W+     HWI P 
Sbjct: 343 AAPTAVLFQKRFEKRVANNGGVSVPEMRFEPLFYGAFLTPIGLMIFSWTCYSNVHWIGPI 402

Query: 521 IFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGY 580
           I   V  FG          Y VD+YK+++   L     V+ I+      F ++  ++EG 
Sbjct: 403 IGSAVFSFGLLYVFVGIFNYTVDAYKKYAASGLACNTFVRCIMAGVFPLFGLQ--MYEGM 460

Query: 581 KNAFTCYALIEIFIGLWAIPL 601
              +  + L  I + +  +P 
Sbjct: 461 GINWASFLLTMITVLMIPVPF 481

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 116/562 (20%), Positives = 204/562 (36%), Gaps = 99/562 (17%)

Query: 73  DMKGQE--SGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRR-------DIALVCVGW 123
           + KG+E  S G++D        I      +   ++P NWP W R        I ++CV +
Sbjct: 135 NEKGKEGDSSGANDEAPDLDPEIEFVTFVTGDPENPHNWPGWIRWTYTVLLSILVICVAY 194

Query: 124 HCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLV 183
                   ++ ++ G   +  +  V +         M++   +G +  SP + L+G+R+ 
Sbjct: 195 G-------SACISGGLGTVEKKFHVGMEAAILSCSLMVIGFSLGPLIWSPVSDLYGRRIA 247

Query: 184 YLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLG 243
           Y V + +++I +I CA + +   LL  R + G   S+   L   +IA+++ +  R   + 
Sbjct: 248 YFVSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIA 307

Query: 244 IYTXXXXXXXXXXXXXXSLVFEHLST---HWLFWILTIIAGSNFVLHLLFVPETFWDRTP 300
            +                 +   +ST     +FW+    AG  +++  L +PET+    P
Sbjct: 308 FFAFAPYVGPVVGPLVNGFI--SVSTGRMDLIFWVNMAFAGVMWIVSSL-IPETY---AP 361

Query: 301 VPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEA 360
           V  KR                    A +R    NP+              +  E  AQ  
Sbjct: 362 VILKR------------------KAARLRKETGNPK--------------IMTEQEAQGI 389

Query: 361 ETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYA 420
                 RA                             +LRP        +L     Y   
Sbjct: 390 SMSEMMRA----------------------------CLLRPLYFAVTEPVLVATCFYVCL 421

Query: 421 VVSLI-IISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHN 479
           + SL+          + ++YG+    VGL++I P + G L +L      +   + LA   
Sbjct: 422 IYSLLYAFFFAFPVIFGELYGYKDNLVGLMFI-PIVIGALWALATTFYCE--NKYLAIVK 478

Query: 480 HGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAIT 539
                PE RL          AI L   G +  +   W+ P+      G+G  +   +   
Sbjct: 479 QRKPTPEDRLMGAKIGAPFAAIALWILGATSYKHIIWVGPASAGLAFGYGMVLIYYSLNN 538

Query: 540 YAVDSYKEFSQEALVTLNMVKNILGFAVSFFNV----KFCLHEG-YKNAFTCYALIEIFI 594
           Y +D Y +++  AL T   +++  G A   F +    K  LH G +  AF   A+I +  
Sbjct: 539 YIIDCYVQYASSALATKVFLRSCGGAAFPLFTIQMYHKLNLHWGSWLLAFISTAMIAL-- 596

Query: 595 GLWAIPLYRWGKLCRSWTNRKN 616
                    WGK  R   ++K+
Sbjct: 597 ---PFAFSYWGKELRHKLSKKD 615

>KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {ON}
           Anc_4.30 YLL028W
          Length = 589

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 104/472 (22%), Positives = 181/472 (38%), Gaps = 77/472 (16%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NW + R+ I    +  +C      +++ ASG  ++ AE  +   Q+  ++G  +  LG
Sbjct: 140 PFNWSLARKIIPCFILCLNCICITLGSAIYASGVLQICAEFHI--IQVVAILGITLYVLG 197

Query: 166 VGS---IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVE 222
             +   IFA P + ++G++ V +V    F I +   A +     LLI R  +GF  +   
Sbjct: 198 FAASPVIFA-PLSEVYGRKGVLVVSAFGFTIFNFAVATAKDLQTLLICRFFAGFIGAAPL 256

Query: 223 SLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGS 282
           ++  A  A+I+  + R   + +++              S + +H +  WL +++  ++  
Sbjct: 257 AVVPAAFADIFDTNVRGKAICLFSLGVFVGPILGPVIGSYIVQHTTWRWLEYVVGCLSAV 316

Query: 283 NFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHV 342
            FVL   F  E            S H T +A + + L                       
Sbjct: 317 VFVLVTFFYQE------------SHHPTILAYKAKQLRR-------------------QT 345

Query: 343 NDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRP- 401
           N+ G+         AQE+         IK I EK M                     RP 
Sbjct: 346 NNWGI-------HAAQES-----VELSIKDICEKTMT--------------------RPI 373

Query: 402 FVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL-G 460
           ++LF+ P +L      ++    L ++ +     + + YGF +    L YIA  IG  + G
Sbjct: 374 YMLFTEPILLIVTIYNSFVYGLLYLLLEAYPIVFVEGYGFITNG-ELPYIALIIGMLVCG 432

Query: 461 SLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWII 518
           + I     D   R       G   PE RL  ++   +   IG+L F W+     + HW  
Sbjct: 433 AFIWYMDDDYLRRY---RKKGGLVPEARLIPMIVGGIVFPIGILWFCWTGNYPNRIHWSC 489

Query: 519 PSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFF 570
           P+I    +GFG        + Y ++SY      A+     +++  G A   F
Sbjct: 490 PTIAGSFIGFGLMGIFLPCLNYIIESYLYIPASAVAANTFMRSAFGAAFPLF 541

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 119/561 (21%), Positives = 214/561 (38%), Gaps = 97/561 (17%)

Query: 73  DMKGQE--SGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRR-------DIALVCVGW 123
           + KG+E  S G++D        I      +   ++P NWP W R        I ++CV +
Sbjct: 135 NEKGKEGDSSGANDEAPDLDPEIEFVTFVTGDPENPHNWPGWIRWSYTVLLSILVICVAY 194

Query: 124 HCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLV 183
                   ++ ++ G   +  +  V L         M++   +G +  SP + L+G+R+ 
Sbjct: 195 G-------SACISGGLGTVEKKFHVGLEAAILSCSLMVIGFSLGPLIWSPVSDLYGRRVA 247

Query: 184 YLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLG 243
           Y V + +++I +I CA + +   LL  R + G   S+   L   +IA+++ +  R   + 
Sbjct: 248 YFVSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIA 307

Query: 244 IYTXXXXXXXXXXXXXXSLVFEHLST---HWLFWILTIIAGSNFVLHLLFVPETFWDRTP 300
            +                 +   +ST     +FW+    AG  +++    +PET+    P
Sbjct: 308 FFAFAPYVGPVVGPLVNGFI--SVSTGRMDLIFWVNMAFAGVMWIIASA-IPETY---AP 361

Query: 301 VPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEA 360
           V  KR                       ++ RL          + G P  +T+    QEA
Sbjct: 362 VILKR-----------------------KAARLR--------KETGNPKIMTE----QEA 386

Query: 361 ETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYA 420
           +           IS  +M  G  +     ++    +V    +V   Y   L  A+ +A+ 
Sbjct: 387 Q----------GISMGEMMRGCLLRPLYFSVTEPVLVATCFYVCLIYS--LLYAFFFAFP 434

Query: 421 VVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNH 480
           V+            + ++YG+    VGL++I P + G L +L      +   + L     
Sbjct: 435 VI------------FGELYGYKDNLVGLMFI-PIVIGALWALATTFYCE--NKYLQIVKQ 479

Query: 481 GIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITY 540
               PE RL          AI L   G +  +   W+ P+      GFG  +   +   Y
Sbjct: 480 RKPTPEDRLLGAKIGAPFAAIALWILGATAYKHIIWVGPASAGLAFGFGMVLIYYSLNNY 539

Query: 541 AVDSYKEFSQEALVTLNMVKNILGFAVSFFNV----KFCLHEG-YKNAFTCYALIEIFIG 595
            +D Y +++  AL T   +++  G A   F +    K  LH G +  AF   A+I +   
Sbjct: 540 IIDCYVQYASSALATKVFLRSAGGAAFPLFTIQMYHKLNLHWGSWLLAFISTAMIAL--- 596

Query: 596 LWAIPLYRWGKLCRSWTNRKN 616
                   WGK  R   ++K+
Sbjct: 597 --PFAFSYWGKGLRHKLSKKD 615

>Ecym_6229 Chr6 complement(427712..429415) [1704 bp, 567 aa] {ON}
           similar to Ashbya gossypii AER339C
          Length = 567

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 113/574 (19%), Positives = 208/574 (36%), Gaps = 123/574 (21%)

Query: 80  GGSDDHLKKTKKGIILNPQPSEC-----KKDPLNWPIWRRDIALVCVGWHCFVGGGQTSM 134
           GG + H K+ ++G +++P+  +      + +P NWP+W++    +   + C V    +S+
Sbjct: 22  GGDNTHKKEGEEGDLIDPKDLDWDDRYDEDNPHNWPVWKKWYTTLVAAFLCLVVSMGSSL 81

Query: 135 LASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIG 194
             S   +L   L+  + Q   L G     LG+  +  +P + ++G++ +YL+ +   M+ 
Sbjct: 82  YVSAVPELV--LKYNIDQTLALAGLTFYLLGLAMVVGAPLSEVYGRKPIYLLSLPPSMLF 139

Query: 195 SIGCACS-TSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXX 253
           ++G   S      +L  R +SG   S   S+ S TI +I+   + +  +  +        
Sbjct: 140 ALGVGFSGQRMGIILPLRFLSGVFASPALSVASGTIVDIFDVDQVSVAMASFCMAPFLGP 199

Query: 254 XXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIA 313
                      E     W  WI  +IAG+     + F+PE+        ++  +   R A
Sbjct: 200 VISPIMAGFAAEKKGWKWGVWI-HLIAGAVLFPFVCFMPES--------HRMVILRKRAA 250

Query: 314 RQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSI 373
           +  RGLS                                                 IK +
Sbjct: 251 K--RGLS-------------------------------------------------IKKM 259

Query: 374 SEKQMAIGLGIYHGRHTIDNWCMVMLRPF-VLFSYPAILFGAWLYAYAVVSLIIISQVID 432
           S ++M         R     + + + RP  +LF  P +L  +   A+    L    +   
Sbjct: 260 SREEMH--------RFIKMTFTVTVFRPIKMLFVEPIVLVFSVYVAFVFAVLFAFFEAYP 311

Query: 433 HAYKDIYGFSSASVGLVYIAPFIGGCLGSL------------------------------ 462
             ++ +Y FS    GL ++   +G  +G++                              
Sbjct: 312 IIFRQVYHFSMGESGLTFLGISVGLWIGTIFYIWYDRKYYYPAAPEGTPPLANPDSKRDA 371

Query: 463 -IAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSI 521
            + GR    + +LL      I   EF L   + ++   A  L   GWS +   HW++P +
Sbjct: 372 PLRGRRDPTSGKLL-----NIAPEEFLLVTKVGSIALPA-ALFWMGWSAKESVHWMVPLL 425

Query: 522 FFGVLGFGSSMCSTTAITYAVDSYKEF-SQEALVTLNMVKNILGFAVSFFNVKFCLHEGY 580
                GFG  +   + + Y   SY       A    NM++ I       F V+   + G 
Sbjct: 426 AGVPFGFGLILIFFSVLMYFTTSYPVLVVSSAFAANNMLRYITSCVFPLFTVQMYNNLGI 485

Query: 581 KNAFTCYALIEIFIGLWAIPL----YRWGKLCRS 610
             A + +     FI L  +P+     R+GK  R 
Sbjct: 486 DWASSLFG----FISLAMVPVPWIFERYGKAMRK 515

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 116/546 (21%), Positives = 208/546 (38%), Gaps = 104/546 (19%)

Query: 104 KDPLNWPIWRR-------DIALVCVGW--HCFVGG----GQTSMLASGFSKLSAELQVPL 150
           ++P NWP+W R        + ++CV +   C  GG     +   + S  S LS  L    
Sbjct: 231 ENPHNWPLWLRWVYTITLSMLVICVAYGSSCITGGLFTVQEKFHVGSVVSILSCSL---- 286

Query: 151 SQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS 210
                    M+L    G +  SP + ++G+RL Y V + +++I +I CA   +   L+I 
Sbjct: 287 ---------MVLGFSFGPLIWSPMSDIYGRRLTYFVSMGLYVIFNIPCAIPNNIATLMIC 337

Query: 211 RVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTH 270
           R   G   S+   L   ++A+++ +  R   +  +                 +   +ST 
Sbjct: 338 RFFCGVWSSSGLCLVGGSLADMFPSETRGRAIAFFAYAPYCGPVFGPLVNGFI--SISTR 395

Query: 271 ---WLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIAT 327
               +FW+    AG+ +++  L +PETF    PV  K+                      
Sbjct: 396 RMDLIFWVNMAFAGAMWIIVAL-IPETF---APVILKK---------------------- 429

Query: 328 VRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHG 387
            R+ +L          + G P  +T+    QEA+ G +  A +K    + +   +     
Sbjct: 430 -RAAKLR--------KETGNPKIMTE----QEAQ-GIEFSAMMKDCVIRPLYFAV----T 471

Query: 388 RHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVG 447
              +D  C      +V   Y   L  A+ +A+ V+            + ++Y +    VG
Sbjct: 472 EPVLDLTCF-----YVCLIYS--LLYAFFFAFPVI------------FGELYDYKDNLVG 512

Query: 448 LVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFG 507
           L+ I   IG  L         +V   ++         PE RL   +      A  L   G
Sbjct: 513 LMLIPILIGASLALATTFYCENVYLAIIRKRKP---TPEDRLLGAMIGAPFAAAALWILG 569

Query: 508 WSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAV 567
            +  +   W+ P+      G+G  +   +   Y +D Y +++  AL T   +++  G A 
Sbjct: 570 ATSYKHIIWVGPASSGLAFGYGMVLIYYSLNNYIIDCYAQYASSALATKVFLRSAGGAAF 629

Query: 568 SFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNRKNLLQ--FSYRVN 625
             F  +     G + A    A I   + L+    Y +GK    W  RKNL +  +S+   
Sbjct: 630 PLFTPQMYHRLGLQWASWLLAFISTAMILFPFSFYVYGK---GW--RKNLSKTDYSFDAL 684

Query: 626 DDGKDE 631
           ++ +DE
Sbjct: 685 EEAEDE 690

>KLLA0F18106g Chr6 (1657556..1659325) [1770 bp, 589 aa] {ON} similar
           to uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton-motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 589

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 113/530 (21%), Positives = 207/530 (39%), Gaps = 94/530 (17%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NWP+ ++ +  + +G  C      +S+ AS  + +S   +V  + +  ++G  +  LG
Sbjct: 138 PFNWPLKKKLVICIMLGLDCIAITMGSSIFASAVTTISEIYEV--ANVVSILGITLYVLG 195

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF-GLSTVE 222
             +  +  +P + L+G++ V L+    F +     A + +   +LI R   GF G + + 
Sbjct: 196 FAASPVIYAPLSELYGRQGVLLIASFGFALFQFAVATAENLQTILICRFFGGFIGAAPLA 255

Query: 223 SLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGS 282
            +P A+ ++++   +R   + ++               S + ++ S  W  ++  I A  
Sbjct: 256 VVP-ASFSDMFDNTQRGTAVTMFALGVFVGPILAPVFGSYIVQYTSWRWTEYVTGIFASV 314

Query: 283 NFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHV 342
            FVL   F  ET             H T +  + +          +R    N    A H 
Sbjct: 315 IFVLLCYFFEETH------------HPTILVNKAK---------MMRKKTGNWGIHAAH- 352

Query: 343 NDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRP- 401
                          +E E        IK + +K +                     RP 
Sbjct: 353 ---------------EEVELS------IKDVCQKTIT--------------------RPI 371

Query: 402 FVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGS 461
           ++LF+ P I       ++    L ++ +     +   Y F  A+  L YIA  IG    +
Sbjct: 372 YMLFTEPIIFLITVYNSFVYGILYLLLEAYPIVFVKGYHF-YANGELPYIALIIGMFFAA 430

Query: 462 LI-AGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWII 518
           ++      D   R++A  N G   PE RLF ++   +   IG+L F W+     + HWI+
Sbjct: 431 VVNIYMEKDYVRRVIA--NSGKPVPEARLFPMMVGSIIFPIGILWFCWTGNYPNKVHWIV 488

Query: 519 PSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHE 578
           P+I    +G+G          Y +DSY   +  A+     ++       S F   F L  
Sbjct: 489 PTIGGSFIGYGLMAIFLPCFNYLIDSYLFLAASAIAGNTFMR-------SSFGAAFPLFA 541

Query: 579 G--YKNAFTCYALIEIFIGLWA---IPL----YRWGKLCRSWTNRKNLLQ 619
           G  ++N  T +A   + +GL+A   IP+    Y++G+  R  +     LQ
Sbjct: 542 GFMFENMGTNWA--GLLLGLFAACLIPVPFLFYKYGRRLRQKSKYAYDLQ 589

>KAFR0K00150 Chr11 complement(37495..39087) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 109/545 (20%), Positives = 198/545 (36%), Gaps = 81/545 (14%)

Query: 78  ESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLAS 137
           ES G  +  K     ++++    +   +P NW   ++++ +  +     +    +S+   
Sbjct: 49  ESKGGKESQKGDVDPLLIDWNGEDDPDNPQNWTSSKKNLIIFEIMMLTCINYMGSSIYTP 108

Query: 138 GFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVL--FGKRLVYLVGILIFMIGS 195
           G   +  +  V     +  +   +L  G+G IF SP + +   G++ +Y++   IFM+  
Sbjct: 109 GQGGIQDDFHVGHVTATLNLSLYVLGYGLGQIFFSPLSEVAKIGRQQIYIITFFIFMLLQ 168

Query: 196 IGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXX 255
           IGCA   +   L+I R ++G   S   S   ATIA+I      A  + ++          
Sbjct: 169 IGCATVQNIAGLVILRFITGILCSPSLSTGGATIADIIHPDNLAIYIALWAIGAVAAPIV 228

Query: 256 XXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQ 315
                + +    +  W FW+L  +A    ++ +   PET                     
Sbjct: 229 GPLLGASMVVAKNWRWCFWLLLWLAIPCLMICVFLFPET--------------------- 267

Query: 316 VRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISE 375
                   ++ + R++R+  RE  G                  +    +K       +S 
Sbjct: 268 -----SAANVLSRRASRI--REQTG------------------DNRYYTKQEKLDAGVSS 302

Query: 376 KQMAIGLGIYHGRHTIDNWCMVMLRPFVLF--SYPAILFGAWLYAYAVVSLIIISQVIDH 433
           KQ  I   +Y     I         P VL   +Y A+ +G +   +    ++ +      
Sbjct: 303 KQFLIN-TLYRPIEIIAE------EPIVLAFDAYIAVCYGTFYLFFEAFPIVFV------ 349

Query: 434 AYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVL 493
              D +GFS   +GL Y    +G C+   +      +N  +  +   G + PE  L + +
Sbjct: 350 ---DNWGFSLIELGLSYFGFCVGCCIAFPVLVIF--INKVVKPSRKDGTFVPETFLILAM 404

Query: 494 PAVLCNAIGLLGFGWSLERQDHWIIP---SIFFGVLGFGSSMCSTTAITYAVDSYKEFSQ 550
               C    L  FGW+     HWI+P    IFF +  F        A +Y    Y ++  
Sbjct: 405 FVSWCLPCSLFLFGWA--AMTHWIVPIIAEIFFVICVFN---LFQAAFSYLAICYPKYVA 459

Query: 551 EALVTLNMVKNILGFAVSFFNVKFCLH---EGYKNAFTCYALIEIFIGLWAIP--LYRWG 605
                    ++ L  A   F      +   +GY   +    +    IGL  IP  LY++G
Sbjct: 460 SVYAGNGFCRSALACAFPLFGKAMYNNLAIDGYPVGWGSSIIGFTSIGLAIIPFALYKYG 519

Query: 606 KLCRS 610
              RS
Sbjct: 520 AYLRS 524

>Suva_8.420 Chr8 (755472..757112) [1641 bp, 546 aa] {ON} YBR008C
           (REAL)
          Length = 546

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 97/518 (18%), Positives = 199/518 (38%), Gaps = 79/518 (15%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
           ++P NWP+ ++ + +  +     V    +S+   G   + +E  V     +  +   +L 
Sbjct: 91  ENPQNWPLLKKSVVVAQIMVLTCVTYMGSSIYTPGQEAIQSEFNVGHVVATLNLSMYVLG 150

Query: 164 LGVGSIFASPTAVL--FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTV 221
            G+G I  SP + +  +G+  +Y++ +  F I  IGCA   +   L++ R +SG   S  
Sbjct: 151 YGLGPIIFSPLSEIARYGRLYIYMITLFFFTIFQIGCATVHNIGGLIVMRFISGILCSPS 210

Query: 222 ESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAG 281
            +    T+A+I         LG+++              + + +  +  ++FW+L  ++ 
Sbjct: 211 LATGGGTVADIISPEIVPLVLGMWSAGAVAAPVLAPLLGAAMIDAKNWRYIFWLLMWLSA 270

Query: 282 SNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGH 341
           +  ++ + F PET                          ++ +I   R+ +L  R+  G 
Sbjct: 271 ATLIVLVFFFPET--------------------------QHYNILHRRALKL--RKETGD 302

Query: 342 VNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRP 401
                +   L  + +A+     +  R   K I+++   +   +Y                
Sbjct: 303 DRYYTLQDRLDRQVDAKTFMINTLYRP-FKMIAKEPALLAFDLYI--------------- 346

Query: 402 FVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGS 461
                  A+ +G +   +    ++ I          IY F+   VG+ Y+  F  GC+ +
Sbjct: 347 -------AVAYGCFYLFFEAFPIVFIG---------IYNFTLVEVGVAYMG-FCVGCVFA 389

Query: 462 LIAGRGSDVNTRLLAAH-NHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP- 519
            I    + ++ R++     +G + PE  L + +    C  + L  FGW+   + HWI+P 
Sbjct: 390 YI--LFAILSMRIIVPRFKNGTFTPEAFLIVAMSVCWCLPLSLFLFGWT--AKVHWILPI 445

Query: 520 --SIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLH 577
              +FF +  F     +     Y    Y ++        +  + +   A   F       
Sbjct: 446 ISEVFFVIAVFNIFQAT---FAYLATCYPKYVASVFAGNSFCRAVFACAFPLFGKAMYDK 502

Query: 578 EGYKNAFTCY--ALIEIF-IGLWAIP--LYRWGKLCRS 610
              KN    +  +L+  F + L AIP  LY++G   R+
Sbjct: 503 LATKNYPVAWGSSLVGFFTLALAAIPFVLYKYGPALRA 540

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 111/529 (20%), Positives = 194/529 (36%), Gaps = 97/529 (18%)

Query: 104 KDPLNWPIWRR-------DIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYL 156
           ++P NWP W R        I ++CV +        ++ ++ G   +  +  V +      
Sbjct: 158 ENPHNWPGWIRWTYTVLLSILVICVAYG-------SACISGGLGTVEKKFHVGMEAAILS 210

Query: 157 VGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF 216
              M++   +G +  SP + L+G+R+ Y V + +++I +I CA + +   LL  R + G 
Sbjct: 211 CSLMVIGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRFLCGV 270

Query: 217 GLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST---HWLF 273
             S+   L   +IA+++ +  R   +  +                  F  +ST     +F
Sbjct: 271 WSSSGLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVNG--FISVSTGRMDLIF 328

Query: 274 WILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRL 333
           W+    AG  +++  L +PET+    PV  KR        + VR          +R    
Sbjct: 329 WVNMAFAGVMWIVSSL-IPETY---APVILKR--------KAVR----------LRKETG 366

Query: 334 NPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDN 393
           NP+              +  E  AQ        RA                         
Sbjct: 367 NPK--------------IMTEQEAQGVSMSEMMRA------------------------- 387

Query: 394 WCMVMLRPFVLFSYPAILFGAWLYAYAVVSLI-IISQVIDHAYKDIYGFSSASVGLVYIA 452
               +LRP        +L     Y   + SL+          + ++YG+    VGL++I 
Sbjct: 388 ---CLLRPLYFAVTEPVLVATCFYVCLIYSLLYAFFFAFPVIFGELYGYKDNIVGLMFI- 443

Query: 453 PFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLER 512
           P + G L +L      +   + LA        PE RL          AI L   G +  +
Sbjct: 444 PIVIGALWALATTFYCE--NKYLAIVKQRKPTPEDRLLGAKIGAPFAAIALWILGATSYK 501

Query: 513 QDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNV 572
              W+ P+      G+G  +   +   Y +D Y +++  AL T   +++  G A   F +
Sbjct: 502 HIIWVGPASAGLAFGYGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSCGGAAFPLFTI 561

Query: 573 ----KFCLHEG-YKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNRKN 616
               K  LH G +  AF   A+I +           WGK  R   ++K+
Sbjct: 562 QMYHKLNLHWGSWLLAFISTAMIAL-----PFAFSYWGKELRHKLSKKD 605

>TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 110/518 (21%), Positives = 203/518 (39%), Gaps = 91/518 (17%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NW   R+ +  + +   C      +S+ A G ++L  +  V   Q+  ++G  +  LG
Sbjct: 184 PFNWSKKRKFLTCLILCIDCITISWGSSIYAPGVTQLCEQYHV--IQVVAILGITLYVLG 241

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  I  +P + L+G++ V +V  L F +     A + +F  ++I R  +GF  +   +
Sbjct: 242 FAASPIIYAPLSELYGRKGVLVVSGLGFALFQFAVATAENFQTIMICRFFAGFIGAAPMA 301

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A  A+++    R   + ++T              S + +H +  WL +++   A + 
Sbjct: 302 IVPAVFADMFDTDFRGKAICLFTLGVFVGPILGPVMGSYIVQHTTWRWLNYVVGFQACAV 361

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           FV  +LFV ET             H T +  + + L +      +R+    P E      
Sbjct: 362 FVAIVLFVEETH------------HPTILVNKAKLLRKKTGNWGIRA----PHED----- 400

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
                    + S A+  ET + ++  I   +E  + I + IY+                 
Sbjct: 401 --------FELSMAEICET-TISKPLIMLFTEPVLLI-ITIYNS---------------- 434

Query: 404 LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIY--GFSSASVG-LVYIAPFIGGCLG 460
                        + Y ++ L++       AY  I+  G+   + G L Y+A  +G  + 
Sbjct: 435 -------------FVYGILYLLL------EAYPIIFVEGYGMKTNGFLPYLALIVGIMIC 475

Query: 461 SLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWII 518
           S++        T+       G   PE RL+ ++ A +   IG+L F W+     + HWI 
Sbjct: 476 SVMIWHADGFYTK--KVKKEGKLIPEDRLYPMIVAGIIFPIGILWFCWTGAYPEKIHWIC 533

Query: 519 PSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHE 578
           P+I    +GFG        + Y ++SY   +  A+     ++       S F   F L  
Sbjct: 534 PTIAGSFIGFGLMGIFLPCLNYIIESYLLLTASAVAANTFMR-------SAFGAVFPLFA 586

Query: 579 GYKNAFTCYALIEIFIGLWA---IPL----YRWGKLCR 609
           GY           + IGL+A   IP+     ++GK  R
Sbjct: 587 GYMFKGMGIGWAGLLIGLFAAAMIPVPFLFLKYGKTIR 624

>ZYRO0A13618g Chr1 (1083024..1084613) [1590 bp, 529 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 529

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 102/475 (21%), Positives = 186/475 (39%), Gaps = 82/475 (17%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
           + P NW   +R + +  V     V    TS    G   +  E  V      ++VG + LS
Sbjct: 74  EHPHNWSTIKRFVVVFNVMVLTCVTYMGTSFYTPGQDLIEKEFHV-----GHVVGTLNLS 128

Query: 164 L-----GVGSIFASPTA--VLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF 216
           L     G+G +   P +  V FG++ +++V + +F +  IGCA   +   L+I R +SG 
Sbjct: 129 LYILGFGLGPLVFGPLSEFVAFGRQRLFIVTLFLFAMLQIGCALVKNIAGLVILRFLSGI 188

Query: 217 GLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWIL 276
             S   +  +A + ++         LG++               + +    +  ++FW+L
Sbjct: 189 FCSPSLANGAAAVGDVVRPRHIPVVLGLWAIGALAGPSTGPLLGASMVVAKNWRYMFWLL 248

Query: 277 TIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPR 336
             I+ +  +L +   PET        N+ S+   R  R +R L+ +    TV+S     R
Sbjct: 249 MWISSATLLLMVFSYPET--------NEDSILYRRCQR-IRKLTGDNRYYTVKS-----R 294

Query: 337 ESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCM 396
           E       D   +G+T      E             I ++ + I L +YH          
Sbjct: 295 EEEKLNWKD---IGITTLYRPFEM------------IIKEPIVIALNVYH---------- 329

Query: 397 VMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIG 456
                       A+ +G +   +    ++         + D+Y F+   +G+ Y    +G
Sbjct: 330 ------------AVEYGVFYLFFEAFPIV---------FGDVYHFTRVELGVSY----MG 364

Query: 457 GCLGSLIAGRGSDVNTRLLAAH--NHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQD 514
            C+G + A   + V +   AA   ++  + PE  L +++       + L  FGW+     
Sbjct: 365 FCVGCITAYGVAMVFSCWYAAKKMSNNTFTPETHLVLMIWVCWTLPLSLFLFGWA--ASV 422

Query: 515 HWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSF 569
           HWIIP I   +   G      +  +Y   SY ++   A    N+ ++  GFA +F
Sbjct: 423 HWIIPMISEVIFIIGQFNIFQSVFSYMAISYPKYMASAFAGNNLCRS--GFACAF 475

>YBR008C Chr2 complement(252563..254209) [1647 bp, 548 aa] {ON}
           FLR1Plasma membrane multidrug transporter of the major
           facilitator superfamily, involved in efflux of
           fluconazole, diazaborine, benomyl, methotrexate, and
           other drugs; expression induced in cells treated with
           the mycotoxin patulin
          Length = 548

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 88/429 (20%), Positives = 165/429 (38%), Gaps = 75/429 (17%)

Query: 99  PSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVG 158
           PS+  ++P NWP+ ++ + +  +     V    +S+   G   +  E  V     +  + 
Sbjct: 88  PSD-PENPQNWPLLKKSLVVFQIMLLTCVTYMGSSIYTPGQEYIQEEFHVGHVVATLNLS 146

Query: 159 PMMLSLGVGSIFASPTA--VLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF 216
             +L  G+G I  SP +    +G+  +Y+V +  FMI  +GCA   +   L++ R +SG 
Sbjct: 147 LYVLGYGLGPIIFSPLSETARYGRLNLYMVTLFFFMIFQVGCATVHNIGGLIVMRFISGI 206

Query: 217 GLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWIL 276
             S   +    T+A+I         LG+++              + + +  +  ++FW+L
Sbjct: 207 LCSPSLATGGGTVADIISPEMVPLVLGMWSAGAVAAPVLAPLLGAAMVDAKNWRFIFWLL 266

Query: 277 TIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPR 336
             ++ + F+L   F PET             H   + R+   L +               
Sbjct: 267 MWLSAATFILLAFFFPET------------QHHNILYRRALKLRKETG------------ 302

Query: 337 ESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCM 396
           +   +   D     L  E +A+     +  R     I E  +             D +  
Sbjct: 303 DDRYYTEQD----KLDREVDARTFLINTLYRPLKMIIKEPAIL----------AFDLYIA 348

Query: 397 VMLRPFVLF--SYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPF 454
           V    F LF  ++P +  G  +Y +++V +                      GL Y    
Sbjct: 349 VAYGCFYLFFEAFPIVFVG--IYHFSLVEV----------------------GLAY---- 380

Query: 455 IGGCLGSLIA-GRGSDVNTRLLAAH-NHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLER 512
           +G C+G ++A G    +N R++     +G + PE  L + +    C  + L  FGW+   
Sbjct: 381 MGFCVGCVLAYGLFGILNMRIIVPRFRNGTFTPEAFLIVAMCVCWCLPLSLFLFGWT--A 438

Query: 513 QDHWIIPSI 521
           + HWI+P I
Sbjct: 439 RVHWILPVI 447

>ZYRO0B16808g Chr2 (1368857..1370446) [1590 bp, 529 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 529

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 114/514 (22%), Positives = 205/514 (39%), Gaps = 97/514 (18%)

Query: 78  ESGGSDDHLKKT------KKGIILNPQPSECK-----KDPLNWPIWRRDIALVCVGWHCF 126
           E+G S+   K++      +KG   +P   E +     + P NW   +R + +  V     
Sbjct: 37  ETGDSERDSKESALVDEVEKGKYSDPFLVEFRGATDPEHPHNWSTIKRFVVVFNVMVLTC 96

Query: 127 VGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL-----GVGSIFASPTA--VLFG 179
           V    TS    G   +  E  V      ++VG + LSL     G+G +   P +  V FG
Sbjct: 97  VTYMGTSFYTPGQDLIEKEFHV-----GHVVGTLNLSLYILGFGLGPLIFGPLSEFVAFG 151

Query: 180 KRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERA 239
           ++ +++V + +F +  IGCA   +   L+I R ++G   S   +  +A + ++       
Sbjct: 152 RQRLFIVTLFLFAMLQIGCALVRNIAGLVILRFLAGIFCSPSLANGAAAVGDVVRPRHVP 211

Query: 240 YRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRT 299
             LG++               S +    +  ++FW+L  I+ +  VL +   PET     
Sbjct: 212 VVLGLWAIGALVGPSTGPLLGSSMVVAKNWRFMFWLLMWISSATLVLMVFTYPET----- 266

Query: 300 PVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQE 359
              N+ S+   R  R +R L+ +    TV+S     RE               ++ N ++
Sbjct: 267 ---NEDSILYRRCQR-IRRLTGDNRYYTVKS-----REE--------------EKLNWKD 303

Query: 360 AETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLF--SYPAILFGAWLY 417
               +  R   + I ++ + I L +YH          V    F LF  ++P I+FG    
Sbjct: 304 ICITTLYRP-FEMIIKEPIVIALNVYHA---------VEYGVFYLFFEAFP-IVFG---- 348

Query: 418 AYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAA 477
                              D+Y F+   +G+ Y    +G C+G + A   + V +   AA
Sbjct: 349 -------------------DVYHFTRVELGVSY----MGFCVGCITAYGVAMVFSCWYAA 385

Query: 478 H--NHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCST 535
              ++  + PE  L +++       + L  FGW+     HWI+P I   +   G      
Sbjct: 386 KKMSNNTFTPETHLVLMIWVCWTLPLSLFLFGWA--ASVHWILPMISEVIFIIGQFNIFQ 443

Query: 536 TAITYAVDSYKEFSQEALVTLNMVKNILGFAVSF 569
           +  +Y   SY ++   A    N+ ++  GFA +F
Sbjct: 444 SVFSYMAISYPKYMASAFAGNNLCRS--GFACAF 475

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 113/528 (21%), Positives = 201/528 (38%), Gaps = 95/528 (17%)

Query: 104 KDPLNWPIWRR-------DIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYL 156
           ++P NWP W R        I ++CV +        ++ ++ G   +  +  V L      
Sbjct: 159 ENPHNWPAWIRWSYTVLLSILVICVAYG-------SACISGGLGTVEKKFHVGLEAAILS 211

Query: 157 VGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF 216
              M++   +G +  SP + L+G+R+ Y V + +++I +I CA + +   LL  R + G 
Sbjct: 212 CSLMVIGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRFLCGV 271

Query: 217 GLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST---HWLF 273
             S+   L   +IA+++ +  R   +  +                  F  +ST     +F
Sbjct: 272 WSSSGLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVNG--FISVSTGRMDLIF 329

Query: 274 WILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRL 333
           W+    AG  +++    +PET+    PV  KR                       ++ RL
Sbjct: 330 WVNMAFAGVMWMVASA-IPETY---APVILKR-----------------------KAARL 362

Query: 334 NPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDN 393
                     + G P  +T+    QEA+           IS  +M  G  +      +  
Sbjct: 363 R--------KETGNPKIMTE----QEAQ----------GISMSEMMRGCLLRPLYFAVTE 400

Query: 394 WCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAP 453
             +V    +V   Y   L  A+ +A+ V+            + ++YG+    VGL++I P
Sbjct: 401 PVLVATCFYVCLIYS--LLYAFFFAFPVI------------FGELYGYKDNLVGLMFI-P 445

Query: 454 FIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQ 513
            + G L +L      +   + L         PE RL          AI L   G +  + 
Sbjct: 446 IVIGALWALATTFYCE--NKYLQIVKQRKPTPEDRLLGAKIGAPFAAIALWILGATAYKH 503

Query: 514 DHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNV- 572
             W+ P+      GFG  +   +   Y +D Y +++  AL T   +++  G A   F + 
Sbjct: 504 IIWVGPASAGLAFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTIQ 563

Query: 573 ---KFCLHEG-YKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNRKN 616
              K  LH G +  AF   A+I +           WGK  R   ++K+
Sbjct: 564 MYHKLNLHWGSWLLAFISTAMIAL-----PFAFSYWGKGLRHKLSKKD 606

>Skud_15.531 Chr15 (957329..958948) [1620 bp, 539 aa] {ON} YBR008C
           (REAL)
          Length = 539

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 113/554 (20%), Positives = 207/554 (37%), Gaps = 88/554 (15%)

Query: 73  DMKGQESGGSDDH--LKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGG 130
           DM+        +H  +KK    ++    PS+   +P NW + ++ + +  +    FV   
Sbjct: 52  DMEACPESYVSEHSQIKKNDPFLVNWNGPSD-PGNPHNWSLQKKSLVVFQIMLLTFVTYM 110

Query: 131 QTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVL--FGKRLVYLVGI 188
            +S+   G   +  E  V     +  +   +L  G+G I  SP + +  +G+  +Y++ +
Sbjct: 111 GSSIYTPGQEYIQEEFHVGHVVTTLNLSLYVLGYGLGPIIFSPLSEIARYGRLNLYMITL 170

Query: 189 LIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXX 248
            +FMI  +GCA   S   L + R +SG   S   +    T+ +I         LGI++  
Sbjct: 171 SLFMIFQVGCATVHSIGGLTVMRFISGILCSPSLATGGGTVTDIISPEMVPLVLGIWSAG 230

Query: 249 XXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLH 308
                       + + +  +  ++FW+L  ++ + F+L   F PET              
Sbjct: 231 VFSAPVFAPLLGAAMVDAKNWRFIFWLLMWLSAATFILLAFFFPET-------------- 276

Query: 309 ETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRA 368
                       ++ +I   R+ +L  R+  G          L  + +A+     +  R 
Sbjct: 277 ------------QHHNILYRRALKL--RKETGDERYYTEQHRLDRQIDAKTFLVNTLYRP 322

Query: 369 HIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLF--SYPAILFGAWLYAYAVVSLII 426
               I E  +             D +  V+   F LF  ++P +  G  +Y + +V +  
Sbjct: 323 FKMIIKEPALL----------AFDLYISVVYGCFYLFFEAFPIVFVG--IYQFTLVEM-- 368

Query: 427 ISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIA-GRGSDVNTRLLAAH-NHGIYE 484
                               GL Y    +G C+G  +A G    +N +++     +G   
Sbjct: 369 --------------------GLAY----MGFCVGCFLAYGLFGVLNKKIIVPRFRNGTLT 404

Query: 485 PEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP---SIFFGVLGFGSSMCSTTAITYA 541
           PE  L M +       + L  FGW+   Q HWI+P    IFF +  F     +     Y 
Sbjct: 405 PEVFLIMAMCVSWSLPLSLFLFGWT--AQVHWILPIISEIFFVIAAFNIFQAT---FAYL 459

Query: 542 VDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCY--ALIEIF-IGLWA 598
              Y +         +  +++   A   F      +   KN    +  +L+  F + L A
Sbjct: 460 ATCYPKHVASVFAGNSFCRSLFACAFPLFGRGMYNNLAIKNYPVAWGSSLVGFFTLILAA 519

Query: 599 IP--LYRWGKLCRS 610
           IP  LY+WG   R+
Sbjct: 520 IPFVLYKWGPSLRA 533

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 112/501 (22%), Positives = 190/501 (37%), Gaps = 92/501 (18%)

Query: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC 200
           +L  E  +   +++  V   +L  G+   F+   A ++G+R V ++G++I++  S+G AC
Sbjct: 89  QLEKEFNIDEDKVNVTVVVYLLFQGIAPTFSGGLADIYGRRPVIVIGMIIYVAVSVGLAC 148

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
           S S+  L+  R++    +S   ++ S  + +     ER    G +               
Sbjct: 149 SNSYGVLVFLRILQSACISPTIAISSGFVGDFTLKFER----GTFVGATSGFALLGQAFG 204

Query: 261 SLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQV 316
           SL+   L+  W    +FW L  + G    + ++F                L ET+     
Sbjct: 205 SLIGAALAAAWDWRAIFWFL--VIGCGVCMLIIFT--------------LLPETK----- 243

Query: 317 RGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEK 376
           R L  N+S+         P+           P+ L      +             ++ + 
Sbjct: 244 RTLVGNLSV--------KPKNILNRA-----PIFLLKPVQKRFKYDNPDYDTLDPNVPKL 290

Query: 377 QMAIGLGIYHGRHTIDNWCMVMLRPFVLFS-YPAIL-FGAWLYAYAVVSLIIISQVIDHA 434
            +   L I               +P ++ S +PA L F  W         +++S +    
Sbjct: 291 DLTSALKITA-------------QPEIILSLFPAGLQFAMWT--------LMLSAISSEL 329

Query: 435 YKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLA------AHNHGI-YEPEF 487
             + Y +    +G+ Y+   IGG +GS I GR  D+  R L         N  I  E EF
Sbjct: 330 SANPYNYKLTIIGVCYLPAGIGGLVGSFITGRIIDIFYRKLTKKFEQDKENGTIPQETEF 389

Query: 488 -----RLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFG--VLGFGSSMCSTTAITY 540
                RL   +P      +  L FGWS+++   W IP++     V  F +    +T+ T 
Sbjct: 390 NVIRARLLAGVPQNFIAVVSFLLFGWSVDK--GWRIPAVLITSCVSSFCAMSTLSTSSTL 447

Query: 541 AVDSYKEFSQEALVTLNMVKNILG--FAVSFFNVKFCLHEGYKNAFTCYALIEIFIG--L 596
            VD Y   S  A    N ++  L   F   F  +K  +  G    F C     +FIG  L
Sbjct: 448 LVDLYPGKSSTATSCFNFIRCTLSAIFMGCFAKMKTSMTVGGTFTFMCGL---VFIGNFL 504

Query: 597 WAIPLYRWGKLCRSWTNRKNL 617
             IP+ R+G     W N + L
Sbjct: 505 LLIPM-RYG---MKWRNERAL 521

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 72/158 (45%), Gaps = 8/158 (5%)

Query: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC 200
           +L  E  V  + I+  V   ++  G+        A  FG+R + L G+L++++ S+G AC
Sbjct: 126 QLEKEFNVDENMINITVVVYLMFQGIAPTVCGGLADCFGRRPIILGGMLVYVVASVGLAC 185

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
           + S+  ++  R V   G+S   ++ S  + +    HER    G +               
Sbjct: 186 APSYGVIIFLRCVQSIGISPTIAISSGVVGDFTLKHER----GTFVGATSGFVLLGQCFG 241

Query: 261 SLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPET 294
           SL+   L+  W    +FW LTI  G+ F++    +PET
Sbjct: 242 SLIGAVLTARWDWRSIFWFLTIGCGTCFLIAFFILPET 279

>AER339C Chr5 complement(1259842..1261563) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR273C
           (TPO4)
          Length = 573

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 113/564 (20%), Positives = 209/564 (37%), Gaps = 110/564 (19%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NWP+W++    +     C      +S+       L  E  V  +Q     G  +  L
Sbjct: 64  NPHNWPLWKKWSTAMVSALLCLAVTMGSSLYMGAVPTLVKEYGV--NQTLACAGLSLYLL 121

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACST-SFNWLLISRVVSGFGLSTVES 223
           G+ ++  +P + +FG++ VYL+ + I ++ S+G   S      +L  R+ SG   S   S
Sbjct: 122 GLATVVGAPLSEVFGRKPVYLISLPISLLFSLGVGLSNGRMAVILPMRLFSGIFASPALS 181

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + S TI +I+   E +  + ++                   E+    W+ WI  +I+G  
Sbjct: 182 VASGTIVDIFDVDEVSVAMSLFCMAPFLGPVISPIMGGYAAENGGWRWVVWI-RLISGGV 240

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
            +  L+ +PET          + +   R AR+ RG+                        
Sbjct: 241 LMPMLIVMPET---------HKYIILARRARK-RGV------------------------ 266

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIK-SISEKQMAIGLGIYHGRHTIDNWCMVMLRPF 402
                       N +++  G +TRA IK +++E                      + RP 
Sbjct: 267 ------------NLRKSRPG-ETRAFIKRTLTE---------------------TLFRPI 292

Query: 403 -VLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGS 461
            +L   P +L  +   A+    L    +     ++ +Y F+    GL +I   +G  LG 
Sbjct: 293 KMLVVEPIVLVFSVYVAFVFSVLFAFFEAYPTIFRGVYHFTMGQTGLTFIGISVGLWLGM 352

Query: 462 LIAG--------RGSDVNTRLLAAHN-------HGIYEPEF-RLFMVLPAV--------- 496
           ++            +   T LLA           G  +PE  +L  ++P +         
Sbjct: 353 MLYVWYDRKYFFPPAPPGTPLLANPQSIRDQPMRGRRDPETGQLVPLVPEMFLTVTKFGS 412

Query: 497 LCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEF-SQEALVT 555
           L   + L   GWS     HWI+P++     GFG  +   + + Y   +Y       A   
Sbjct: 413 LALPVALFWLGWSARPSVHWIVPALAGIPFGFGMILIFFSVLMYFTTTYPVLVVSSAFAA 472

Query: 556 LNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIP--LYRWGKLCRSWTN 613
            N+++ +       F ++   + G   A + +  I   + L  +P    R+GK  R    
Sbjct: 473 NNLLRYVTSCVFPLFTIQMYENLGIGWASSVFGFIS--LALVPVPWIFERYGKAMR---- 526

Query: 614 RKNLLQFSYRVNDDGKDEKDNHTE 637
            K++  F Y      + +++N +E
Sbjct: 527 HKSV--FGYNAMATARQQEENASE 548

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 112/558 (20%), Positives = 213/558 (38%), Gaps = 76/558 (13%)

Query: 73  DMKGQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQT 132
           + + ++  G +D  ++    I      +   ++P NW  W R +  + +          +
Sbjct: 125 ENQKKKFTGDNDEEQELDTDIEFVTFVTNDPENPHNWATWLRWLYTIVLSILVISVAYGS 184

Query: 133 SMLASGFSKLSAELQVPLSQISYLVGPMM-LSLGVGSIFASPTAVLFGKRLVYLVGILIF 191
           + +  G   ++ +  V  +++S L   +M +   +G +  SP + L+G+R+ Y V + ++
Sbjct: 185 ACITGGLELVNEKYHVS-TEVSILSCSLMVIGFSLGPLIWSPVSDLYGRRVAYFVSLGLY 243

Query: 192 MIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXX 251
           +I +I CA + +   LL  R + G   S+   L   +IA+++ +  R   +  +      
Sbjct: 244 VIFNIPCALAPNIGCLLACRFLCGVWSSSGLCLVGGSIADMFPSETRGKAIAFFAYAPYC 303

Query: 252 XXXXXXXXXSLVFEHLST---HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLH 308
                      +  ++ST     +FW+     G  +++ + F+PETF    PV  KR   
Sbjct: 304 GPVFGPLVNGFI--NISTGRMDLIFWVNMAFCGFMWIV-VAFIPETF---APVILKR--- 354

Query: 309 ETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRA 368
             R AR             +R    NP+              +  E  AQ        RA
Sbjct: 355 --RAAR-------------LRKETGNPK--------------IMTEQEAQGLSVSEMMRA 385

Query: 369 HIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIIS 428
            +  +     A+          +D  C      +V   Y   L  A+ +AY V+      
Sbjct: 386 CL--LRPLYFAV------TEPVLDLMCF-----YVCLIYS--LLYAFFFAYPVI------ 424

Query: 429 QVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFR 488
                 +  +YG+    +GL++I P + G   +L      ++    L         PE R
Sbjct: 425 ------FGKLYGYKDNIIGLMFI-PILIGASAALCTTYWCELKYVALTKRRKP--TPEDR 475

Query: 489 LFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEF 548
           L   +      AI L   G +  +   W+ P+      GFG  +   +   Y +D Y  +
Sbjct: 476 LLGAMIGAPFAAIALWILGATSYKHIIWVGPASSGLAFGFGMVLIYYSLNNYIIDCYAMY 535

Query: 549 SQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLC 608
           +  AL T   +++  G A   F  +     G + A    A I   + L     Y +GK  
Sbjct: 536 ASSALATKVFLRSAGGAAFPLFTNQMYDRLGLQWASWLLAFISTAMILIPFAFYYYGKGL 595

Query: 609 RSWTNRKNLLQFSYRVND 626
           R+  ++K+   +S+  N+
Sbjct: 596 RAKLSKKD---YSFDSNE 610

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 116/531 (21%), Positives = 190/531 (35%), Gaps = 101/531 (19%)

Query: 104 KDPLNWPIWRR-------DIALVCV--GWHCFVGGGQTSMLASGFSKLSAELQVPLSQIS 154
           ++P NWP W R        I ++CV  G  C  GG  T          +A L   L  I 
Sbjct: 159 ENPHNWPSWVRWSYTVLLSILVICVAYGSACISGGLGTVEKKYHVGMEAAILSCSLMVIG 218

Query: 155 YLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVS 214
           + +GP++ S         P + L+G+R+ Y V + +++I +I CA + +   LL  R + 
Sbjct: 219 FSLGPLIWS---------PVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRFLC 269

Query: 215 GFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST---HW 271
           G   S+   L   +IA+++ +  R   +  +                  F  +ST     
Sbjct: 270 GVWSSSGLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVNG--FISVSTGRMDL 327

Query: 272 LFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRST 331
           +FW+    AG  +++    +PET+    PV  KR                    A +R  
Sbjct: 328 IFWVNMAFAGVMWIISSA-IPETY---APVILKR------------------KAARLRKE 365

Query: 332 RLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTI 391
             NP+              +  E  AQ        RA                       
Sbjct: 366 TGNPK--------------IMTEQEAQGVSMSEMMRA----------------------- 388

Query: 392 DNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLI-IISQVIDHAYKDIYGFSSASVGLVY 450
                 +LRP        +L     Y   + SL+          + ++YG+    VGL++
Sbjct: 389 -----CLLRPLYFAVTEPVLVATCFYVCLIYSLLYAFFFAFPVIFGELYGYKDNLVGLMF 443

Query: 451 IAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSL 510
           I P + G L +L      +   + L         PE RL          AI L   G + 
Sbjct: 444 I-PIVIGALWALATTFYCE--NKYLQIVKQRKPTPEDRLLGAKIGAPFAAIALWILGATA 500

Query: 511 ERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFF 570
            +   W+ P+      GFG  +   +   Y +D Y +++  AL T   +++  G A   F
Sbjct: 501 YKHIIWVGPASAGLAFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLF 560

Query: 571 NV----KFCLHEG-YKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNRKN 616
            +    K  LH G +  AF   A+I +           WGK  R   ++K+
Sbjct: 561 TIQMYHKLNLHWGSWLLAFISTAMIAL-----PFAFSYWGKGLRHKLSKKD 606

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 116/521 (22%), Positives = 206/521 (39%), Gaps = 87/521 (16%)

Query: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC 200
           +L  E  +  ++++  V   +L  G+    +   A +FG+R + L G++I+++ SIG AC
Sbjct: 127 QLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGLAC 186

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
           + S+  +   R +   G+S   ++ S  + +    HER    G +               
Sbjct: 187 APSYGVICFLRCIQSIGISPTIAISSGVVGDFTLKHER----GTFVGATSGLVLLGQCFG 242

Query: 261 SLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQV 316
           SL+   L+  W    +FW L I +G   ++    +PET   RT V N        ++ + 
Sbjct: 243 SLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPET--KRTIVGN--------LSIKP 292

Query: 317 RGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEK 376
           + +     +  ++                  PV    + +  + ET  KT      I   
Sbjct: 293 KNILNRAPVFLLK------------------PVQKRFKYDNPDYETLDKT------IPRL 328

Query: 377 QMAIGLGIYHGRHTIDNWCMVMLRPFVLFS-YPAIL-FGAWLYAYAVVSLIIISQVIDHA 434
            +A    I          C +   P +L S +PA L F  W         +++S +    
Sbjct: 329 DLASAFKI----------CAL---PEILLSLFPAGLQFALWT--------LMLSSISSTL 367

Query: 435 YKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSD-VNTRLL-----AAHNHGIYEPE-- 486
               Y +    +G+ Y+   +GG LGS++ GR  D +  + L        N  I E E  
Sbjct: 368 SAPPYNYRLTIIGVCYLPGGVGGLLGSMLTGRFLDYIYKKALRDFEKKKQNGTIPENEEF 427

Query: 487 ----FRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFG--VLGFGSSMCSTTAITY 540
                RL  ++P      I  L FGWS ++   W IP++     V  F +    +++ T 
Sbjct: 428 NTIKVRLNAIIPQNFIAVISFLLFGWSADK--GWKIPAMLITSCVSSFCAMSTLSSSTTL 485

Query: 541 AVDSYKEFSQEALVTLNMVKNILG--FAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWA 598
            VD Y + +  A    N ++  L   F   F  +KF +  G    F    LI +   L  
Sbjct: 486 LVDLYPKKASTASSCFNFIRCSLSSIFMGCFAKMKFAMTVGGTFTFMV-GLILVGNFLML 544

Query: 599 IPLYRWGKLCRSWTNRKNLLQFSYRVND--DGKDEKDNHTE 637
           IP+ ++G   R     K       ++N+  DG D+ ++ ++
Sbjct: 545 IPM-KYGMEWRREREAKEQALLEQKLNESMDGNDDDNSQSK 584

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 108/523 (20%), Positives = 202/523 (38%), Gaps = 87/523 (16%)

Query: 105 DPLNWPIWRR-------DIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYL- 156
           +P NW +  R        I ++CV +        ++ +A G   +   L V  S+++ L 
Sbjct: 159 NPHNWSLKLRWLYTITLSILVICVAYG-------SACIAGGLGTVQKHLHVG-SEVAVLS 210

Query: 157 VGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF 216
           V  M+L    G +  SP + ++G+R+ Y V + +++I +I CA + +   L+I R   G 
Sbjct: 211 VSLMVLGFSFGPLIWSPVSDIYGRRVAYFVSMFLYVIFNIPCAVAKNPQTLMICRFFCGV 270

Query: 217 GLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST---HWLF 273
             S+   L   +IA+++    R   +  +                 +   +ST     +F
Sbjct: 271 WASSGLCLVGGSIADMFPNDTRGRAIAFFAYAPYCGPVFGPLVNGFI--SVSTGRMDLIF 328

Query: 274 WILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRL 333
           W+    AG  +++  L +PET+    PV  KR   + R                      
Sbjct: 329 WVNMAFAGVMWIIVAL-IPETY---APVILKRKAAKLR---------------------- 362

Query: 334 NPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDN 393
                     + G P  +T+    QEA+ G      +K+   + +   +        +D 
Sbjct: 363 ---------KETGNPKIMTE----QEAQ-GLSLNEMLKACCVRPLYFAV----TEPVLDL 404

Query: 394 WCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAP 453
            C      +V+  Y ++L+G + +A+ V+            + ++Y +     GL++I  
Sbjct: 405 TCF-----YVMLIY-SLLYG-FFFAFPVI------------FGELYDYKDNLTGLMFIPI 445

Query: 454 FIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQ 513
            IG    SL          + LA        PE RL   +      AI L   G +  ++
Sbjct: 446 LIG---ASLALCTTFYCENKYLAITRRRKPNPEDRLLGAMIGAPFAAISLWMLGATATKK 502

Query: 514 DHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVK 573
             W+ P+      G+G  +   +   Y +D Y +++  AL T   +++  G A   F  +
Sbjct: 503 VIWVAPASSGLPFGYGMVLIYYSLNNYIIDCYAQYASSALATKVFLRSAGGAAFPLFTTQ 562

Query: 574 FCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNRKN 616
              + G   A    A I   + L     Y +GK  R+  ++K+
Sbjct: 563 MYHNLGLHWASWLLAFIASGMVLIPYLFYTFGKGLRARLSKKD 605

>TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON} 
          Length = 520

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 72/157 (45%), Gaps = 9/157 (5%)

Query: 420 AVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLL---A 476
           A+V L  ++    + ++ IY F +  VG  Y+    G  +G L+A   S +  +      
Sbjct: 324 AIVYLFFVA--FPYIFETIYEFGAVEVGCAYV----GLLVGILLASPTSFIIQKHYEKKV 377

Query: 477 AHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTT 536
           A N+GI  PE R   +        IGL+ F W+  R+ HWI P I   + G G     T 
Sbjct: 378 ADNNGISTPEMRFEALYYGAFLTPIGLMIFCWTCYRKVHWIGPIIGSSIFGSGVFYVFTG 437

Query: 537 AITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVK 573
             +Y VD Y++FS  A+   + V++ +      F ++
Sbjct: 438 VFSYTVDGYRKFSATAMACNSFVRSTMSAVFPLFGLQ 474

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 88/207 (42%), Gaps = 20/207 (9%)

Query: 97  PQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAEL--------QV 148
           P P + K+     PI+R+ I  + +     V     ++++S ++ +S  +        +V
Sbjct: 63  PDPEDIKRI---LPIYRKYIIGMVITLTSMV----ITIISSCWTLISDRIMDHFHISHEV 115

Query: 149 PLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLL 208
            +  IS+ +      LGVG +F SP + L+G+R  +++ +   ++       S +   ++
Sbjct: 116 SVLGISFYI----FGLGVGPLFLSPLSELYGRRKTFIISLFFSIVWQCLVIWSKTIEGVM 171

Query: 209 ISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLS 268
             R +SGF  S   S+      +I+        + IYT              S      +
Sbjct: 172 FGRFLSGFFGSAFLSVAGGLFTDIFEKKNIGIPITIYT-TSPMLGPALGPIISGALHGTN 230

Query: 269 THWLFWILTIIAGSNFVLHLLFVPETF 295
             W F  + + +G +F+  +L VPET+
Sbjct: 231 YKWTFITMLLASGLSFICVILLVPETY 257

>Kpol_2002.86 s2002 (201096..203006) [1911 bp, 636 aa] {ON}
           (201096..203006) [1911 nt, 637 aa]
          Length = 636

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 81/192 (42%)

Query: 103 KKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMML 162
           + DP  W   ++    + +G  CF     ++++    +  +    V +  I   V  M+ 
Sbjct: 142 RDDPRTWTTRQKWNITILLGIICFDVAMMSAIVTGDINSPAKHFNVSIEVICLTVSLMVW 201

Query: 163 SLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVE 222
             G+G +  +P +  FG+  +Y   +L+ +I  I CA   +   LL  R + G   S   
Sbjct: 202 GFGIGPMIFAPLSEEFGRNAIYHTTLLVAVIFIIPCAVPRNIGTLLAFRFLDGLAFSAPM 261

Query: 223 SLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGS 282
            L   ++++I+   ER   + I++              SL+       W++  + I +G 
Sbjct: 262 CLIGGSLSDIWRVKERGVAMAIFSAAPFLGPVMGPIVGSLLSVKCGWRWVYIFMIIFSGC 321

Query: 283 NFVLHLLFVPET 294
            + +  +F+PET
Sbjct: 322 LYAVAFVFLPET 333

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 86/205 (41%), Gaps = 14/205 (6%)

Query: 398 MLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIY----GFSSASVGLVYIAP 453
           +LRPF+L +   I+F   LY   +  L+ +      AY  +Y    G+      +++I  
Sbjct: 374 LLRPFILLT-ELIVFLVTLYMSVIYGLLYM---FFFAYPLVYSEGKGWGDIKTSIMFIPI 429

Query: 454 FIGGCLGSLIAGR-GSDVNTRLLAAHNHGIYEP-EFRLFMVLPAVLCNAIGLLGFGWSLE 511
            +G  +G+ ++    +D N R     + G   P E RL  ++       IGL  + W+  
Sbjct: 430 GVGVLVGTALSPVFNNDYNRRAQRYIDRGEIPPAELRLIPMMAGCWFVPIGLFCYAWTSF 489

Query: 512 RQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFN 571
               W  P       G G  +    A  Y VDSY+ ++   L     V+++ G A   F 
Sbjct: 490 PHVSWAGPCFSGFACGLGFILLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGGACPLFT 549

Query: 572 VKFCLHEGYKNAFTCYALIEIFIGL 596
           ++     GY+ A T  A    FIGL
Sbjct: 550 IQMYHRLGYEWASTLMA----FIGL 570

>KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON} 
          Length = 516

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 87/453 (19%), Positives = 165/453 (36%), Gaps = 74/453 (16%)

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
           L  G +F SP + L+G+R  ++  + + ++       S +   ++  R +SGF  S+  S
Sbjct: 124 LAFGPLFLSPISELYGRRATFIFSLTLSIVWQCLTTWSRTLTGVMFGRFLSGFFGSSFLS 183

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +    I++I+   +    + +YT                ++  +   W F    I +G  
Sbjct: 184 VAGGAISDIFLKSQITVPMSLYTTAAMMGPSLGPIISGALYT-VDFRWTFVTFIIASGVC 242

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLS-ENVSIATVRSTRLNPRESAGHV 342
            V  ++ +PET+         R L     AR+ R  + ++   A +  TR          
Sbjct: 243 LVAIVVTIPETY---------RPLLLINKARRFRKETGDDRYFAPLEVTR---------- 283

Query: 343 NDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPF 402
                      E++   A   S  R  +    +  MA+ L  Y G               
Sbjct: 284 ----------RETSFLSAALLSSRRPFMLLFRDPMMAV-LCFYTGLEL------------ 320

Query: 403 VLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLG-- 460
                      A +Y Y V           + Y+ +Y F+      +YI   +G  L   
Sbjct: 321 -----------AIIYLYFVA--------FPYIYQTLYRFTVMQSACMYIGLMVGMILATP 361

Query: 461 -SLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP 519
            S++  R  +       A N G+  PE R   +    + + +GL+ F W+L    HWI  
Sbjct: 362 TSVLIQRRYEAKV----AQNGGVSVPEMRFDPLFYGAILSPVGLMIFAWTLYSHVHWIGS 417

Query: 520 SIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEG 579
            I   + G G          Y VD+Y+ ++   +   + V+ ++      F ++  ++EG
Sbjct: 418 MIGSALFGAGVLYVFIGIFNYTVDAYRRYAASGMACNSFVRCVMAGVFPLFGLQ--MYEG 475

Query: 580 YKNAFTCYALIEIFIGLWAIPLY--RWGKLCRS 610
               +  + +    + +  +P    R+G   RS
Sbjct: 476 MGINWASFLIAMCTLAMVPVPFLFKRYGAYLRS 508

>NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa]
           {ON} Anc_4.30
          Length = 567

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 98/470 (20%), Positives = 182/470 (38%), Gaps = 77/470 (16%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NWP+ ++ I  V +  +C      +S+ AS   ++     V   Q+  ++G  +  LG
Sbjct: 118 PFNWPMKKKVITCVILCLNCICISMGSSIFASAVPQICEIYGV--IQVVAILGVTLYVLG 175

Query: 166 --VGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  I  +P + ++G+R V ++    F +     A + +   ++I R   G   +   +
Sbjct: 176 FAISPIVYAPLSEIYGRRGVLVISSFGFCLFQFAVATAENLQTIMICRFFGGLMGAAPFA 235

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A +A+++  + R   + ++T              S + +  +  WL +++ I AG  
Sbjct: 236 VVPAAMADMFDTNTRGKAICLFTIGVFVAPVVSPVMGSYMAQRTTWRWLEYVIGIFAGVL 295

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
               ++F  ET      V           A+Q+R  + N  I             A H N
Sbjct: 296 TAAVVVFFQETHHPSILVAK---------AKQMRKETNNWGI------------HAAHEN 334

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
                                     IK I+EK +                     RP +
Sbjct: 335 ----------------------VELSIKEIAEKTIT--------------------RPII 352

Query: 404 -LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSL 462
            LF+ P +LF     ++    L ++ +     +   YGF+     L YIA  IG  + ++
Sbjct: 353 MLFTEPILLFVTIYNSFVYGILYLLLEAYPIIFVQGYGFTENG-ELPYIALIIGMLVCAI 411

Query: 463 -IAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWIIP 519
            I    SD   R   A   G   PE RL+ ++ A +   IG+L F W+     + H+++P
Sbjct: 412 FIWYMDSDYLRRFRKA---GTLVPEARLYPMIVAGIVFPIGILWFCWTGYYPEKIHFMVP 468

Query: 520 SIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSF 569
           ++    +GFG        + Y ++SY   +  A+     +++  GF  SF
Sbjct: 469 TVGGAFVGFGLMGIFLPCLNYIIESYLPLAASAVAANTFMRS--GFGASF 516

>KNAG0F03480 Chr6 complement(657351..658997) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 102/520 (19%), Positives = 193/520 (37%), Gaps = 75/520 (14%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P+NW + ++   ++ +     +    +S+   G  ++  +  V     +  +   +L  G
Sbjct: 95  PVNWTMAKKIFLVIQIMLLTCLTYMGSSIYTPGQEEIQKDFHVGHVTATLNLSMYVLGYG 154

Query: 166 VGSIFASPTAVL--FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
           +G I  SP + +  FG++ +Y+    +FM+  +GCA   +   L++ R  SG   S   +
Sbjct: 155 LGPIIFSPLSEVAKFGRQQIYIYTFFLFMVFQVGCATVKNIGGLVVLRFFSGILCSPSLA 214

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
              AT+ +I  A  R   +G++               + +    +  W+FW++  + G++
Sbjct: 215 TGGATMGDIVEAKWRPVLIGLWAIGAVAAPVLAPLLGAAMVVAKNWRWIFWLMLWMCGAS 274

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
            +L ++  PET                         S N +I + R+ RL  R+  G   
Sbjct: 275 LILFVICFPET-------------------------SAN-NILSRRARRL--RKQTG--- 303

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
           DD                    T+  I S  E +  +   +Y          M++L P +
Sbjct: 304 DDRY----------------YTTQERIDSAIEPKQFLITTLYRPIK------MILLEPII 341

Query: 404 L-FS-YPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGS 461
           + F  Y A+ +GA+   +    ++ I          +Y F+   +G+ Y   F  GC+ +
Sbjct: 342 MAFDLYIALCYGAFYLFFEAFPIVFIG---------LYKFTLVEMGVAYFG-FCVGCIFA 391

Query: 462 LIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSI 521
                       L      G   PE  L + +    C    L  FGW+     HWI+P I
Sbjct: 392 YALLLLFLAKV-LGPRFEKGEGTPETFLLLAMCVSWCLPCALFLFGWA--ANTHWIVPII 448

Query: 522 FFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLH---E 578
             G+           +  Y    Y ++           + +   A   F      +   +
Sbjct: 449 AEGIFVIAVFNLFQASFAYLSVCYPKYVASVFAGNGFCRAVFACAFPLFGKAMYDNLAID 508

Query: 579 GYKNAFTCYALIEIFIGLWAIP--LYRWGKLCRSWTNRKN 616
           GY   +    +  I + L AIP  LY++G   R+ +  K+
Sbjct: 509 GYPVGWGSSLVGFITMFLAAIPFVLYKYGPALRAKSRFKD 548

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 101/507 (19%), Positives = 185/507 (36%), Gaps = 90/507 (17%)

Query: 105 DPLNWPIWRR-------DIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLV 157
           +P NWP+W R          ++CV +        ++ +  G   +  +  V L       
Sbjct: 172 NPHNWPLWIRWTYTILLSTLVICVAYG-------SACITGGLGTVQDQFHVGLEAAILSC 224

Query: 158 GPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFG 217
             M++   +G +  SP + L+G+++ Y   + +++I +I CA + +   LL  R + G  
Sbjct: 225 SLMVIGFSLGPLIWSPVSDLYGRQVAYFFSMGLYVIFNIPCALAPNLGCLLACRFLCGVW 284

Query: 218 LSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST---HWLFW 274
            S+   L   +IA+++ +  R   +  +                 +   +ST     +FW
Sbjct: 285 SSSGLCLVGGSIADMFPSETRGKAIAFFAFCPYTGPVLGPVVNGFI--SVSTGRMDLIFW 342

Query: 275 ILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLN 334
           +    AG  +++    +PET+    PV  KR   + R                       
Sbjct: 343 VNMAFAGVMWIISSA-IPETY---APVILKRRAAKLR----------------------- 375

Query: 335 PRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNW 394
                    + G P  +T+    QEA+           IS  +M  G  +   + ++   
Sbjct: 376 --------KETGNPKIMTE----QEAQ----------GISFNEMMKGCVLRPLKFSVTEP 413

Query: 395 CMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPF 454
            +     +V   Y   L  A+ +AY V+            + ++YG+    +GL+ +   
Sbjct: 414 VLFATCFYVCLIYS--LLYAFFFAYPVI------------FSEMYGYKDNFIGLMMLPIL 459

Query: 455 IGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQD 514
           IG               ++ LA        PE RL          A+GL   G +     
Sbjct: 460 IGATFALAFTFW---CESKYLALIKTRKPTPEDRLLGAKIGAPFAALGLWMLGATTYNHR 516

Query: 515 HWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNV-- 572
            W+ P+      GFG  +   +   Y +D Y +++  AL T   +++  G A   F    
Sbjct: 517 MWVAPASSGIPFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTTQM 576

Query: 573 --KFCLH-EGYKNAFTCYALIEIFIGL 596
             K  LH   +  AF C A+I +  G 
Sbjct: 577 YHKLGLHWASWLLAFICTAMIALPFGF 603

>Ecym_7063 Chr7 complement(130980..132842) [1863 bp, 620 aa] {ON}
           similar to Ashbya gossypii AGR195W
          Length = 620

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 85/199 (42%), Gaps = 10/199 (5%)

Query: 409 AILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGS 468
           A+LF  + Y ++V           H   + YG+S+ ++G  Y  P +   +GS+I G  S
Sbjct: 424 ALLFATY-YGFSVT--------FSHYLTNEYGYSNLAIGACYACPGVALMMGSIIGGHSS 474

Query: 469 D-VNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLG 527
           D      +A H+   Y    RL   +  +  + +G +G+GW+++   H      F  ++ 
Sbjct: 475 DYFRKSWIAKHSDQKYPSYKRLLSQIMGLNVSMVGCIGYGWAIQLHYHVAALLFFSFLMA 534

Query: 528 FGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCY 587
           FG + CS + +TY  +S  + +   +   N  +NI     S    K C   G    FT  
Sbjct: 535 FGMTWCSNSTMTYLTESNPKRAAGTIAVSNSFRNIAAAISSAIIFKLCDAMGVGWCFTGL 594

Query: 588 ALIEIFIGLWAIPLYRWGK 606
            L ++   L    L R G 
Sbjct: 595 GLCDLISVLSIYYLIRNGN 613

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 72/172 (41%), Gaps = 2/172 (1%)

Query: 126 FVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYL 185
           F+G    ++       L  E  V  + I+  V   M       +  +  A   G++L+Y+
Sbjct: 173 FLGPMSGNIYIPALPILEREFNVSTTTINTTVSVFMAVFSFAPLLWAIYADYGGRKLLYV 232

Query: 186 VGILIFMIGSIGCAC-STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGI 244
           + + + +I +I  A   T+   L   R+   F  S+V SL + T+++I    +R   +  
Sbjct: 233 ISMGLNVIVNILLASIPTNIGALYFLRIAQAFASSSVISLGAGTVSDITSPKDRGKAVAY 292

Query: 245 YTXXXXXXXXXXXXXXSLVFEHLST-HWLFWILTIIAGSNFVLHLLFVPETF 295
           +                ++  +     WLF   +I+AG  F+L  LF+PET 
Sbjct: 293 FMLGPNAGPVLAPIIAGIILMNGDNWRWLFGFTSIMAGVGFMLVCLFLPETL 344

>Kpol_1057.25 s1057 (56904..58550) [1647 bp, 548 aa] {ON}
           (56904..58550) [1647 nt, 549 aa]
          Length = 548

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 48/230 (20%), Positives = 93/230 (40%), Gaps = 2/230 (0%)

Query: 82  SDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSK 141
           + D+    K   +++    E  + P NW   ++ I ++ V     V    +S+   G   
Sbjct: 71  NTDNETINKDPFLVDWNGDEDPEHPYNWSTPKKTIMILQVMLLTAVTYMGSSIYTPGQEA 130

Query: 142 LSAELQVPLSQISYLVGPMMLSLGVGSIFASPTA--VLFGKRLVYLVGILIFMIGSIGCA 199
           +  E  V     +  +   +L  G+G I  SP +     G++ +Y++ +  F I  IG A
Sbjct: 131 VQKEFHVGHVAATLNLSIYVLGYGIGPIIFSPLSEFATLGRQNIYIITLFCFCIFQIGAA 190

Query: 200 CSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXX 259
              ++  +++ R +SG   S   +   AT+ +I         LG++              
Sbjct: 191 TVKNYGGMVVIRFISGIFCSPALATGGATVTDIMKPELVPVVLGLWAVGAIAAPVLAPLL 250

Query: 260 XSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHE 309
            + + E     W+FW+L  +  +  ++ + F PET  D   V   R L +
Sbjct: 251 GAAILEAKDWRWIFWLLLWMCAATLIILIFFFPETHHDNILVRRARRLRK 300

>TPHA0O02010 Chr15 complement(410334..412022) [1689 bp, 562 aa] {ON}
           
          Length = 562

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 99/230 (43%), Gaps = 19/230 (8%)

Query: 78  ESGGSDDHLKKTKKGIILNP------QPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQ 131
           E+G +D   +K K     NP       PS+    P+NW   +R   L+ +     V    
Sbjct: 76  EAGSADQESQKQKTVEERNPFLLEWDDPSD-PDFPVNWSKKKRGAILLQIMLLTSVTYMG 134

Query: 132 TSMLASGFSKLSAELQVPLSQISYLVGPMMLSL-----GVGSIFASPTA--VLFGKRLVY 184
           +S+   G  ++ +E  V      ++V  + LSL     G+G +  SP +   L G++ +Y
Sbjct: 135 SSIYTPGQLQIQSEFGV-----GHVVATLNLSLYVLGYGLGPLIFSPLSEFSLLGRQHLY 189

Query: 185 LVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGI 244
            V + IF I  IGCA   +F  L++ R +SG   S   S   A+I++I         LG+
Sbjct: 190 TVTLFIFTILQIGCATVHNFGGLVVLRFLSGVFCSPSLSTGGASISDILAPEVVPLFLGL 249

Query: 245 YTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPET 294
           +               + +       W+FW L  +     VL +LF+PET
Sbjct: 250 WAVGAISAPVLAPLLGAAMVVAEDWRWIFWFLLWLCAFTLVLLMLFMPET 299

>CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {ON}
           highly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028w TPO1
          Length = 577

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 93/475 (19%), Positives = 180/475 (37%), Gaps = 83/475 (17%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NWP+ ++ +  + +  +C      +S+ A+G  ++     V    +  ++G  +  LG
Sbjct: 128 PFNWPLRKKVMLCIILCLNCISITMGSSIFATGIRQICEIYHV--IPVVAILGITLYVLG 185

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  +  +P + ++G+R V ++    F + +   A +     ++I R  +GF  +   +
Sbjct: 186 FAASPVIYAPLSEIYGRRGVLVISSFGFALFNFAVATAKDLQTIMICRFFAGFIGAAPLA 245

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A  A+++  + R   + +++              S + +H +  WL +++   A + 
Sbjct: 246 VVPAAFADMFDTNIRGKAICLFSLGVFVGPILAPVIGSYITQHTTWRWLEYVIACFASAI 305

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRI----ARQVRGLSENVSIATVRSTRLNPRESA 339
           FV  L F  E+             H   I    A+++R L+ N  I             A
Sbjct: 306 FVAILFFFEES-------------HHPSILVGKAKELRKLTGNWGI------------HA 340

Query: 340 GHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVML 399
            H                            +K I+EK +                     
Sbjct: 341 AH----------------------EDVELSVKEIAEKTIT-------------------- 358

Query: 400 RPFV-LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGC 458
           RP + LF+ P +L      ++    L ++ +     ++  YGF +    L YI+  IG  
Sbjct: 359 RPIIMLFTEPLLLIVTIYNSFVYGILYLLLEAYPIVFEQGYGFHTNG-ELPYISLIIGMA 417

Query: 459 L-GSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDH 515
           + G+ I     D   R       G   PE RL  ++ A +   IG+L F W+     + H
Sbjct: 418 ICGAFIWWMDEDYLRRY---RKKGGLVPEARLLPMVVAGIVFPIGILWFCWTGNYPHKIH 474

Query: 516 WIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFF 570
           WI+P+I     GFG        + Y ++SY   +  A+     +++  G A   F
Sbjct: 475 WIVPTIAGAFTGFGLIGIFLPCLNYIIESYLLIAASAVAANTFMRSGFGAAFPLF 529

>TPHA0A00130 Chr1 complement(10942..12645) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 100/230 (43%), Gaps = 19/230 (8%)

Query: 78  ESGGSDDHLKKTKKGIILNP------QPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQ 131
           E+G +D+  +K K     +P       PS+    P+NW   +R   L+ +     V    
Sbjct: 81  EAGSADEESQKQKTVEERDPFLLEWDDPSD-PDFPVNWSKKKRGAILLQIMLLTSVTYMG 139

Query: 132 TSMLASGFSKLSAELQVPLSQISYLVGPMMLSL-----GVGSIFASPTA--VLFGKRLVY 184
           +S+   G  ++ +E  V      ++V  + LSL     G+G +  SP +   L G++ +Y
Sbjct: 140 SSIYTPGQLQIQSEFGV-----GHVVATLNLSLYVLGYGLGPLIFSPLSEFSLLGRQHLY 194

Query: 185 LVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGI 244
            V + IF I  IGCA   +F  L++ R +SG   S   S   A+I++I         LG+
Sbjct: 195 TVTLFIFTILQIGCATVHNFGGLVVLRFLSGVFCSPSLSTGGASISDILAPEVVPLFLGL 254

Query: 245 YTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPET 294
           +               + +       W+FW L  +     VL +LF+PET
Sbjct: 255 WAVGAISAPVLAPLLGAAMVVAEDWRWIFWFLLWLCAFTLVLLMLFMPET 304

>Kpol_358.7 s358 complement(24674..26041) [1368 bp, 455 aa] {ON}
           complement(24674..26041) [1368 nt, 456 aa]
          Length = 455

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/228 (21%), Positives = 97/228 (42%), Gaps = 3/228 (1%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           PLNW + ++ I ++ +          +S+   G   +  E ++     +  +   ++  G
Sbjct: 2   PLNWSVPKKAIMMIQITLLTMFTYMGSSIYTPGQDAIQEEFKIGHVAATLNLSVYVIGYG 61

Query: 166 VGSIFASPTA--VLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
           +G IF SP +     G++ +Y++ +  F +  IG A   +   +++ R +SG   S   +
Sbjct: 62  IGPIFFSPLSEFATLGRQNIYIITLFCFCMLQIGTATVDNLGGMVVIRFLSGIFCSPSLA 121

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
              ATI+++      +  L I+               + + E     W+FW+L  +  + 
Sbjct: 122 TGGATISDMISVENVSTLLVIWAAGSFASPVLAPLLGAAMLEAKGWRWIFWLLLWMCTAI 181

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSE-NVSIATVRS 330
           F+L + F PET  D   V   R L +     +   L+E N S+   +S
Sbjct: 182 FILMIFFFPETHHDNILVRRARRLRKETGDNRYYALAEKNESVMDFKS 229

>TPHA0G01430 Chr7 (292540..294453) [1914 bp, 637 aa] {ON} Anc_8.723
           YOR273C
          Length = 637

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 83/191 (43%), Gaps = 4/191 (2%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NWP W++  A +     C V    +S+  SG  +L    Q+  +Q   L G     L
Sbjct: 64  NPHNWPAWKKWYATMVAALLCLVVTMGSSLYVSGVPELVLRYQI--NQTLALAGLTFYLL 121

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS-RVVSGFGLSTVES 223
           G+ ++  +P + +FG++ +YL+ + I M+ ++G   S     +++  R  SG   S   S
Sbjct: 122 GLTTVIGAPLSEVFGRKPIYLISLPISMLFTMGVGLSGGHMRIILPLRFFSGVFGSPALS 181

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + S TI +++   E    + ++                   E     W  WI  +IAG  
Sbjct: 182 VGSGTILDVFDMDEVPMAMAMFCLAPFLGPIISPVMAGFATEKQGWRWAEWI-QLIAGGL 240

Query: 284 FVLHLLFVPET 294
            +  +  +PET
Sbjct: 241 ILPFIALMPET 251

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 58/146 (39%), Gaps = 16/146 (10%)

Query: 501 IGLLGFGWSLERQDHWIIPSIFFGV-LGFGSSMCSTTAITYAVDSYKEFSQEALVTL-NM 558
           I L    W+     HW+ P I  GV  GFG  +   + + Y   SY      +++   NM
Sbjct: 416 IALFWQAWTARSDVHWMAP-IAAGVPFGFGLILIFFSVLIYFSYSYPPLYVASVIAANNM 474

Query: 559 VKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNRKNLL 618
           ++ ++      F V+   +   K A T +AL+ + +        RWG   R      N+ 
Sbjct: 475 LRYLMSSVFPLFTVQMYENLTIKWASTLFALVCVVMIPVPWIFERWGPKLR------NIS 528

Query: 619 QFSYRVN-------DDGKDEKDNHTE 637
           QF +             ++E+D H +
Sbjct: 529 QFGWAAMAREQAKLKQEEEERDQHAK 554

>ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON}
           similar to uniprot|O43081 Schizosaccharomyces pombe
           SPBC947 SPBC947.06c protein and weakly similar to
           YHR048W uniprot|P38776 Saccharomyces cerevisiae YHR048W
           Hypothetical ORF
          Length = 508

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 103/263 (39%), Gaps = 18/263 (6%)

Query: 358 QEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVM--------LRPFVLFSYPA 409
            E+ +G       K I ++    G   YH +H  + W + +        +RPF + + P 
Sbjct: 245 SESHSGVLLAYRAKKIRKRT---GNWAYHAKH--EEWDLDLNEYLSTHLIRPFAMLATPI 299

Query: 410 ILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSD 469
           + F A   +Y    L +I   +   +K   G+      L  +A  +G  LG +    G  
Sbjct: 300 VFFLALFASYVFGILYLIVTSLPLTFKMTRGWEGTLGNLPMLAVLVGVILGGVANVWGGL 359

Query: 470 VNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFG 529
              R+L A N G+  PE R   ++        GL  F W+     HWI P I    + FG
Sbjct: 360 RYRRILIA-NKGVPIPEERFPPMMMFAWLMPTGLFIFAWTSWAHVHWIAPCIGLSCMAFG 418

Query: 530 SSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYAL 589
             +     + Y VD++ +++  A+      ++IL      F      + G     +  A 
Sbjct: 419 FFVIFQGCLNYLVDAFTKYAASAIAANTFFRSILAGVFPLFGSALFGNLGVHWGASTIAF 478

Query: 590 IEIFIGLWAIP--LYRWGKLCRS 610
           +   +G+  IP   Y +G   RS
Sbjct: 479 VA--LGMIPIPFVFYAFGSKIRS 499

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 47/112 (41%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
            P NW   ++       G   F     ++  +   S L     V   +        +L +
Sbjct: 54  SPFNWSRGKKLWHTAIYGLATFSAQFNSTTTSPSVSHLGEYFNVSREKALLATSLYVLGI 113

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF 216
             G +F +P + ++G+++     +L+ M+ ++G A S  F  LL +R  +GF
Sbjct: 114 AFGPMFFAPLSEMYGRKIAIFGSLLVSMVFTLGSASSKDFASLLATRFFAGF 165

>Kpol_1018.195 s1018 (493001..494647) [1647 bp, 548 aa] {ON}
           (493001..494647) [1647 nt, 549 aa]
          Length = 548

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/230 (20%), Positives = 93/230 (40%), Gaps = 2/230 (0%)

Query: 82  SDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSK 141
           + D+    K   +++    +  + P NW   ++ I ++ V     V    +S+   G   
Sbjct: 71  NTDNETINKDPFLVDWNGDDDPEHPYNWSTPKKTIMILQVMLLTAVTYMGSSIYTPGQEA 130

Query: 142 LSAELQVPLSQISYLVGPMMLSLGVGSIFASPTA--VLFGKRLVYLVGILIFMIGSIGCA 199
           +  E  V     +  +   +L  G+G I  SP +     G++ +Y++ +  F I  IG A
Sbjct: 131 VQKEFHVGHVAATLNLSIYVLGYGIGPIIFSPLSEFATLGRQNIYIITLFCFCIFQIGAA 190

Query: 200 CSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXX 259
              ++  +++ R +SG   S   +   AT+ +I         LG++              
Sbjct: 191 TVKNYGGMVVIRFISGIFCSPALATGGATVTDIMKPELVPVVLGLWAVGAIAAPVLAPLL 250

Query: 260 XSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHE 309
            + + E     W+FW+L  +  +  ++ + F PET  D   V   R L +
Sbjct: 251 GAAILEAKDWRWIFWLLLWMCAATLIILIFFFPETHHDNILVRRARRLRK 300

>TDEL0E04480 Chr5 complement(836068..837918) [1851 bp, 616 aa] {ON} 
          Length = 616

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/192 (19%), Positives = 86/192 (44%)

Query: 103 KKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMML 162
           ++DP  W   ++    + +G  CF     ++++    +  +    V    +   V  M+ 
Sbjct: 130 REDPRCWSTRQKWNLTILLGVVCFAVALMSAIITGDMTSPAEYFGVSSIVMCLCVSLMVW 189

Query: 163 SLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVE 222
             GVG +  +P +  FG+  VY   +L+ ++  + CA + +   LL  R + G   S   
Sbjct: 190 GFGVGPLLFAPLSEEFGRNWVYHTTLLVAVVFIVPCAVAKNIGTLLAFRFLDGLAFSAPM 249

Query: 223 SLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGS 282
            L   ++++++   ER   + +++              SL+   ++  W ++ + I +G 
Sbjct: 250 CLIGGSLSDMWRNEERGVAMSVFSAAPFIGPVMGPIIGSLLSVKINWRWPYYFMIIFSGC 309

Query: 283 NFVLHLLFVPET 294
            +++ ++F+PET
Sbjct: 310 LYIIMVIFLPET 321

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 82/201 (40%), Gaps = 10/201 (4%)

Query: 398 MLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYG----FSSASVGLVYIAP 453
           ++RP +L S   I+F   LY   +  L+ +      AY  +Y     +      L++I  
Sbjct: 362 LMRPVILLS-ELIVFLITLYMSIIYGLLYM---FFFAYPMVYSEGKKWGDIKTSLMFIPL 417

Query: 454 FIGGCLGSLIAG-RGSDVNTRLLAAHNHGIYEP-EFRLFMVLPAVLCNAIGLLGFGWSLE 511
            +G  + + I+     D   R     + G   P E RL  ++   +   +GL  + WS  
Sbjct: 418 GVGVLISTAISPILNKDYLKRAQRYIDRGEVPPAELRLIPMMIGSIFVPVGLFAYAWSSF 477

Query: 512 RQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFN 571
               W  P       GFG  M    A  Y VDSY+ ++   L     V+++ G AV  F 
Sbjct: 478 PHVSWAGPCFSGMACGFGFLMLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGGAVPLFT 537

Query: 572 VKFCLHEGYKNAFTCYALIEI 592
           ++     GY+ A T  A I +
Sbjct: 538 IQMYHRLGYEWATTLMAFISL 558

>TBLA0A04260 Chr1 (1055087..1056790) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 97/225 (43%), Gaps = 20/225 (8%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NW I  + + ++       V     S+   G   +  E  V      ++VG + LS+
Sbjct: 113 NPQNWSIRMKTVMMIQTSILTCVTYMGASIYTPGQEDIQNEFNV-----GHIVGTLNLSV 167

Query: 165 -----GVGSIFASPTAVL--FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFG 217
                G G +F +P + +    ++++Y + +L + I  IGCA   +   L++ R ++GF 
Sbjct: 168 YVLGYGFGQVFFAPLSEVSTIDRQIIYSLTLLFYSIFQIGCATVNNIGGLIVIRFITGFL 227

Query: 218 LSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILT 277
            S   +   AT+A+   A   AY LG+++              + +    +  W+FW L 
Sbjct: 228 SSQALATTGATMADFLDARYYAYLLGLWSVGAIAAPILAPLLGACMVVAKNWRWIFWFLC 287

Query: 278 IIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSEN 322
            ++ +  ++ + F PET        N  ++   R  R  + + +N
Sbjct: 288 WLSATITLITMFFYPET--------NHANILHRRAKRLRKQIGDN 324

>KAFR0B00180 Chr2 complement(43943..45535) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 104/553 (18%), Positives = 203/553 (36%), Gaps = 88/553 (15%)

Query: 77  QESGGSDDHLKKTKKGIILNPQP-------SECKKDPLNWPIWRRDIALVCVGWHCFVGG 129
           ++S  +D   K  ++  + +  P       ++   +P NW   ++++ +  V        
Sbjct: 41  EDSSSADIESKAGRENPVGDSAPFLVDWNGNDDPDNPQNWSDLKKNLIVFEVILLTCTNY 100

Query: 130 GQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVL--FGKRLVYLVG 187
             +S+   G   +  +  V     +  +   +L  G+G +F SP + +   G++ +Y+V 
Sbjct: 101 MGSSIYTPGQDGIQNDFHVGQVTATLNLSLYVLGCGLGQVFFSPLSEVAKIGRQQIYIVT 160

Query: 188 ILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTX 247
             IFM+  IGCA   +   L+I R+++G   S   S   A+IA++    +    + ++  
Sbjct: 161 FPIFMLIQIGCATVQNIEGLIILRLLTGILCSPPLSTGGASIADVIHPGKLTTYIALWAV 220

Query: 248 XXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSL 307
                        + +    +  W FW+L  ++    +  + F PE     T   N  S 
Sbjct: 221 GTLAAPIIGPLLGASMVVAKNWRWTFWLLLWLSIPCLICCIFFFPE-----TSAANILSR 275

Query: 308 HETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTR 367
             +RI +Q                     ++  H   + +  G+T     ++    +  R
Sbjct: 276 RASRIRKQT-------------------GDNRYHTEQEMLDAGVT----PKDFLINTLYR 312

Query: 368 AHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIII 427
             I+ I ++ + +   +Y                       A+ FG         +L + 
Sbjct: 313 P-IEIIVKEPIVLAFDVYT----------------------ALCFG---------TLYLF 340

Query: 428 SQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLG--SLIAGRGSDVNTRLLAAHNHGIYEP 485
            + +   + + +GF+   +GL Y    +G C+    L+      V  R       G + P
Sbjct: 341 FEALPIVFVENWGFTLIELGLSYFGFCVGCCVAFSVLLLFVSKIVKPR----RQDGTFVP 396

Query: 486 EFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP---SIFFGVLGFGSSMCSTTAITYAV 542
           E  L + +         L  FGW+     HWI+P    IFF +  F       TA +Y  
Sbjct: 397 ETFLILAMSVSWSLPCALFLFGWA--AMTHWIVPIIAEIFFVLFAFN---LFQTAFSYLA 451

Query: 543 DSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLH---EGYKNAFTCYALIEIFIGLWAI 599
             Y  +         + + + G A   F      +   +GY   +    +  I + L  I
Sbjct: 452 LCYPNYIASVYAGNGLCRCVFGCAFPLFGRAMYNNLAIDGYPVGWGSSIIGFISLALALI 511

Query: 600 P--LYRWGKLCRS 610
           P  LY++G+  RS
Sbjct: 512 PFVLYKYGEYLRS 524

>Kwal_55.19590 s55 complement(38363..39964) [1602 bp, 533 aa] {ON}
           YBR008C (FLR1) - Major Facilitator Transporter [contig
           159] FULL
          Length = 533

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 91/459 (19%), Positives = 175/459 (38%), Gaps = 100/459 (21%)

Query: 82  SDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSK 141
           S+      K   +++    E   +PLNW   ++ + +               ML +  + 
Sbjct: 56  SNSDSTDEKDPFLVDWDGPEDPDNPLNWSSGKKSLVV------------SQMMLLTCATY 103

Query: 142 LSAELQVPLSQ-------ISYLVGPMMLSL-----GVGSIFASPTAVL--FGKRLVYLVG 187
           + A +  P  +       + ++VG + LSL     G+G I  SP + +   G++ +Y++ 
Sbjct: 104 MGASIYTPGQEGIQREFGVGHVVGTLNLSLYVLGYGLGPIIFSPLSEVASVGRQQIYVIT 163

Query: 188 ILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTX 247
           + +FM+  +G A   +   LL+ R +SG   S   +   AT+ +I         +G++  
Sbjct: 164 VFLFMLFQVGAATVKNIGGLLVIRFISGILCSPSLATGGATMGDIIKPEIVPIFIGLWAI 223

Query: 248 XXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSL 307
                        + + +  +  + FWIL  I+ + F++ +LF PET        +   L
Sbjct: 224 GAVAAPVIAPLIGAAMVQAKNWRYTFWILMWISAATFIVLVLFFPET-------QHNNIL 276

Query: 308 HETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTR 367
           H  R A +VR ++ +    T                              +  ++  +TR
Sbjct: 277 H--RRAVRVRKVTGDNRFYT----------------------------QQERIDSKIETR 306

Query: 368 AHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSY-PAILFGAWLYAYAVVSLII 426
           A +                          V +RPFV+ +  PA+L      A    +  +
Sbjct: 307 AFMHE------------------------VFVRPFVIMALEPAVLAFDIYIAVCYGAFYL 342

Query: 427 ISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDV--NTRLLAAHNHGIYE 484
             +     +  IY F+   +GL     F+G C+G ++A     +     +     +  + 
Sbjct: 343 FFEAFPLVFVGIYNFTLVELGLA----FMGFCVGCVLAYIALLIYLAKYIAPKFKNNTFT 398

Query: 485 PEFRLFMVLPAVLCNAI--GLLGFGWSLERQDHWIIPSI 521
           PE   F+ L   +C A+   L  FGW+   + HW++P I
Sbjct: 399 PE--DFLPLSMAVCWALPLSLFMFGWT--ARVHWVLPMI 433

>ZYRO0E09988g Chr5 (796142..797788) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 548

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 112/556 (20%), Positives = 211/556 (37%), Gaps = 95/556 (17%)

Query: 73  DMKGQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQT 132
           D+ G      D   K T+   +++    E  + P NW   ++ I +  V    F+    +
Sbjct: 64  DIDGAVEQMHD--FKDTRDPFLIDFTGPEDPEHPHNWSTLKKTIVITEVSLLTFITYMGS 121

Query: 133 SMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTA--VLFGKRLVYLVGILI 190
           S+   G  ++  E  V     +  +   ++  G+G I  SP +   +FG++ +Y+V + +
Sbjct: 122 SIYTPGQEQIQQEFGVGHVVATLNLSVYVIGYGIGPIIFSPLSEFAIFGRQQLYIVTLFL 181

Query: 191 FMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXX 250
           F +   GCA   +   L+I R ++G   S   +  +A+I ++         LG+++    
Sbjct: 182 FTMLQAGCALVHNIAGLVILRFLTGVLCSPSLATGAASIGDVVRPKYVPILLGLWSGAAY 241

Query: 251 XXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHET 310
                     + +    +  W+FW+L  ++    V  + F PET  D         LH  
Sbjct: 242 AAPCVGPLIGAAMVIAKNWRWIFWLLMWMSALLLVTLIFFFPETSEDNI-------LH-- 292

Query: 311 RIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHI 370
           R   +++ ++ +    T ++     RE +              + NA++    +  R   
Sbjct: 293 RRCERIKKITGDDRYYTFKA-----REES--------------KLNAKDIAIIALYRPFE 333

Query: 371 KSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLF--SYPAILFGAWLYAYAVVSLIIIS 428
             + E  +            +D +  +    F LF  S+P +  G  +Y + ++ L    
Sbjct: 334 IMVKEPIV----------QALDIYIALTYGIFYLFFESFPIVFSG--IYHFTLIEL---- 377

Query: 429 QVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHN--HGIYEPE 486
                             GL Y    +G  +GS +A   S +     A     +G + PE
Sbjct: 378 ------------------GLSY----LGFLVGSFVAYAASIIFLHYYADRKMANGTFTPE 415

Query: 487 FRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP---SIFFGVLGFG--SSMCSTTAITYA 541
             L + +    C   GL  FGW+     HW++P    + F +  F    S+ S  A++Y 
Sbjct: 416 TFLVLAMCVSWCLPCGLFIFGWA--ASVHWMVPIAAELLFVMCDFNLWESIFSYLAVSYP 473

Query: 542 VDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLH-----EGYKNAFTCYALIEIFIGL 596
                 F+   ++         GFA +F      ++     +GY   +    L  I IGL
Sbjct: 474 KYVASVFAGNGVLR-------AGFACAFPLFGKAMYDNLAIDGYPVGWGSSLLGFITIGL 526

Query: 597 WAIP--LYRWGKLCRS 610
             +P   Y++G   RS
Sbjct: 527 ALLPFLFYKYGPYLRS 542

>ZYRO0G16302g Chr7 complement(1336890..1338533) [1644 bp, 547 aa]
           {ON} similar to uniprot|P38776 Saccharomyces cerevisiae
           YHR048W Hypothetical ORF
          Length = 547

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 93/458 (20%), Positives = 163/458 (35%), Gaps = 78/458 (17%)

Query: 161 MLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLST 220
           +  LG G +  SP + L+G+R+ ++  +   +        S +   +L  R +SGF  S+
Sbjct: 152 IFGLGCGPLLLSPISELYGRRITFIFSLSFSVAWQCLVIWSPTIEGVLFGRFLSGFFGSS 211

Query: 221 VESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIA 280
             S+ S TI++I+   +    +  Y               S  F      W F ++ I++
Sbjct: 212 FLSVASGTISDIFTKDQIGIPMTFYALAPFAGPSLGPVL-SGAFNKDGYKWPFIVMMIVS 270

Query: 281 GSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAG 340
                L    VPE++                                             
Sbjct: 271 SVLLGLVTFTVPESY--------------------------------------------- 285

Query: 341 HVNDDGVPVGLTDESNAQEAETGS-KTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVML 399
                  PV L  ++     ETG  K  A ++ I  +     L +   +  ID    ++L
Sbjct: 286 ------KPVLLIRKAKRLRKETGDDKYFAPLEVIRREANIFRLILLSVKRPID----LLL 335

Query: 400 RPFVL--FSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGG 457
           R +++   S+   L  A +Y Y  V          + Y  ++ F+    GL Y+   IG 
Sbjct: 336 RDYMIGVLSFYTGLVLAIIYLYFTV--------FPYIYPKLWNFTVMETGLAYLGLLIGM 387

Query: 458 ---CLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQD 514
              C   LI  +    N       N G   PE R   +     C  IGL+ F W+     
Sbjct: 388 IIVCPSCLIFQK----NYARRVERNGGKSTPEMRFEALFYGAFCTPIGLMIFAWTCYSHV 443

Query: 515 HWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKF 574
           HWI   I   V G G          Y VD+Y+ ++  A+     V+ I+      F  + 
Sbjct: 444 HWIGSLIGSAVFGAGVFFVFVGVFAYTVDAYRRYAASAMACNTFVRCIMAGVFPLFGRQ- 502

Query: 575 CLHEGYKNAFTCYALIEIFIGLWAIPLY--RWGKLCRS 610
            +++G    +  + L  + +G+  +P    ++G + R+
Sbjct: 503 -MYKGMGINWAGFLLAMVAVGMIPVPFLFSKYGSVLRA 539

>NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa]
           {ON} Anc_4.30
          Length = 639

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 100/446 (22%), Positives = 174/446 (39%), Gaps = 75/446 (16%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NWP+ ++ I  V +   C      +S+  S   ++     V   Q+  ++G  +  LG
Sbjct: 190 PFNWPMKKKVILCVVLCLDCIGISMGSSIFGSAVLQICEIYDV--IQVVAILGITLYVLG 247

Query: 166 --VGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             V  +  +P + ++G+R V ++    F I     A + +   ++I R  SG   S   +
Sbjct: 248 FAVSPVIYAPLSEIYGRRGVLVISAFAFCIFQFAVATAENLQTIMICRFFSGVIGSAPMA 307

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A  A+++  + R   + +++              S + +  +  WL +++ I AG  
Sbjct: 308 VVPAAFADMFDTNLRGKAICLFSLFVFVGPILSPVFGSYMAQRTTWRWLEYVVGIFAGVV 367

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           FVL +LF  ET      V NK        A+Q+R  S N  I             A H N
Sbjct: 368 FVLIVLFYEETHHPSILV-NK--------AKQMRKQSNNWGI------------HAAHEN 406

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRP-F 402
                                     IK I +K +                     RP F
Sbjct: 407 ----------------------VELSIKDIIQKTVT--------------------RPIF 424

Query: 403 VLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSL 462
           +LF+ P +L      ++    L ++ +     + + YGF      L YIA  +G  + S 
Sbjct: 425 MLFTEPMLLIITIYNSFVYGILYLLLEAYPIVFVEGYGFIENG-ELPYIALIVGMLVCSF 483

Query: 463 IAGRGSDVNTRLLAAHNHGIYEPEFR-LFMVLPAVLCNAIGLLGFGWS--LERQDHWIIP 519
                 D +     A   G+  PE R L M+LP++    IG+L F W+     + H+++P
Sbjct: 484 FIWY-MDTDYLKRCAKKGGLV-PEARLLLMILPSIFF-PIGILWFCWTGNYPEKIHFMVP 540

Query: 520 SIFFGVLGFGSSMCSTTAITYAVDSY 545
           ++  G +GFG        + Y ++SY
Sbjct: 541 TVAGGFIGFGLIGIFLPCLNYIIESY 566

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 76/166 (45%), Gaps = 2/166 (1%)

Query: 138 GFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIG 197
              +L  +  +  ++++  V   +L  GV    +   A ++G+R V L G+LIF++ SIG
Sbjct: 113 ALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASIG 172

Query: 198 CACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXX 257
            A + S+  ++  R +   G+S   ++ S  +++     ER   +G  +           
Sbjct: 173 IAKAPSYGVIVFLRCIQSIGISPTIAISSGVVSDFTVKRERGTFVGATSGLVLIGQGIGP 232

Query: 258 XXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPN 303
              +++   L    +FW LTI  GS  ++    +PET   RT V N
Sbjct: 233 LLGAVITAALHWRAVFWFLTIGCGSCMIIGFFLLPET--KRTIVGN 276

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 69/170 (40%), Gaps = 22/170 (12%)

Query: 439 YGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEP------------E 486
           Y +S   +G+ Y+   IGG  GS++ GR  D+  R          E             +
Sbjct: 361 YNYSLTIIGVCYLPAGIGGLAGSMLTGRVIDLYYRRSLQKFQEDKESGKISEDTPFNNFK 420

Query: 487 FRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAI----TYAV 542
            RL  VLP         + FGWS+++   W IPS+   +  F  S C+ +++    T  V
Sbjct: 421 VRLACVLPQCFIAICSFILFGWSVDK--GWKIPSVL--ITSFVCSYCTMSSLSVMTTLLV 476

Query: 543 DSYKEFSQEALVTLNMVKNILG--FAVSFFNVKFCLHEGYKNAFTCYALI 590
           D Y   S  A    N V+  L   F   F  +K  +  G   +F C  L+
Sbjct: 477 DLYPTKSSTASSCFNFVRCSLSTIFMGCFAKMKQSMTVGGTFSFLCGLLL 526

>TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 87/476 (18%), Positives = 182/476 (38%), Gaps = 73/476 (15%)

Query: 100 SECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGP 159
           ++ K  P NW +  + I    +   C      +S+ A G +++S   Q  +  +  ++G 
Sbjct: 177 ADDKLHPFNWSMKEKTITCAILCLDCITITLGSSIFAPGVTQISE--QYDIITVVAILGI 234

Query: 160 MMLSLGVGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFG 217
            +  LG  +  +  +P + ++G++L+ ++    F +     A + +   ++I R  SG  
Sbjct: 235 TLYVLGFAASPVLYAPLSEIYGRKLILVISGFGFALFQFAVATAENLQTIMICRFFSGLI 294

Query: 218 LSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILT 277
                ++  A  A+++  + R   + +++              S + +H S  WL +++ 
Sbjct: 295 GGAPMAVVPAVFADMFDTNFRGKAICLFSAFVFIGPILGPIMGSYIVQHTSWRWLNYVVG 354

Query: 278 IIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRE 337
            +A   FVL  +FV            K S H T +  + R + +      +R        
Sbjct: 355 CLASLVFVLLCVFV------------KESHHATILVNKARKMRKETGNWGIR-------- 394

Query: 338 SAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMV 397
            A H                ++AE        +K I E  +                   
Sbjct: 395 -AAH----------------EDAELS------LKEICETTIT------------------ 413

Query: 398 MLRPFVL-FSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIG 456
             +P VL F+ P +L  +   ++    L ++ +     +   YG +     L Y+A  +G
Sbjct: 414 --KPIVLLFTEPVLLVISLYNSFVYGILYLLLEAYPIVFIQGYGLTVNGY-LPYLALIVG 470

Query: 457 GCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQD 514
             + + +        ++ +A     +  PE RL+ ++ + +   IG+L F W+     + 
Sbjct: 471 IIICAGMIWYADTDYSQQVAKQKKLL--PERRLYPIIISGIVFPIGILWFCWTGAYPEKI 528

Query: 515 HWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFF 570
           HWI P+I    +GFG        + Y ++SY   +  A+     +++  G     F
Sbjct: 529 HWICPTIAGSFIGFGLIGIFLPCLNYIIESYLFIAASAVAANTFMRSTFGAVFPLF 584

>Suva_10.43 Chr10 (89159..90922) [1764 bp, 587 aa] {ON} YLL028W
           (REAL)
          Length = 587

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 98/470 (20%), Positives = 176/470 (37%), Gaps = 77/470 (16%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NWP+ ++ +    +   C      +S+ AS   ++     V   ++  ++G  +  LG
Sbjct: 138 PFNWPMKKKVLLCFVLCLDCIAIAMCSSIFASAVPQICEIYHV--IEVVAILGITLFVLG 195

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  I  +P + L+G++ V ++    F +     A + +   + I R   GF  +   +
Sbjct: 196 FAASPIIYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTIFICRFFGGFIGAAPMA 255

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A  A+++  + R   + ++               S + +  +  WL +++   A   
Sbjct: 256 VVPAAFADMFDTNVRGKAIALFALGVFVGPILAPVMGSYIAQRTTWRWLEYVVGCFASLV 315

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           FVL  LF  ET    T + NK        A+Q+R  S N  I             A H  
Sbjct: 316 FVLIALFFEETH-HPTILVNK--------AKQMRKQSNNWGI------------HAAH-- 352

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
                                     IK I +K +                     RP V
Sbjct: 353 --------------------EDVELSIKDIVQKTVT--------------------RPIV 372

Query: 404 -LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL-GS 461
            LF  P +LF     ++    L ++ +     + + YGF+     L YIA  IG  +  +
Sbjct: 373 MLFVEPLLLFVTIYNSFVYGILYLLLEAYPLVFVEGYGFTENG-ELPYIALIIGMVVCAA 431

Query: 462 LIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWIIP 519
            I    +D   R  A    G   PE RL+ ++ A     IG+L F W+     + HW++P
Sbjct: 432 FIWYMDNDYLRRCKA---KGGLVPEARLYAMIIAGTIFPIGILWFCWTGYYPHKIHWMVP 488

Query: 520 SIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSF 569
           ++    +GFG        + Y ++SY   +  A+     +++  GF   F
Sbjct: 489 TVGGSFIGFGLMGIFLPCLNYIIESYLPLAASAVAANTFMRS--GFGACF 536

>CAGL0H06039g Chr8 complement(592526..594295) [1770 bp, 589 aa] {ON}
           similar to uniprot|P38124 Saccharomyces cerevisiae
           YBR008c FLR1
          Length = 589

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 86/430 (20%), Positives = 166/430 (38%), Gaps = 86/430 (20%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
           + P NW   ++   +V +     +    +S+   G  ++  E  V      ++VG + LS
Sbjct: 132 RKPWNWSFSKKTFVIVQLMVLTCINYMGSSIYTPGQEQIQHEFHV-----GHVVGTLNLS 186

Query: 164 L-----GVGSIFASPTAVL--FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF 216
           +      +G I  SP + +   G+  +YL   ++F I  + CA   +   L+I R ++G 
Sbjct: 187 MYVLGYAIGPIIFSPLSEVSSIGRMPLYLWTFILFTILQVACALVRNIAGLVILRFITGI 246

Query: 217 GLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWIL 276
             S V +   A++ ++ F       LG +               + +       W+FW++
Sbjct: 247 LCSPVLATGGASVGDVCFPRYVPRFLGAWAVGAVAAPVMAPILGAAMVVAKDWRWIFWLM 306

Query: 277 TIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPR 336
             + G+  +  + F PET        ++  LH  R A+++R L+ +    T +  +    
Sbjct: 307 LFMCGATLLSIIFFFPET-------SHECILH--RRAKRLRKLTGDDRYYTKKEKQ---- 353

Query: 337 ESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCM 396
                  ++ +PV +                  IK+   + +                 M
Sbjct: 354 -------EEALPVSV-----------------FIKNTLWRPIK----------------M 373

Query: 397 VMLRPFVLF--SYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPF 454
           + L P +L    Y A+ +GA+   +    ++         +  IY F+   VGL ++  F
Sbjct: 374 IALEPIILAFDVYIALCYGAFYLFFEAFPIV---------FAGIYHFTLVEVGLAFLG-F 423

Query: 455 IGGCL---GSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLE 511
             GC+    +LI  +   +  + L     G + PE  L + +    C    L  FGW+  
Sbjct: 424 CVGCVFAYTALIIFQEKVIRKKFL----EGKFRPELFLILAMCLGWCLPFSLFFFGWT-- 477

Query: 512 RQDHWIIPSI 521
            + HWI+P I
Sbjct: 478 ARIHWILPII 487

>CAGL0L10912g Chr12 complement(1167086..1169041) [1956 bp, 651 aa]
           {ON} similar to uniprot|Q12256 Saccharomyces cerevisiae
           YOR273c
          Length = 651

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 85/192 (44%), Gaps = 6/192 (3%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NWP W++  A +   + C      +S+  SG  +L A+  V  +Q   L G     L
Sbjct: 76  NPHNWPSWKKWYATMVAAFLCLAVTMNSSLYVSGVPELVAKYHV--NQTLALAGLTFYLL 133

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTS-FNWLLISRVVSGFGLSTVES 223
           G+ ++  +P + +FG++ +YL  + I M+ ++G   S      +L  R  +GF  S   S
Sbjct: 134 GLANVIGAPLSEVFGRKPIYLFSLPISMLFTMGVGLSGGHMRTILPLRFFAGFFASPCLS 193

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + S TI +++   E +  +  ++                  E  S  +  WI   +  S 
Sbjct: 194 VGSGTILDVFDVDEVSVAMTFFSLAPFLGPVISPIIAGFAVEERSWRYTQWIQ--LWASG 251

Query: 284 FVLHLL-FVPET 294
            +L L+  +PET
Sbjct: 252 LILPLIAIMPET 263

>Skud_3.178 Chr3 complement(290523..291692) [1170 bp, 389 aa] {ON}
           YBR008C (REAL)
          Length = 389

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/232 (19%), Positives = 101/232 (43%), Gaps = 9/232 (3%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NW   ++   +  V +   V    +S+   G   + ++ +V     +  +   +L  G
Sbjct: 58  PHNWSNLKKGFVMFEVLFLTCVTYMGSSIYTPGQQAIQSQFKVGHVVATLNLSIYVLGYG 117

Query: 166 VGSIFASPTA--VLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
           +G IF +P +     G++ +Y++ + +F++  IGCA   +   L++ R +SG   S   S
Sbjct: 118 IGPIFLAPFSEFATIGRQTIYIITLFVFIMFQIGCATVDNVGGLIVMRFISGVLSSPALS 177

Query: 224 LPSATIAEIYFAHERA-YRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGS 282
             +A+I ++    ++    +G+++              + +       ++FW+LT +A +
Sbjct: 178 TGAASIGDVISDEKKVPLVIGLWSIGAVLAPIVAPLLGASMMVAKGWRYIFWLLTWMATA 237

Query: 283 NFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLN 334
           N V+   F+PET  D             R  +++ G+    ++      RL+
Sbjct: 238 NLVMLFFFLPETLADNV------LYRRCRRIKKMTGIDAYCTLKQQDEERLD 283

>Kpol_1044.21 s1044 (47355..49118) [1764 bp, 587 aa] {ON}
           (47355..49118) [1764 nt, 588 aa]
          Length = 587

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 103/471 (21%), Positives = 172/471 (36%), Gaps = 75/471 (15%)

Query: 102 CKKD----PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLV 157
           C KD    P NW +  R      +G         +S    G  +++ E  V   Q + ++
Sbjct: 128 CGKDDPLHPFNWSLKLRIFICFILGLDVINVAVASSNFVFGVPQITEEYHV--GQDTAML 185

Query: 158 GPMMLSLGVG--SIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSG 215
           G  +  LG     I  +P + ++G+++V LV      +     A       LLI R   G
Sbjct: 186 GVTLFVLGFAGAPIIYAPLSEIYGRQMVILVSAFGTAVFQFAVATGKDIQTLLICRFFGG 245

Query: 216 FGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWI 275
              S    +  A  A+++    RA  + +++              + + +H +  WL +I
Sbjct: 246 LVGSAPFVVVPAMFADLFDTDIRAKAVCLFSLGTLAGPVMTPIFGTYITQHTTWRWLDYI 305

Query: 276 LTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNP 335
             + A   FVL L+F+ ET      V   + + +      +    ENV + T+R      
Sbjct: 306 QGMFASLVFVLLLIFLKETHHPTILVKKAKMMRKKSNNWGIHAAQENVEL-TMRDVI--- 361

Query: 336 RESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWC 395
                HVN                      TR      +E  +A+ L  Y      D++C
Sbjct: 362 -----HVN---------------------FTRPLKMLFTEPVIAM-LTFY------DSYC 388

Query: 396 MVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFI 455
                                  Y ++ L++ +Q I   Y + YGF+     L  I+  +
Sbjct: 389 -----------------------YGILYLLLEAQPI--IYVEGYGFNRNG-ALPSISVIV 422

Query: 456 GGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQD- 514
           G  + ++    G   N  + AA   G   PE RL  V+       IG+L   W+    D 
Sbjct: 423 GMIICTVYVWVGD--NRYIKAAEKKGKLLPELRLREVITCSFAMPIGVLWLTWTGHYHDR 480

Query: 515 -HWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILG 564
            HWI+P I    +GFG        + Y ++SY   +  AL     ++ I G
Sbjct: 481 IHWIVPVIADAFVGFGLLGSLLQCVNYLIESYFYLAASALAANTFMRAIFG 531

>Kpol_1018.193 s1018
           (487656..487952,487955..487999,488002..489165,
           489169..489309) [1647 bp, 548 aa] {ON}
           (487656..487952,487955..487999,488002..489165,
           489169..489309) [1647 nt, 549 aa]
          Length = 548

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 94/430 (21%), Positives = 166/430 (38%), Gaps = 89/430 (20%)

Query: 105 DPLNWPIWRR----DIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPM 160
           +PLN  I+++    DI+   +  + ++G   +S+   G      E  V     +  +   
Sbjct: 96  NPLN--IYKQKSTNDISNNVIQLYTYMG---SSIYTPGQEDFQKEFHVGHIAATLNLSIY 150

Query: 161 MLSLGVGSIFASPTA--VLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGL 218
           +L  G+G +  SP +  V  G + +Y++ +  F I  IG A   +F  +++   +SG   
Sbjct: 151 VLGYGLGPLILSPLSEFVTLGCQQIYIITLFCFCILQIGAATVKNFGRMIVILFLSGVFC 210

Query: 219 STVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTI 278
           S   +   ATIA+I       Y LG+++                + E     W+FW+L  
Sbjct: 211 SPALTTGGATIADIVKPEVVPYFLGLWSVRAIAAPVLAPLLGVAILEAKGGRWIFWLLLW 270

Query: 279 IAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRES 338
           +  +  ++ + F PET                          +  +I   R+ RL  R+S
Sbjct: 271 MCAATLMILIFFFPET--------------------------QQGNILVRRTRRL--RKS 302

Query: 339 AGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVM 398
            G              +  Q+ E      A + S   K + I                ++
Sbjct: 303 TGDKR---------YYTKEQKKEEQLNLTAFMLSAIYKPVKI----------------II 337

Query: 399 LRPFVL-FS-YPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIG 456
             P VL F  Y A+ +G +   +    L+ +          IY F+   +GL ++  +  
Sbjct: 338 KEPIVLAFDLYLAVCYGVFYLFFEAFPLVFVG---------IYNFTPVELGLGFMG-YQV 387

Query: 457 GCLGS---LIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNA--IGLLGFGWSLE 511
           GC+ S    I      +N R     +   ++PE   FM+LP ++C A  + L  FGW+  
Sbjct: 388 GCIISYPIFIVFLVKYLNPRF----SDNTFKPE--DFMILPMLVCWALPLSLFLFGWT-- 439

Query: 512 RQDHWIIPSI 521
              HWI+P I
Sbjct: 440 AGVHWILPII 449

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 75/167 (44%), Gaps = 10/167 (5%)

Query: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC 200
           +L  +  +  + ++  V   +L  G+        A ++G+R V L G+L++++ SI  AC
Sbjct: 128 QLEKQFDIDENLVNVTVVVYLLFQGISPTVCGGLADIYGRRPVILFGMLVYIVASIALAC 187

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXX 260
           + S+  ++  R +   G+S + ++ S  + +     ER    G +               
Sbjct: 188 ANSYGVIIFLRCLQSCGISPIIAISSGCVGDFTMKAER----GTFVGAVSGLVLLGQAFG 243

Query: 261 SLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPETFWDRTPVPN 303
           SL+   L+  W    +FW L I AG    + +L +PET   RT V N
Sbjct: 244 SLIGAALAAAWDWRAIFWFLAIGAGCCLFVGILVLPET--KRTIVGN 288

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 78/181 (43%), Gaps = 23/181 (12%)

Query: 398 MLRPFVLFSYPAILF----GAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAP 453
           +L PF +   P I+     G   +A   +  +++S +      + Y +    +G+ Y+  
Sbjct: 331 LLAPFTIICQPEIVLSLLPGGLQFA---LWTLMLSSISSELAIEPYNYKLIIIGVCYLPA 387

Query: 454 FIGGCLGSLIAGRGSDV----NTRLLAAHNHGIYEPEFRLFMV-----LPAVLCNAIGLL 504
            +GG LGSLI GR  D+    + +   A       PE + F +     LPA+  N I + 
Sbjct: 388 GMGGLLGSLITGRVIDIYYKKSLKKFDAMKEAKEIPEDKQFNIFKARLLPALPQNFIAVA 447

Query: 505 G---FGWSLER--QDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMV 559
               FGW +++  +   I+   FFG   + +    +T+ T  VD Y   S  A    N +
Sbjct: 448 AFILFGWCVDKGLKVESILIVSFFG--SYCAMSTLSTSSTLLVDLYPGKSSTATSCFNFI 505

Query: 560 K 560
           +
Sbjct: 506 R 506

>NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {ON}
           Anc_5.284
          Length = 516

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 93/217 (42%), Gaps = 12/217 (5%)

Query: 400 RPFVLFSYPAILFGAWLYAYAVVSLIIISQV-IDHAYKDIYGFSSASVGLVYIAPFIGGC 458
           RPF+L     ++     Y   V++++ +  V   + +K +YGF    +   Y+   +G  
Sbjct: 298 RPFLLLFLDPMMGVLCFYTGLVLAIVYLYFVAFPYIFKKLYGFGVMQIACCYLGMMVGMT 357

Query: 459 LG---SLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDH 515
           L    SLI  +  ++N       N+ I  PE R   +     C  IGL+ F W+  +  H
Sbjct: 358 LAAPTSLIFQKRYEMN----VIKNNNIRTPEMRFEPLFYGAFCCPIGLMIFAWTCYQNVH 413

Query: 516 WIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFC 575
           W+ P I   + G G          Y VD+Y+ ++   +   + V++ +      F ++  
Sbjct: 414 WMGPMIGSAIFGSGVFFVFVGVFNYTVDAYRRYAASGMACNSFVRSTMSGIFPLFGLQ-- 471

Query: 576 LHEGYKNAFTCYALIEIFIGLWAIPLY--RWGKLCRS 610
           +++G    +  + L  + I +  +P    ++G   RS
Sbjct: 472 MYKGMGINWAGFLLAMVTILMIPVPFLFTKYGAYLRS 508

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 61/135 (45%), Gaps = 1/135 (0%)

Query: 161 MLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLST 220
           +  LG G +F SP + L+G+RL ++  + + +I       S +   ++  R +SGF  S 
Sbjct: 121 IFGLGFGPLFLSPISELYGRRLTFIFSMTLSIIWQCLTTWSHNVVGMMFGRFLSGFFGSA 180

Query: 221 VESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIA 280
             S+   +I++I+        + +YT                ++   +  W+F  L I +
Sbjct: 181 FLSIAGGSISDIFDKATITIPMSLYTLSCFYGPVLGPIVSGALYRE-NYRWVFATLLIAS 239

Query: 281 GSNFVLHLLFVPETF 295
           G   VL +  +PET+
Sbjct: 240 GVCLVLIIFTIPETY 254

>ZYRO0E09966g Chr5 (793128..794813) [1686 bp, 561 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 561

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 115/559 (20%), Positives = 216/559 (38%), Gaps = 100/559 (17%)

Query: 76  GQESGGSDD--HLKKTKKGI---ILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGG 130
           G  SGG  +   LK  K      ++  + ++    P NW  +++ + ++ +     V   
Sbjct: 73  GSVSGGDGNSGELKDGKDATDPYLVQFRGTKDPDHPHNWLGFKKFVVILEIMLLTCVTYM 132

Query: 131 QTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL-----GVGSIFASPTA--VLFGKRLV 183
            +++   G  ++  E  V      ++VG + LS+     G+G +  SP +   ++G++ +
Sbjct: 133 GSAIYTPGQEEIQKEFGV-----GHVVGTLNLSMYVLGYGLGPMVFSPLSEFAMYGRQQL 187

Query: 184 YLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLG 243
           Y++ + +F +  IGCA   +   L+I R ++G   S   +  +A+I +I         +G
Sbjct: 188 YIITLFLFSMLQIGCALVHNIAGLVILRFITGILCSPSLATGAASIGDIVKPELVPVFIG 247

Query: 244 IYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPN 303
           +++              + +    +  W+FW+L  ++ +  +L + F PET  D   +  
Sbjct: 248 MWSIGAVAAPVTGPLLGASMVVAKNWRWIFWLLMWMSAALLILLVFFFPETGEDN--ILY 305

Query: 304 KRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETG 363
           +R +   RI R++ G          R      RE A     D   V L            
Sbjct: 306 RRCM---RI-RKITGDD--------RYYTFKAREEAKLTFKDIAVVALYRP--------- 344

Query: 364 SKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVS 423
                  + I ++ + + L IY                       A+ +G +   +    
Sbjct: 345 ------FEIIVKEPIVLALDIYI----------------------ALCYGTFYLFFEAFP 376

Query: 424 LIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHN--HG 481
           ++         +  +Y F+   +GL Y    +G C+G + A   S +     AA      
Sbjct: 377 IV---------FAGVYHFTLIELGLAY----MGFCVGCVFAYAISLIFLTQYAARQAKKN 423

Query: 482 IYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP---SIFFGVLGFGSSMCSTTAI 538
            + PE  L + +    C  + L  FGW+     HW +P    IFF +  F     +    
Sbjct: 424 KFTPETFLVLAMGVCWCLPLALFLFGWA--ASVHWTLPMLAEIFFVICVFNLFQAT---F 478

Query: 539 TYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHE-----GYKNAFTCYALIEIF 593
            Y   SY ++         +++   GFA +F      +++     GY  A+    L    
Sbjct: 479 AYLAMSYPKYMASVFAGNGVMRA--GFACAFPLFGKAMYDNLAIKGYPVAWGSSLLGFFS 536

Query: 594 IGLWAIP--LYRWGKLCRS 610
           IGL AIP  LY++G   RS
Sbjct: 537 IGLAAIPFLLYKYGPYLRS 555

>TPHA0K02160 Chr11 complement(461256..463082) [1827 bp, 608 aa] {ON}
           Anc_4.30 YLL028W
          Length = 608

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 110/514 (21%), Positives = 200/514 (38%), Gaps = 80/514 (15%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISY--LVGPMMLS 163
           P NW + R+ + + C+   C +     SM +S F+    ++      I    ++G  +  
Sbjct: 158 PFNWKM-RKKVMICCI--LC-LDSLSVSMASSIFASSIPDIDEIYGVIDVVAILGVTLFV 213

Query: 164 LGVG--SIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF-GLST 220
           LG     I  +P + LFG++ V L+      +     A + +   +LI R  +G  G + 
Sbjct: 214 LGFAFSPIIFAPLSELFGRQKVILISSFGNALFQYAVATAANLQTILICRFFAGLIGAAP 273

Query: 221 VESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIA 280
           +  +P A  A+I+  + R   + +++              S + +H +  W  ++++ + 
Sbjct: 274 IAVVP-AVFADIFDTNIRGKAIALFSLGVFIGPILGPIIGSYIVQHTTWRWTEYVISFL- 331

Query: 281 GSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAG 340
            S FV  L+ +   F + T  P    +     A+++R  + N  I               
Sbjct: 332 -STFVTLLILL---FLEETHHP----IILVNKAKKLRKETNNWGI--------------- 368

Query: 341 HVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLR 400
           H + + V      E    E  T   TR  +  + E  + + + IY+              
Sbjct: 369 HASHENV------ELTIDEIITNMITRPLVMLVKEPVLLV-VSIYNS------------- 408

Query: 401 PFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLG 460
                           + Y ++ L++ +  I   +   YGF+     L Y+A  IG  L 
Sbjct: 409 ----------------FVYGILYLLLEAYPI--VFIQGYGFTKNG-ELPYLALIIGMILC 449

Query: 461 SLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWII 518
           +      SD++       N G   PE RLF ++ A +   IGLL F W+       HWI+
Sbjct: 450 TAFIWY-SDIDYLKRVEQNQGHVVPEARLFPMIVAGILFPIGLLWFTWTGNYYTSIHWIV 508

Query: 519 PSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHE 578
           P+I    +GFG        + Y ++SY   +  A+     +++   F  SF      + +
Sbjct: 509 PTIAGSFIGFGLIGIFLPCLNYIIESYLYLTASAVAANTFLRS--AFGASFPLFAGYMFK 566

Query: 579 GYKNAFTCYALIEIFIGLWAIPLY--RWGKLCRS 610
           G    F    L  + I L  +PL+  R+GK  R 
Sbjct: 567 GMGVNFAGLLLGLVAIVLIPVPLFLLRYGKAIRE 600

>NDAI0A07730 Chr1 complement(1777435..1779102) [1668 bp, 555 aa]
           {ON} 
          Length = 555

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 96/485 (19%), Positives = 173/485 (35%), Gaps = 80/485 (16%)

Query: 75  KGQES--GGSDD-----HLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFV 127
           K  ES  G +DD      L++     ++     E   +P NW   ++ I +  V     V
Sbjct: 64  KSNESSNGSTDDSTGNIKLEEKDDPYLVGWNGPEDPDNPQNWSTLKKTIVIFNVMLLTAV 123

Query: 128 GGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVL--FGKRLVYL 185
               +S+   G  ++  E  V     +  +   +L  G+G I  SP   +   G++  Y 
Sbjct: 124 TYMGSSIYTPGEEQIRKEFHVGHVVATLNLSLYVLGYGLGPIVFSPLTEIAKIGRQQTYT 183

Query: 186 VGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIY 245
           +    F I  IG A   +   L++ R  +G   S   +  +ATIA++         L I+
Sbjct: 184 LTFFCFTILQIGAATVHNIGGLIVIRFFTGIFCSPALATGAATIADVVSPEIVPIFLAIW 243

Query: 246 TXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKR 305
           +              + +       W+FW+L  ++ +  ++   F PET           
Sbjct: 244 SIGAMVAPIIGPLLGATMVISKGWRWIFWLLLWMSAATLIILTFFFPET----------- 292

Query: 306 SLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSK 365
                         S N +I + R++R+  R   G  +   V   L  ++  +     + 
Sbjct: 293 --------------SAN-NILSRRASRI--RNKTGDKSYYTVQEKLDSDTTTERFLINTF 335

Query: 366 TRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLI 425
            R   K I+++ M + L +Y                       A+ +GA+   +    ++
Sbjct: 336 YRP-FKLIAKEPMILVLDVYL----------------------ALCYGAFYLFFEAFPIV 372

Query: 426 IISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLG--SLIAGRGSDVNTRLLAAHNHGIY 483
            +          IY F+    GL Y    +G C+   +L+      V  R      +  +
Sbjct: 373 FVG---------IYHFTLIETGLAYFGFCVGCCIAFPALMVFLHKVVRPRF----ENNTF 419

Query: 484 EPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP---SIFFGVLGFGSSMCSTTAITY 540
            PE  L + +         L  FGW+     HWI+P    IFF +  F    C+ + +  
Sbjct: 420 TPEVFLILAMCVSWSLPTSLFLFGWA--ASTHWIVPIIAQIFFVLCVFNLFQCTFSYLAM 477

Query: 541 AVDSY 545
           A   Y
Sbjct: 478 AYPKY 482

>Smik_2.128 Chr2 complement(240029..241672) [1644 bp, 547 aa] {ON}
           YBR008C (REAL)
          Length = 547

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 94/212 (44%), Gaps = 3/212 (1%)

Query: 85  HLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSA 144
            ++K+   ++    PS+  ++P NW + ++ + +  V     V    +S+   G   +  
Sbjct: 74  QIEKSDPFLVYWNGPSD-AENPQNWSVPKKSLVIFQVMLLTCVTYMGSSIYTPGQEYIQE 132

Query: 145 ELQVPLSQISYLVGPMMLSLGVGSIFASPTAVL--FGKRLVYLVGILIFMIGSIGCACST 202
           E  V     +  +   +L  G+G I  SP + +  +G+  +Y+V +  FMI  +GCA   
Sbjct: 133 EFHVGHVVATLNLSLYVLGYGLGPIIFSPLSEIARYGRLYLYMVTLFFFMIFQVGCATVH 192

Query: 203 SFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSL 262
           +   L++ R +SG   S   +    T+A+I         LG+++              + 
Sbjct: 193 NIGGLIVMRFISGILCSPSLATGGGTVADIISPEMVPLILGMWSAGAVAAPVLAPLLGAA 252

Query: 263 VFEHLSTHWLFWILTIIAGSNFVLHLLFVPET 294
           + +  +  ++FW+L  ++ + F+L     PET
Sbjct: 253 MVDAKNWRFIFWLLMWLSAATFILLAFLFPET 284

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 93/223 (41%), Gaps = 18/223 (8%)

Query: 398 MLRPF-VLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIG 456
           + RPF ++   PAIL      A A     +  +     +  +Y FS   VGL Y    +G
Sbjct: 327 LYRPFKMIIKEPAILAFDLYIAVAYGCFYLFFEAFPIVFIGVYHFSLIEVGLAY----MG 382

Query: 457 GCLGSLIA-GRGSDVNTRLLAAH-NHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQD 514
            C+G + A G  + +N R++     +G + PE  L + +       + L  FGW+   + 
Sbjct: 383 FCVGCVFAYGLFAFLNIRIIVPRFKNGTFTPEAFLIVAMCVCWSLPLSLFLFGWT--ARV 440

Query: 515 HWIIPSI--FFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNV 572
           HWI+P I   F VL   +   +T A  Y    Y ++           +     A   F  
Sbjct: 441 HWILPVISEVFFVLAVFNIFQATFA--YLATCYPKYVASVFAGNGFCRASFACAFPLFGK 498

Query: 573 KFCLHEGYKNAFTCY--ALIEIF-IGLWAIP--LYRWGKLCRS 610
               +   KN    +  +L+  F +GL  IP  LY++G L RS
Sbjct: 499 AMYDNLATKNYPVAWGSSLVGFFTLGLAIIPFILYKYGPLLRS 541

>TBLA0C07220 Chr3 (1750032..1751870) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 104/247 (42%), Gaps = 30/247 (12%)

Query: 104 KDPLNWPIWRR------DIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLV 157
            +P+NW    +       + L CV +        +++   G  ++  E  V      ++V
Sbjct: 157 DNPMNWSFAMKFFMTFQIMTLTCVTYM------GSTIHTPGQEQIQEEFHV-----GHVV 205

Query: 158 GPMMLSL-----GVGSIFASPTAVL--FGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS 210
           G + LS+     GVG +F SP +     G++ +Y++  +IF +  +GCA   +   L+I 
Sbjct: 206 GTLNLSVYVLGYGVGPMFFSPLSEFARLGRQQIYILTFMIFGLFQVGCALVDNIYGLIIL 265

Query: 211 RVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTH 270
           R  SG   S   +   AT+A+     +  Y LG++               + + + +   
Sbjct: 266 RFFSGVVSSPALTTGGATLADYINEEKLTYFLGLWAIAAFAAPIIGPIVGAAMVDAVDWR 325

Query: 271 WLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRS 330
           W FW+L  + G+  ++   F PET      +  +R+L      R++ G     +I +   
Sbjct: 326 WQFWLLLFVTGACLLVLAPFFPET--QAENILFRRALR----LRKITGDKRYYTIESEEE 379

Query: 331 TRLNPRE 337
            +L  +E
Sbjct: 380 KKLTTKE 386

>Skud_15.438 Chr15 complement(773226..775205) [1980 bp, 659 aa] {ON}
           YOR273C (REAL)
          Length = 659

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 113/574 (19%), Positives = 205/574 (35%), Gaps = 111/574 (19%)

Query: 74  MKGQESGGSDDHLKKTKKGIILNPQP-----SECKKDPLNWPIWRRDIALVCVGWHCFVG 128
           ++ ++   S+     T  G  ++P+       +   +P NWP W++  A +   + C V 
Sbjct: 46  IEDEKRSNSNGDSSDTTNGEPVDPKDLDWDGPDDPDNPHNWPSWKKWYATMISAFLCLVV 105

Query: 129 GGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGI 188
              +S+  S   +L A   V  +Q   L G     LG+ ++  +P + +FG++ +YL  +
Sbjct: 106 TMGSSLYVSSVPELVARYHV--NQTLALAGLTFYLLGLSTVIGAPLSEVFGRKPIYLFSL 163

Query: 189 LIFMIGSIGCACSTSFNWLLIS-RVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTX 247
            + M+ ++G   S     +++  R +SG   S   S+ S TI +I+   + +  +  +  
Sbjct: 164 PLSMLFTMGVGLSNGHMRIILPLRFLSGVFASPALSVGSGTILDIFDVDQVSVAMTYFVL 223

Query: 248 XXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSL 307
                            +     W  WI  +IAG   +  +  +PET             
Sbjct: 224 SPFLGPVLSPIMAGFATQAEGWRWSEWI-QLIAGGIILPFIAVMPET------------- 269

Query: 308 HETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTR 367
           H+  I R+ R    N+ +   + TR + +E                           KT 
Sbjct: 270 HKGIILRK-RAKKRNMVLK--KFTRKDQKEFL-------------------------KTT 301

Query: 368 AHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIII 427
             +  +   +M +   I           + +   +V F + AILFG +  AYAV+     
Sbjct: 302 VTVTILRPMKMLVAEPI-----------VFVFSVYVAFIF-AILFG-FFEAYAVI----- 343

Query: 428 SQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIA---------------------GR 466
                  Y+ +Y  S    GL    PFIG  +G  IA                       
Sbjct: 344 -------YRGVYHMSIGVSGL----PFIGIGVGLWIAAFFYLYIDRKYLFPKPPSGTPAL 392

Query: 467 GSDVNTRLLAAHNHGIYEPEF-RLFMVLPA---VLCN------AIGLLGFGWSLERQDHW 516
             +  T    A   G  +P   +L  ++P    + C        IGL    W+     HW
Sbjct: 393 EENERTSKRTAPYRGARDPNTGKLLPIVPEKFLIACKFGSVALPIGLFWQAWTARPDVHW 452

Query: 517 IIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFS-QEALVTLNMVKNILGFAVSFFNVKFC 575
           + P       GFG  +   + + Y    Y   +    L   N+++ ++      F ++  
Sbjct: 453 MAPVAAGVPFGFGLILIFFSVLMYFSTCYPPLTVASCLAANNLLRYVMSSVFPLFTIQMY 512

Query: 576 LHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCR 609
                K A T +AL+ + +        +WG   R
Sbjct: 513 TKMKIKWASTLFALLCVVMIPIPWIFEKWGSKLR 546

>Smik_15.455 Chr15 complement(784048..786027) [1980 bp, 659 aa] {ON}
           YOR273C (REAL)
          Length = 659

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 84/191 (43%), Gaps = 4/191 (2%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NWP W++  A +   + C V    +S+  S   +L A+  V  +Q   L G     L
Sbjct: 82  NPHNWPSWKKWYATMTSAFLCLVVTMGSSLYVSSVPELVAKYHV--NQTLALAGLTFYLL 139

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS-RVVSGFGLSTVES 223
           G+ ++  +P + +FG++ +YL  + I M+ ++G   S     +++  R +SG   S   S
Sbjct: 140 GLSTVIGAPLSEVFGRKPIYLFSLPISMLFTMGVGLSNGHMRIILPLRFLSGVFASPALS 199

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + S TI +I+   + +  +  +                   +     W  WI  +IAG  
Sbjct: 200 VGSGTILDIFDVDQVSVAMTYFVLSPFLGPVLSPIMAGFATQAKGWRWSEWI-QLIAGGL 258

Query: 284 FVLHLLFVPET 294
            +  +  +PET
Sbjct: 259 ILPFIALMPET 269

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 80/233 (34%), Gaps = 49/233 (21%)

Query: 409 AILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAG--- 465
           AILFG +  AYAV+            Y+ +Y  S    GL    PFIG  +G  IA    
Sbjct: 331 AILFG-FFEAYAVI------------YRGVYHMSMGVSGL----PFIGIGVGLWIAAFFY 373

Query: 466 ------------------RGSDVNTRLLAAHNHGIYEPEF-RLFMVLPA---VLCN---- 499
                                D  T    A   G  +P   +L  V+P    + C     
Sbjct: 374 LYLDRKYLFPKAPAGTPPLSEDERTSKRTAPYRGARDPNTGKLLPVVPEKFLIACKFGSV 433

Query: 500 --AIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFS-QEALVTL 556
              IGL    W+     HW+ P       GFG  +   + + Y    Y   +    L   
Sbjct: 434 ALPIGLFWQAWTARPDVHWMAPVAAGVPFGFGLILIFFSVLMYFSTCYPPLTVASCLAAN 493

Query: 557 NMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCR 609
           N+++ ++      F ++       K A T +AL+ + +        +WG   R
Sbjct: 494 NLLRYVMSSVFPLFTIQMYTKMKIKWASTLFALLCVVMIPIPWVFEKWGSKLR 546

>TDEL0A06670 Chr1 complement(1163596..1165473) [1878 bp, 625 aa]
           {ON} Anc_8.723 YOR273C
          Length = 625

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 85/192 (44%), Gaps = 4/192 (2%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
           ++P NWP W++    + V   C V    +S+  SG  ++   L+   +Q   + G     
Sbjct: 62  ENPHNWPSWKKWYTTMTVAMLCLVVTMGSSLYVSGVPEMV--LRYKYNQTLAISGLTFYL 119

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS-RVVSGFGLSTVE 222
           LG+ ++  +P + +FG++ VYL  + I M+ ++G   S     +++  R +SG   S   
Sbjct: 120 LGLSTVIGAPLSEVFGRKPVYLFSLPISMLFTMGVGLSNGHMRIVLPLRFLSGAFASPAL 179

Query: 223 SLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGS 282
           S+ S TI +I+   + +  +  +               S   E     W  WI  +IAG 
Sbjct: 180 SVGSGTIMDIFDMDQVSVAMTFFCVAPFLGPVISPIMGSFATEKQGWRWSQWI-QLIAGG 238

Query: 283 NFVLHLLFVPET 294
             +  +  +PET
Sbjct: 239 LILPFIAIMPET 250

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 83/395 (21%), Positives = 154/395 (38%), Gaps = 85/395 (21%)

Query: 160 MMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLS 219
           ++L  GVG +  +P + L+G+R+ Y   + ++++ +I CA + +   LL+ R + G   S
Sbjct: 196 VVLGYGVGQLVWAPLSDLYGRRITYFTSLFLYVVFNIPCAVAPNIQTLLVCRFICGVLSS 255

Query: 220 TVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST-HWLFWILTI 278
           +   L   ++A+++ A  R   +  +                 +         +FW+   
Sbjct: 256 SGLCLVGGSLADMFPADLRGLTIAFFAFAPYGGPVFAPLINGFIAVRTERLDLIFWVNMA 315

Query: 279 IAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRES 338
           +AG+ ++L  L VPET+    P+  KR       A ++R L+ N +I T           
Sbjct: 316 LAGAVWLLVAL-VPETY---APIILKRR------AEKLRKLTGNQNIMT----------- 354

Query: 339 AGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVM 398
                              QEA+ G    A +++                         +
Sbjct: 355 ------------------EQEAQ-GLSLSAMVQT------------------------CL 371

Query: 399 LRP-FVLFSYPAI--------LFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLV 449
           LRP + +F+ P +        L  + LYA+     +I S+        +YG+    +GL+
Sbjct: 372 LRPLYFIFTEPVLDLMCFYVCLIYSLLYAFFCAYPVIFSE--------LYGYKDDKIGLM 423

Query: 450 YIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS 509
           ++   IG  L +L      +   R LAA    +  PE RL   +     +AI L   G +
Sbjct: 424 FLPIIIGASL-ALATTYWCEKKYRELAARRPCV--PEDRLLGAMIGAPFSAIALWILGAT 480

Query: 510 LERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDS 544
             +   W+ P+      G+G  M   +   Y +D+
Sbjct: 481 SYKHIIWVGPASSGLAFGYGMVMVYYSLNNYIIDT 515

>KLTH0E00528g Chr5 complement(54185..55843) [1659 bp, 552 aa] {ON}
           similar to uniprot|P38124 Saccharomyces cerevisiae
           YBR008C FLR1 Plasma membrane multidrug transporter
           member of the major facilitator superfamily involved in
           efflux of fluconazole diazaborine benomyl methotrexate
           and other drugs
          Length = 552

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 97/436 (22%), Positives = 174/436 (39%), Gaps = 89/436 (20%)

Query: 99  PSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVG 158
           P +C+ +PLNW   ++      V +   +    T M AS ++     +Q     + ++VG
Sbjct: 93  PKDCE-NPLNWSRLKKGF----VVFQVMLLTCATYMGASIYTPGQEYIQHEFG-VGHVVG 146

Query: 159 PMMLSL-----GVGSIFASPTAVL--FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISR 211
            + LSL     G+G I  SP + +   G++ +Y+V +  FM+  +G A   +   LL+ R
Sbjct: 147 TLNLSLYVLGYGLGPIVFSPLSEVASVGRQQIYIVTLFFFMLFQVGAATVKNIGGLLVIR 206

Query: 212 VVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW 271
            +SG   S   +    T+ +I      +  +G++               + + +     +
Sbjct: 207 FISGVLCSPSLATGGGTMGDIIKPEIVSVFIGLWAIGAVAAPVVAPLLGAAMVQAKGWRY 266

Query: 272 LFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRST 331
            FW+L  I+ +  +L ++F PET        ++  LH  R A +VR  + ++   T R  
Sbjct: 267 DFWLLMWISAATLILLVVFFPET-------QHQNILH--RHAVRVRKETGDLRYYT-RQE 316

Query: 332 RLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTI 391
           R++                                 A IK+ S          +     +
Sbjct: 317 RVD---------------------------------AEIKATS----------FMKELFV 333

Query: 392 DNWCMVMLRPFVLFS--YPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLV 449
             + ++ L P VL    Y A+ +GA+   +    L+ I          IY F+   +GL 
Sbjct: 334 RPFLIMALEPAVLAFDIYIAVCYGAFYLFFEAFPLVFIG---------IYNFTLVEMGLA 384

Query: 450 YIAPFIGGCLGSLIAGRGSDV--NTRLLAAHNHGIYEPEFRLFMVLPAVLCNA--IGLLG 505
               F+G C+G L+A     V     +     +  + PE   F+ L   +C A  + L  
Sbjct: 385 ----FLGFCIGCLLAYAALLVYLAKYIGPKFKNNTFTPE--DFLPLSMAVCWALPLSLFM 438

Query: 506 FGWSLERQDHWIIPSI 521
           FGW+   + HWI+P I
Sbjct: 439 FGWT--ARVHWILPII 452

>KAFR0F04390 Chr6 (860978..862681) [1704 bp, 567 aa] {ON} Anc_4.30
           YLL028W
          Length = 567

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 92/448 (20%), Positives = 173/448 (38%), Gaps = 79/448 (17%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NW + ++ I  + +   C      +S+ ASG +++     V   Q+  ++G  +   G
Sbjct: 118 PFNWTLTKKTIICLILCLDCICISMASSIFASGVTQICEIYHV--IQVVAILGVTLYVFG 175

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  I  +P + ++G+R V ++  L F I     A + +   ++I R   G   +   +
Sbjct: 176 FAASPIIYAPLSEIYGRRGVLVLSSLGFCIFQFAVATAENLQTIMICRFFGGLIGAAPMA 235

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A  A+++  + R   + +++              S + +H +  WL +++  +A   
Sbjct: 236 VVPAAFADMFDTNMRGKAVCLFSLGVFVGPIISPVMGSYIVQHTTWRWLEYVVGCLAALV 295

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRI----ARQVRGLSENVSIATVRSTRLNPRESA 339
           FVL  LF  ET             H   I    A+Q+R  + N  I             A
Sbjct: 296 FVLVALFFEET-------------HHPSILVGKAKQMRQDTNNWGI------------HA 330

Query: 340 GHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVML 399
            H N          E + ++    + TR  I   +E  + I + IY+             
Sbjct: 331 AHEN---------AELSIRDIVQNTITRPLIMLFTEPVLLI-VSIYNS------------ 368

Query: 400 RPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL 459
                            + Y ++ L++ +  I   + + YG++     L YIA  IG   
Sbjct: 369 -----------------FVYGILYLLLEAYPI--VFVEGYGYTKNG-ELPYIALIIGMIF 408

Query: 460 GSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWI 517
            ++        ++ L   +  G   PE RL  ++ A +   IG+L F W+     + HWI
Sbjct: 409 CAMFIWYMD--SSYLKKVNKAGGLVPEARLEPMILAGIVFPIGILWFCWTGNYPEKIHWI 466

Query: 518 IPSIFFGVLGFGSSMCSTTAITYAVDSY 545
            P+I    +GFG        + Y ++SY
Sbjct: 467 CPTIAGAFIGFGLMGIFLPCLNYIIESY 494

>ZYRO0E09900g Chr5 (786545..788164) [1620 bp, 539 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 539

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 124/559 (22%), Positives = 209/559 (37%), Gaps = 105/559 (18%)

Query: 75  KGQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWP------IWRRDIALVCVGWHCFVG 128
           KG E   SD    K     ++    S+  + PLNWP      +    + L CV       
Sbjct: 57  KGTEKESSDT--TKDVDPFLVEFTGSDDPEHPLNWPNSKTTLVITEIMVLTCV------- 107

Query: 129 GGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL-----GVGSIFASPTAVL--FGKR 181
              T M +S ++    E+Q     + ++VG + LSL     G+G +  SP +     G++
Sbjct: 108 ---TYMGSSIYTPGQEEIQHDF-HVGHVVGTLNLSLYVLGYGLGPLIFSPLSEFAKIGRQ 163

Query: 182 LVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYR 241
            +Y++ + +F +  IGCA   +   L+I R ++GF  S   +   A+I +I         
Sbjct: 164 RLYIITLFLFCMLQIGCALVQNIAGLVILRFITGFLCSPSLATGGASIGDIVRPEIVPIF 223

Query: 242 LGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPV 301
           +G++               + +       W+FW++  ++G   ++ + F PET  +    
Sbjct: 224 IGLWGVGAVAAPVTGPLLGASMVVANGWRWIFWLMVWMSGGILIILVFFFPETSVENI-- 281

Query: 302 PNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAE 361
                    R  +++R L                       NDD            +E +
Sbjct: 282 -------LYRRCQRIRKLK----------------------NDD-------RYYTLKERQ 305

Query: 362 TGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAV 421
               TR        K +AI   +Y     I    +VM     L  Y A+ +G +   +  
Sbjct: 306 ESKLTR--------KDIAIT-ALYRPFQMIFEDPIVM----ALDGYLALCYGTFYLFFEA 352

Query: 422 VSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHG 481
             ++ I          +Y F+   VGL Y+  F  GC  + +      V        N+ 
Sbjct: 353 FPIVFIG---------VYDFTLIEVGLAYMG-FTVGCAIAYVVCLTFMVFVVAKKFKNNT 402

Query: 482 IYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP---SIFFGVLGFGSSMCSTTAI 538
           +  PE  L + +    C  + L  FGW+     HW +P    IFF VL   +   ST A 
Sbjct: 403 M-TPEVFLILGMMTSWCLPLSLFLFGWA--ASVHWTLPMLAEIFF-VLCVFNLFQSTFA- 457

Query: 539 TYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHE-----GYKNAFTCYALIEIF 593
            Y   SY ++         + +   GFA +F      +++     GY  A+    L    
Sbjct: 458 -YLAFSYPKYLASVYAGNGVCRA--GFACAFPLFGKAMYDNLAIKGYPVAWGSSILGFFS 514

Query: 594 IGLWAIP--LYRWGKLCRS 610
           + L  IP  LY++G   RS
Sbjct: 515 MALATIPFFLYKYGPYLRS 533

>Kwal_26.8985 s26 complement(1029923..1031665) [1743 bp, 580 aa]
           {ON} YOR273C (TPO4) -  [contig 68] FULL
          Length = 580

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 69/142 (48%), Gaps = 3/142 (2%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NWP WR+  A +     C V    +S+  +G  ++   L+   SQ   L G     L
Sbjct: 27  NPHNWPTWRKWFATMTSAMLCLVVTMGSSLYVNGVPRMV--LEYGYSQTLALAGLTFYLL 84

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACST-SFNWLLISRVVSGFGLSTVES 223
           G+ ++  +P + ++G++ VY + + + M+ S+G A S      +L  R  SG   S   S
Sbjct: 85  GLSTVIGAPLSEIYGRKPVYAISLPLSMLFSMGVALSNGKMRIILPMRFFSGVFASPALS 144

Query: 224 LPSATIAEIYFAHERAYRLGIY 245
           + S TI +I+   E +  + ++
Sbjct: 145 VASGTIVDIWDMDEISIAMSLF 166

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 56/141 (39%), Gaps = 12/141 (8%)

Query: 501 IGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKE-FSQEALVTLNMV 559
           I L   GW+ +   HW+ P       GFG  +   + I Y    Y   F   AL   N++
Sbjct: 380 ISLFWLGWTSKASVHWMAPMAAGVPFGFGLILIFFSVIMYFSSCYPPLFVASALAANNLL 439

Query: 560 KNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIP--LYRWGKLCRSWTNRKNL 617
           + +       F ++  ++E  K  +       I + +  +P    R+G+  R    +K+ 
Sbjct: 440 RYVTSCVFPLFTIQ--MYEKMKIGWASSLFGFICVAMIPLPWIFERYGETMR----QKST 493

Query: 618 LQF---SYRVNDDGKDEKDNH 635
             F    + + DD + E  +H
Sbjct: 494 FGFDVVQHEIEDDDRRESMSH 514

>KLTH0D12320g Chr4 complement(1001954..1003720) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q12256 Saccharomyces cerevisiae
           YOR273C TPO4 Polyamine transport protein
          Length = 588

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 83/191 (43%), Gaps = 4/191 (2%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NWP W++  A +     C V    +S+  +G  ++   L+   SQ   L G     L
Sbjct: 38  NPHNWPTWKKWFATMTAALLCLVVTMGSSLYVNGVPRMV--LEYGYSQTLALAGLTFYLL 95

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACS-TSFNWLLISRVVSGFGLSTVES 223
           G+ ++  +P + +FG++ +Y+  + + M+ ++G A S      +L  R  +G   S   S
Sbjct: 96  GLSTVVGAPLSEIFGRKPIYVASLPLSMLFTMGVALSGGKMRVVLPVRFFAGVFASPALS 155

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + S TI +I+   E +  + ++                   E     W  +I  + AG  
Sbjct: 156 VASGTIVDIFDMDEVSVAMSLFCLAPFLGPVISPVIAGFATEKQGWRWATYI-QLFAGGL 214

Query: 284 FVLHLLFVPET 294
            +  +L +PET
Sbjct: 215 IMPFVLLMPET 225

>TPHA0I03320 Chr9 (737136..738824) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 116/521 (22%), Positives = 194/521 (37%), Gaps = 89/521 (17%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL- 164
           P+NW   +R + L+ +     V    +S+   G  ++ +E  V      ++V  + LSL 
Sbjct: 109 PVNWSKKKRAVILLQIMLLTSVTYMGSSIYTPGQLQIQSEFGV-----GHVVATLNLSLY 163

Query: 165 ----GVGSIFASPTA--VLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGL 218
               G+G +  SP +   L G++ +Y V + IF +  IGCA   +F  L + R  SG   
Sbjct: 164 VLGYGLGPLIFSPQSEFSLLGRQHLYTVTLFIFAMLQIGCATVHNFGGLAVLRFFSGVFC 223

Query: 219 STVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTI 278
           S   S   A+IA+I         LG++               +++       W+FW+   
Sbjct: 224 SPSLSTGGASIADILAPEVVPVFLGLWAVAAFSSPVLAPLLGAVMVVAEDWRWIFWLQLW 283

Query: 279 IAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRES 338
           ++    ++ LLF+PET             H   + R+ R L                R+ 
Sbjct: 284 LSTFTLIVLLLFMPETH------------HGNILYRRARRL----------------RKQ 315

Query: 339 AGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVM 398
            G   DD                T S         +EK+  + LG +          ++M
Sbjct: 316 TG---DD-------------RWSTAS---------AEKEKKLELGAFLLTAVYKPIKIIM 350

Query: 399 LRPFV--LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIG 456
             P +  +  Y A+L+G +   +    L+         +  IY F+    GL ++  F  
Sbjct: 351 REPIIAAIDMYTALLYGIFYLFFEAFPLV---------FGGIYNFTLVESGLAFLG-FQV 400

Query: 457 GCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHW 516
           GC           V   L    N      +F +  ++ A+   A  L  FGW+     HW
Sbjct: 401 GCAIIYPIYIVFLVKYILPRMQNQTFVPEDFLVINMIVAIFLPA-ALFVFGWT--AGVHW 457

Query: 517 IIP---SIFFGVLGFG--SSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFN 571
           I+P    + F +  F    S  +  AI+++      F+   L           F  + +N
Sbjct: 458 ILPIFAEVLFVISAFTIFQSNFAYIAISFSDHVASVFAGNGLARAGFACAFPLFGQAMYN 517

Query: 572 VKFCLHEGYKNAFTCYALIEIFIGLWAIP--LYRWGKLCRS 610
                 E Y  A+    L  I IG+  IP  LY++G + RS
Sbjct: 518 N--LGSEKYPVAWGSSLLGFISIGMSTIPFLLYKYGAVLRS 556

>Smik_12.27 Chr12 (69102..70865) [1764 bp, 587 aa] {ON} YLL028W
           (REAL)
          Length = 587

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 92/446 (20%), Positives = 168/446 (37%), Gaps = 75/446 (16%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NWP+ ++ +  + +   C      +S+ AS   ++     V   ++  ++G  +  LG
Sbjct: 138 PFNWPMKKKVLICLVLCLDCIAIAMCSSIFASAVPQICEIYHV--IEVVAILGITLFVLG 195

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  +  +P + L+G++ V ++    F I     A + +   + I R   GF  +   +
Sbjct: 196 FAASPVVYAPLSELYGRKGVLVLSAFGFAIFQFAVATAENLQTIFICRFFGGFIGAAPMA 255

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A  A+++  + R   + ++               S + +  +  WL +++   A + 
Sbjct: 256 VVPAAFADMFDTNIRGKAIALFALGVFVGPILSPVMGSYIAQRTTWRWLEYVVGCFASAV 315

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           FV  +LF  ET    T + NK        A+Q+R  S N  I             A H  
Sbjct: 316 FVAIVLFFEETH-HPTILVNK--------AKQMRKQSNNWGI------------HAAH-- 352

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
                                     IK I +K +                     RP +
Sbjct: 353 --------------------EDVELSIKDIVQKTVT--------------------RPII 372

Query: 404 -LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL-GS 461
            LF  P +LF     ++    L ++ +     + + YGF      L YIA  IG  +  +
Sbjct: 373 MLFVEPLLLFVTIYNSFVYGILYLLLEAYPLVFVEGYGFVENG-ELPYIALIIGMIVCAA 431

Query: 462 LIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWIIP 519
            I    +D   R  A    G   PE RL+ ++ A     IG+L F W+     + HW++P
Sbjct: 432 FIWYMDNDYLRRCKA---KGKLVPEARLYAMVVAGTIFPIGILWFCWTGYYPHKIHWMVP 488

Query: 520 SIFFGVLGFGSSMCSTTAITYAVDSY 545
           ++    +GFG        + Y ++SY
Sbjct: 489 TVGGAFIGFGLMGIFLPCLNYIIESY 514

>TBLA0A10350 Chr1 (2550231..2551796) [1566 bp, 521 aa] {ON}
           Anc_5.284 YHR048W
          Length = 521

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 93/233 (39%), Gaps = 13/233 (5%)

Query: 386 HGRHTIDNWCMVML---RPF-VLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGF 441
           + R +I  W  ++    RPF +LF  P +    +   + +  + +      + Y  ++ F
Sbjct: 286 NTRSSIPFWKAILFSIRRPFGLLFFDPMMGVLCFYSGFELAIIYLFFVAFPYVYPLLWNF 345

Query: 442 SSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLL--AAHNHGIYEPEFRLFMVLPAVLCN 499
           +       YI   +G  L ++ +     V  R L     N+GI  PE R   +      +
Sbjct: 346 NVMETACSYIGMMVGIILSAITSLY---VQKRYLEKVKKNNGISIPEMRFEPLYIGAFLS 402

Query: 500 AIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMV 559
            IGL+ F W+     HWI P I   + G G          Y VD+Y+ ++   L     V
Sbjct: 403 PIGLMIFAWTCYSNVHWIAPIIGSTIFGMGVFYVFAGIFNYTVDAYRTYAASGLACNTFV 462

Query: 560 KNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLY--RWGKLCRS 610
           + ILG     F ++  + EG    +  + L  + I L  +P     +G   RS
Sbjct: 463 RCILGGIFPLFGLQ--MFEGMTVNWAGFLLAMLAICLIPVPFLFDHYGAYLRS 513

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 69/147 (46%), Gaps = 1/147 (0%)

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
           L  G +F SP + ++G+R+ ++  + + ++       +++   +L  R ++GF  S   S
Sbjct: 129 LAFGPLFLSPISEMYGRRITFIFSLSMSIVWQCLTTWASNIEGMLFGRFLAGFFGSAFLS 188

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +   TI++++  +E    + ++T                ++ H++  W F +L I +G  
Sbjct: 189 VAGGTISDLFNKNEVGVPMALFTTAGFLGPSIGPLLSGAMY-HINYKWTFIVLLITSGVC 247

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHET 310
            +L +L VPET+     +   + L  T
Sbjct: 248 LILVVLTVPETYKPVLLINKAKRLRST 274

>Kpol_413.2 s413 complement(4040..6043) [2004 bp, 667 aa] {ON}
           complement(4040..6043) [2004 nt, 668 aa]
          Length = 667

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 81/191 (42%), Gaps = 4/191 (2%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NWP W++  A +     C V    +S+  SG  ++    +V  +Q   L G     L
Sbjct: 92  NPHNWPTWKKWYACMVAAILCLVVTMGSSLYVSGVPEIVLRYKV--NQTLALAGLTFYLL 149

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS-RVVSGFGLSTVES 223
           G+ ++  +P + +FG++ VY   + I M+ ++G   +     +++  R +SG   S   S
Sbjct: 150 GLSTVIGAPLSEVFGRKPVYFFSLPISMLFTMGVGLANGHMRIILPLRFLSGVFASPALS 209

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + S TI +++   E    L  +                   E     W  WI  +IAG  
Sbjct: 210 VGSGTILDVFDLDEVPVALTFFCLAPFLGPVISPVMGGFACESQGWRWAEWI-QLIAGGL 268

Query: 284 FVLHLLFVPET 294
            +  +  +PET
Sbjct: 269 ILPFIALMPET 279

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 61/281 (21%), Positives = 110/281 (39%), Gaps = 44/281 (15%)

Query: 361 ETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVL-FS-YPAILFG---AW 415
           +  +K    +K  ++++  + L I      +    M+++ P VL FS Y A +F    A+
Sbjct: 287 KRAAKRNIKLKKPTKEEYKMFLKITFTITILRPLKMLVVEPIVLVFSIYIAFIFAVLFAF 346

Query: 416 LYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLI------------ 463
             AY V+            Y+ +Y  S    GL +I   +G  LG+++            
Sbjct: 347 FEAYPVI------------YRGVYQMSYGVSGLAFIGIGVGLWLGAMLYLWIDRRYLFPA 394

Query: 464 AGRGS---DVNTRLLAAHNHGIYEPEFRLFMVLPA--VLCNAIGLLGF-------GWSLE 511
           A  G+   + +  L  A   G  +    +   +P   ++C  IG +          W+  
Sbjct: 395 APEGTPPLENSGTLRTAPLRGYRDENGNVLPPVPEKFLICCKIGSIALPVALFWQAWTAR 454

Query: 512 RQDHWIIPSIFFGV-LGFGSSMCSTTAITYAVDSYKEFSQEALVTL-NMVKNILGFAVSF 569
              HW+ P I  GV  GFG  +   + + Y   +Y      +++   NM++ I       
Sbjct: 455 PDVHWMAP-IAAGVPFGFGLILIFFSVLMYFSLAYPPLYVASVIAANNMLRYITSSVFPL 513

Query: 570 FNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRS 610
           F ++   +   K A T +ALI + +        RWG   R+
Sbjct: 514 FTIQMYENLKIKWASTLFALICVVMVPVPWIFERWGAKLRN 554

>KLTH0E06138g Chr5 (558501..560345) [1845 bp, 614 aa] {ON} similar
           to uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton-motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 614

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 96/472 (20%), Positives = 180/472 (38%), Gaps = 76/472 (16%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NWP+ +R    + +G +       +S+ AS   ++ A+  V  +Q+  ++G  +   G
Sbjct: 164 PYNWPMRKRAFLCLLLGLNAVTVAMGSSIFASAVPQICAKYHV--AQVVGVLGVTLYVFG 221

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  +  +P + L+G++ + ++    F++     A +     ++I R  +GF  +   +
Sbjct: 222 FAASPVIYAPLSELYGRQKLLIISSFGFVLFMFATATAKDLQTIMICRFFAGFIGAAPLA 281

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A   +++    R   + ++               S + +H +  W  + + + A   
Sbjct: 282 IVPACFFDMFDNETRGTAVVVFAMGVFMGPILAPVFGSYIVQHTTWRWTQYCVGMFAALV 341

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
            +L  +F  ET    T + NK        AR++R +S N  I             A H  
Sbjct: 342 TILLAIFYEETH-HPTILVNK--------ARRMRQISGNWGI------------RAAH-- 378

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
                         ++AE        +K I++K +                     RP  
Sbjct: 379 --------------EDAELS------LKEIAQKTVT--------------------RPIY 398

Query: 404 LFSYPAILFGAWLY---AYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLG 460
           +     ILF   LY    Y ++ L++ +  I    K  Y F   +  L YIA  IG  + 
Sbjct: 399 MLVTEPILFAITLYHSFVYGILYLLLEAYPIVFVKK--YHF-YVNGELPYIALLIGMGVN 455

Query: 461 SLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQD--HWII 518
           +           R +   N G   PE RL  ++ A +   IG+L F W+    D  H+++
Sbjct: 456 AAYNIWEEKSYVRKV-RENSGKPLPEERLKTMILAGIVFPIGILWFCWTGNYSDKVHFMV 514

Query: 519 PSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFF 570
           P++    +GFG          Y +DSY   S  A+     +++  G A   F
Sbjct: 515 PTVAGSFIGFGLIGIFLPCFNYIIDSYLFLSASAIAGNTFMRSSFGAAFPLF 566

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 96/234 (41%), Gaps = 26/234 (11%)

Query: 105 DPLNWPIWRR-------DIALVCV--GWHCFVGGGQTSMLASGFSKLSAELQVPLSQISY 155
           +P NWP+W R          ++CV  G  C  GG  T          +A L   L  I +
Sbjct: 175 NPHNWPLWIRWAYTVILSCLVICVAYGSACITGGLFTVQEQYHVGLEAAILSCSLMVIGF 234

Query: 156 LVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSG 215
            +GP++ S         P + L+G+RL Y + + ++ I +I CA S +   LL+ R + G
Sbjct: 235 SLGPLIWS---------PVSDLYGRRLAYFISMGLYTIFNIPCALSPNLGGLLVCRFLCG 285

Query: 216 FGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLV-FEHLSTHWLFW 274
              S+   L   +IA+++ +  R   +  +                 V         +FW
Sbjct: 286 VFSSSGLCLVGGSIADMFPSETRGRAIAFFAFAPYTGPIIGPLVNGFVSVCTRRMDLIFW 345

Query: 275 ILTIIAGSNFVLHLLFVPETF------WDRTPVPNKRSLHETRIARQVRGLSEN 322
           I    AG  +++ + F+PET+      W    +  +    +    ++ +G+S N
Sbjct: 346 INMAFAGVMWII-VAFIPETYAPVILKWRAAKLRKETGNPKIMTEQEAQGVSVN 398

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 71/180 (39%), Gaps = 3/180 (1%)

Query: 437 DIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAV 496
           ++YG+    +GL++I   IG  +         +   +L+         PE RLF  +   
Sbjct: 445 ELYGYKDNLIGLMFIPILIGATMALATTFYCENEYLKLVKKRKP---TPEDRLFGAMIGA 501

Query: 497 LCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTL 556
              A  L   G +  +   W+ P+      G+G  +   +   Y +D Y +++  AL T 
Sbjct: 502 PFAAAALWILGATSYKHIIWVGPASSGLAFGYGMVLIYYSLNNYIIDCYVQYASSALATK 561

Query: 557 NMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNRKN 616
             +++  G A   F  +     G + A    A I   + L     Y +GK  R   ++K+
Sbjct: 562 VFLRSAGGAAFPLFTNQMYHKLGLQWASWLLAFISTAMILLPFGFYYYGKTLRHKLSKKD 621

>Skud_12.38 Chr12 (75867..77630) [1764 bp, 587 aa] {ON} YLL028W
           (REAL)
          Length = 587

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 91/446 (20%), Positives = 168/446 (37%), Gaps = 75/446 (16%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NWP+ ++ +  + +   C      +S+ AS   ++     V   ++  ++G  +  LG
Sbjct: 138 PFNWPMKKKVLICLVLCLDCIAIAMCSSIFASAVPQICEIYHV--IEVVAILGITLFVLG 195

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  +  +P + L+G++ V ++    F +     A + +   + I R   GF  +   +
Sbjct: 196 FAASPVIYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTIFICRFFGGFIGAAPMA 255

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A  A+++    R   + ++               S + +  +  WL +++   A + 
Sbjct: 256 VVPAAFADMFDTDVRGKAIALFALGVFVGPILSPVMGSYIAQRTTWRWLEYVVGCFASAV 315

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           FV  +LF  ET    T + NK        A+Q+R  S N  I             A H  
Sbjct: 316 FVAIVLFFEETH-HPTILVNK--------AKQMRKESNNWGI------------HAAH-- 352

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
                                     IK I +K +                     RP +
Sbjct: 353 --------------------EDVELSIKEIIQKTVT--------------------RPII 372

Query: 404 -LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL-GS 461
            LF  P +LF     ++    L ++ +     + + YGF+     L YIA  IG  +  +
Sbjct: 373 MLFVEPLLLFVTIYNSFVYGILYLLLEAYPLVFVEGYGFTENG-ELPYIALIIGMMVCAA 431

Query: 462 LIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWIIP 519
            I    +D   R  A    G   PE RL+ ++ A     IG+L F W+     + HW++P
Sbjct: 432 FIWYMDNDYLRRCKA---KGKLVPEARLYAMVVAGTIFPIGILWFCWTGYYPHKIHWMVP 488

Query: 520 SIFFGVLGFGSSMCSTTAITYAVDSY 545
           ++    +GFG        + Y ++SY
Sbjct: 489 TVGGSFIGFGLMGIFLPCLNYIIESY 514

>KNAG0G02830 Chr7 complement(625263..627296) [2034 bp, 677 aa] {ON}
           Anc_8.723 YOR273C
          Length = 677

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 83/191 (43%), Gaps = 4/191 (2%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NWP W++    +   + C V    +S+  SG  +L A+  V  +Q   L G     L
Sbjct: 82  NPHNWPTWKKWAVTMTAAFLCLVVSMGSSLYVSGVPELVAKYHV--NQTLALAGLTFYLL 139

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS-RVVSGFGLSTVES 223
           G+ ++  +P + +FG++ +Y+V + +  +  +G   S     +++  R  +G   S   S
Sbjct: 140 GLSTVIGAPLSEVFGRKPIYVVSLPVSCLFIMGVGLSGGHMRVILPLRFFAGAFASPALS 199

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + S TI +I+   E +  +  +                   E+ S  +  WI    +G  
Sbjct: 200 IASGTIMDIFDLDEVSVAMTFFCLAPFMGPVLSPIMAGFAAEYRSWRYTQWIQLFASGMV 259

Query: 284 FVLHLLFVPET 294
           F   +L +PET
Sbjct: 260 FPF-ILLMPET 269

>Kwal_55.20686 s55 (517314..519155) [1842 bp, 613 aa] {ON} YLL028W
           (TPO1) - polyamine transport protein [contig 140] FULL
          Length = 613

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 108/520 (20%), Positives = 196/520 (37%), Gaps = 100/520 (19%)

Query: 81  GSDDHLKKTKKGIILNP---------------QPSECKKD-------PLNWPIWRRDIAL 118
           G+ D ++KTK      P               +P E   D       P NWP  +R    
Sbjct: 116 GAQDDVEKTKIDYTGCPPMGGGRAYPPPLPDREPYEVAFDGPDDPLHPYNWPARKRSFLC 175

Query: 119 VCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGS--IFASPTAV 176
           + +G +       +S+ AS   ++     V  +Q+  ++G  +   G  +  +  +P + 
Sbjct: 176 LLLGLNAVTVAMGSSIFASAVPQVCEIYGV--AQVVGVLGVTLYVFGFAASPVIYAPLSE 233

Query: 177 LFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAH 236
           L+G++ + ++    F++     A + +   ++I R  +GF  +   ++  A   ++Y   
Sbjct: 234 LYGRQRLLIISSFGFVLFMFATATAENLQTIMICRFFAGFVGAAPLAIVPACFFDMYDNE 293

Query: 237 ERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFW 296
            R   + ++               S + +H +  W  +++ I      VL  +F  ET  
Sbjct: 294 NRGTAVVVFAMGVFMGPILAPVFGSYIVQHTTWRWTQYVVAIFGSCVTVLLAVFYEETHH 353

Query: 297 DRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESN 356
               V      H+   AR++R LS N  I             A H              +
Sbjct: 354 PTILV------HK---ARRMRELSGNWGI------------RAAH-------------ED 379

Query: 357 AQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRP-FVLFSYPAILFGAW 415
           AQ +         IK I++K +                     RP ++LF+ P ILF   
Sbjct: 380 AQLS---------IKEIAQKTVT--------------------RPIYMLFTEP-ILFLIT 409

Query: 416 LY---AYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNT 472
           LY    Y ++ L++ +  I    K  Y  +     L YIA  +G  + ++          
Sbjct: 410 LYHAFVYGILYLLLEAYPIVFIGKYHYYVNGQ---LPYIALLVGMGVNAIYNIWEEKSYV 466

Query: 473 RLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQD--HWIIPSIFFGVLGFGS 530
           R + A N G   PE RL  ++ + +   IG+L F WS    D  H+++P++    +GFG 
Sbjct: 467 RKVRA-NGGKPLPEERLKTMIISGIVFPIGILWFCWSGNYPDKVHYMVPTVAGSFIGFGL 525

Query: 531 SMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFF 570
                    Y +DSY   +  A+     +++  G A   F
Sbjct: 526 IGIFLPCFNYLIDSYLILAASAIAGNTFMRSAFGAAFPLF 565

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 10/170 (5%)

Query: 138 GFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIG 197
              +L AE  V    I+  V   +L  G+    +   A ++G+R + L+G+LI++I SIG
Sbjct: 105 ALKELEAEFDVNEELINITVVVYLLFQGIAPTISGGLADVYGRRPIILLGMLIYVIASIG 164

Query: 198 CACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXX 257
            ACS S+  ++  R +   G+S + ++ S    +     ER    G +            
Sbjct: 165 LACSKSYGAVVFLRCLQSAGISPIIAINSGVAGDFTVKSER----GTFVGAVSGFTLMGQ 220

Query: 258 XXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPETFWDRTPVPN 303
              SL+   L+  +    +FW L I  G+  ++    + ET   RT V N
Sbjct: 221 AFGSLIGAALTAAYDWRAIFWFLVIGCGTCMIILCFLLIET--KRTIVGN 268

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 81/181 (44%), Gaps = 19/181 (10%)

Query: 437 DIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDV-----NTRLLAAHNHGIYEPEFR--- 488
           D Y +S   +G+ Y+   IGG LGS   G+  DV     + + L     G+ + + R   
Sbjct: 351 DPYDYSLTMIGVCYLPSGIGGLLGSFCTGKIIDVYYKRSHKKFLEKKEAGLIDKDARFNT 410

Query: 489 ----LFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDS 544
               L    P  +C A+    FGW+L+++ H  +  +   +  F +    +T+ T  VD 
Sbjct: 411 FKARLISGAPQNVCAAVVFTLFGWALKQRWHIAVVLVTSFIGSFCAMSTLSTSSTLLVDL 470

Query: 545 YKEFSQEALVTLNMVKNILG--FAVSFFNVKFCLHEGYKNAFTCYALIEIFIG--LWAIP 600
           Y   S  A    N ++ +L   F   F  +K  ++ G    FTC + + +F+G  L  IP
Sbjct: 471 YPSKSSTATSCYNFMRCVLSAIFMACFSKMKSSMNVG--GTFTCISGM-VFVGNFLILIP 527

Query: 601 L 601
           +
Sbjct: 528 M 528

>ZYRO0E09922g Chr5 (788952..790643) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 563

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 107/554 (19%), Positives = 212/554 (38%), Gaps = 95/554 (17%)

Query: 76  GQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSML 135
           G ++ G     K      ++  + ++    P NW  +++ + ++ +     V    +++ 
Sbjct: 80  GDDNSGELKDAKDATDPYLVQFRGTKDPDHPHNWLGFKKFVVILEIMLLTCVTYMGSAIY 139

Query: 136 ASGFSKLSAELQVPLSQISYLVGPMMLSL-----GVGSIFASPTA--VLFGKRLVYLVGI 188
             G  ++  E  V      ++VG + LS+     G+G +  SP +   ++G++ +Y++ +
Sbjct: 140 TPGQEEIQKEFGV-----GHVVGTLNLSMYVLGYGLGPMVFSPLSEFAMYGRQQLYIITL 194

Query: 189 LIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXX 248
            +F +  IGCA   +   L+I R ++G   S   +  +A+I +I         +G+++  
Sbjct: 195 FLFSMLQIGCALVHNIAGLVILRFITGILCSPSLATGAASIGDIVTPQWVPVFIGMWSIG 254

Query: 249 XXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLH 308
                       + +    +  W+FW+L  ++ +  ++ + F PET  D   +  +R + 
Sbjct: 255 AVAAPVTGPLLGASMVVAKNWRWIFWLLMWMSAALLIVLIFFFPETGEDN--ILYRRCV- 311

Query: 309 ETRIARQVRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRA 368
             RI R++ G          R      RE A     D   V L                 
Sbjct: 312 --RI-RKITGDD--------RYYTFKAREEAKLTFKDIAVVALYRP-------------- 346

Query: 369 HIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIIS 428
             + I ++ + + L IY                       A+ +G +   +    ++   
Sbjct: 347 -FEIIVKEPIVLALDIYI----------------------ALCYGTFYLFFEAFPIV--- 380

Query: 429 QVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHN--HGIYEPE 486
                 +  +Y F+   +GL Y    +G C+G + A   S +      A       + PE
Sbjct: 381 ------FAGVYHFTLIELGLAY----MGFCVGCVFAYAISLIFLSQYGARQAKKNRFTPE 430

Query: 487 FRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP---SIFFGVLGFGSSMCSTTAITYAVD 543
             L + +    C  + L  FGW+     HW +P    IFF +  F     +    +Y   
Sbjct: 431 TFLVLAMGVCWCLPLALFLFGWA--ASVHWTLPMLAEIFFVICVFNLFQAT---FSYLAM 485

Query: 544 SYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHE-----GYKNAFTCYALIEIFIGLWA 598
           SY ++         +++   GFA +F      +++     GY  A+    L    IGL  
Sbjct: 486 SYPKYMASVFAGNGVMRA--GFACAFPLFGKAMYDNLAIKGYPVAWGSSLLGFFSIGLAV 543

Query: 599 IP--LYRWGKLCRS 610
           +P  LY++G   RS
Sbjct: 544 LPFLLYKYGPYLRS 557

>KLTH0G06754g Chr7 (541019..542461) [1443 bp, 480 aa] {ON} similar
           to uniprot|P38776 Saccharomyces cerevisiae YHR048W
           Hypothetical ORF
          Length = 480

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 77/181 (42%), Gaps = 11/181 (6%)

Query: 435 YKDIYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAA---HNHGIYEPEFRLFM 491
           +  +Y F++  +G+ Y+    G  +G ++    S    R  A    ++ G   PE R   
Sbjct: 299 FGSLYSFTTMELGVSYM----GMLVGIVLVAPTSLWFQRRYAQKVINSGGQQVPELRFEP 354

Query: 492 VLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQE 551
           +        IGL+ F W+     HWI P I   V G G     T    Y VD+++ +S  
Sbjct: 355 LFYGAFLTPIGLMIFAWTSYSHVHWIAPIIGTAVFGAGVFFVFTGVFNYTVDAFRLYSAS 414

Query: 552 ALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLY--RWGKLCR 609
           A+   + V++++      F  +  ++EG    +  + L  + I +  +P    R+G   R
Sbjct: 415 AMACNSFVRSMMAGVFPLFTTQ--MYEGMGVNWASFLLAMVSIAMIPVPFLFTRYGAYLR 472

Query: 610 S 610
           S
Sbjct: 473 S 473

>Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W
           (REAL)
          Length = 599

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 8/121 (6%)

Query: 178 FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHE 237
            G+R V L+ I+I+    +G AC+ ++  +++ R +   G+S V ++ S  + +I    E
Sbjct: 146 LGRRPVVLIAIIIYFGACVGLACTQTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAE 205

Query: 238 RAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPE 293
           R    G Y               +L+   LS+ W    +FW LTI +G  F+  LL +PE
Sbjct: 206 R----GGYVGYAAGFQVLGSAFGALIGAGLSSRWGWRAIFWFLTIGSGICFLASLLILPE 261

Query: 294 T 294
           T
Sbjct: 262 T 262

>Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W
           (REAL)
          Length = 565

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 63/134 (47%), Gaps = 8/134 (5%)

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESL 224
           G+   F    A   G+R V LV ILI++   +G AC+ ++  +++ R +   G+S V ++
Sbjct: 111 GLAPTFMGGFADSLGRRPVVLVAILIYLGACVGLACAQTYAQIIVLRCLQAAGISPVIAI 170

Query: 225 PSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIA 280
            S  + +I    ER    G Y               +L+   LS+ W    +FW L I +
Sbjct: 171 NSGIMGDITTRAER----GGYVGYVAGFQVLGSAFGALIGAGLSSRWGWRAIFWFLAIGS 226

Query: 281 GSNFVLHLLFVPET 294
           G  F+  LL +PET
Sbjct: 227 GVCFLGSLLVLPET 240

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 64/141 (45%), Gaps = 10/141 (7%)

Query: 178 FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHE 237
            G+R V L  +L++    IG ACS ++  +++ R +   G+S V ++ S  + +I    E
Sbjct: 141 MGRRPVVLSSVLVYCCACIGLACSHTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAE 200

Query: 238 RAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPE 293
           R    G Y               +L+   LS  W    +FW L I +G   V  ++ +PE
Sbjct: 201 R----GGYVGYVSGFQVIGSAFGALIGAGLSATWSWRSIFWFLAIGSGVCLVASIIILPE 256

Query: 294 TFWDRTPVPNKRSLHETRIAR 314
           T   RT V N   +   RI+R
Sbjct: 257 T--KRTVVGNGSIMPPNRISR 275

>TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.242
           YNL065W
          Length = 550

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 90/235 (38%), Gaps = 9/235 (3%)

Query: 73  DMKGQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQT 132
           D    E G   D      K    N    +    P +W   +++ A + V   C   G  +
Sbjct: 57  DDDDDEEGNHHDTTNGMYKTKSQNRDEPDIDSPPYSW-FDKKEKAFLVV--QCAFTGLLS 113

Query: 133 SMLASGF----SKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGI 188
           S+  S +    S L  +  +   QI+  V    +   V        A   G+R V +  +
Sbjct: 114 SLAGSIYYPVLSVLEVKFHITEEQINISVVVYYVFQAVSPTLMGGLADSLGRRPVIITSV 173

Query: 189 LIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXX 248
            ++    IG AC  +++ L+  R +   G+S V ++ S  + ++    ER   +G+ +  
Sbjct: 174 FLYFCACIGLACCNNYSQLIGLRCLQATGISPVIAVNSGLMGDVTTKAERGGYMGLVSGT 233

Query: 249 XXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPN 303
                       + +F       +FW L I +G   VL L  +PET   RT V N
Sbjct: 234 QVLGTAFGALIGAALFSRWGWRSIFWFLVIGSGVCLVLSLFILPET--KRTVVGN 286

>Suva_8.322 Chr8 complement(573995..575953) [1959 bp, 652 aa] {ON}
           YOR273C (REAL)
          Length = 652

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 81/191 (42%), Gaps = 4/191 (2%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NWP W++  A +     C V    +S+  S   +L A   V  S+   L G     L
Sbjct: 75  NPHNWPSWKKWYATMSSALLCLVVTMGSSLYVSSVPELVARYHV--SRTLALSGLTFYLL 132

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS-RVVSGFGLSTVES 223
           G+ ++  +P + +FG++ VYL  +   M+ ++G   S     +++  R +SG   S   S
Sbjct: 133 GLATVIGAPLSEVFGRKPVYLFSLPASMLFTMGVGLSNGHMRIILPLRFLSGVFASPALS 192

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + S TI +I+   + +  +  +                   E     W  WI  +IAG  
Sbjct: 193 VGSGTILDIFDVDQVSVAMTYFVLSPFLGPVLSPIMAGFATEAKGWRWSEWI-QLIAGGM 251

Query: 284 FVLHLLFVPET 294
            +  +  +PET
Sbjct: 252 VLPFIATMPET 262

>KAFR0E00140 Chr5 complement(25875..27191) [1317 bp, 438 aa] {ON} 
          Length = 438

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 96/467 (20%), Positives = 171/467 (36%), Gaps = 91/467 (19%)

Query: 161 MLSLGVGSIFASPTAVL--FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGL 218
           +L  G+G IF SP + +   G++ +Y++   IFM+  IGCA   +   L+I R ++G   
Sbjct: 40  VLGYGLGQIFFSPLSEVAKIGRQQIYIITFFIFMLLQIGCATVQNIAGLVILRFITGILC 99

Query: 219 STVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTI 278
           S   S   A+IA++    +    + ++               + +       W FW+L  
Sbjct: 100 SPSLSTGGASIADVIHPEKLTIYIALWAVGTVAAPIVGPLLGASMVVAKDWRWTFWLLFW 159

Query: 279 IAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRES 338
           ++    V  + F PET           S   +R A +VR  +++           N   +
Sbjct: 160 LSIPCLVCCIFFFPET---------SASNILSRRASRVRAQTDD-----------NRYFT 199

Query: 339 AGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVM 398
              + D G+         ++E    +  R  I+ I ++ + +   IY             
Sbjct: 200 EQEILDAGI--------TSKEFLINTLYRP-IEIIVKEPIVLAFDIYL------------ 238

Query: 399 LRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGC 458
                     A+ +G +   +    ++ +           +GF+   +GL Y     G C
Sbjct: 239 ----------ALCYGTFYLFFEAFPIVFVEN---------WGFTLIELGLSY----FGFC 275

Query: 459 LGSLIAGRGSDVNTRLLAAH-------NHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLE 511
           +G  IA      +  LL  H         G + PE  L + +         L  FGW+  
Sbjct: 276 VGCCIA-----FSVLLLFVHKVVKPRRKEGTFVPETFLLLAMSVSWGLPCALFLFGWA-- 328

Query: 512 RQDHWIIP---SIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVS 568
              HWI+P    IFF +  F       TA +Y    Y ++           +++   A  
Sbjct: 329 AMTHWIVPIIAEIFFVLCVFN---LFQTAFSYLAMCYPKYIASVYAGNGFCRSVFACAFP 385

Query: 569 FFNVKFCLH---EGYKNAFTCYALIEIFIGLWAIP--LYRWGKLCRS 610
            F      +   +GY   +    +  + + L  IP  LYR+G+  RS
Sbjct: 386 LFGRAMYNNLAIDGYPVGWGSSIIGLVALALAFIPFVLYRYGEYLRS 432

>NCAS0A03120 Chr1 (611490..613124) [1635 bp, 544 aa] {ON}
          Length = 544

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/248 (19%), Positives = 100/248 (40%), Gaps = 7/248 (2%)

Query: 81  GSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFS 140
             ++ + + K   +++        +P NW   ++   ++ V     V    +S+   G  
Sbjct: 66  NKEEAIVEEKDPFLVDWNGDNDPDNPQNWSTSKKTFMVIQVMLLTSVTYMGSSIYTPGQE 125

Query: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTA--VLFGKRLVYLVGILIFMIGSIGC 198
            L  E  V     +  +   +L  G+G I  SP +   L G++ +Y++ +  F +  IG 
Sbjct: 126 ALQKEFHVGHVAATLNLSIYVLGYGLGPIMLSPFSEFALLGRQHIYIITLFCFCMFQIGA 185

Query: 199 ACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXX 258
           A   +   +++ R  SG   S   +   ATI++I         +G+++            
Sbjct: 186 ATVHNLGGMIVIRFFSGIFCSPALTTGGATISDIINPQMVPVVIGLWSVAAVAAPALGPL 245

Query: 259 XXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPET-----FWDRTPVPNKRSLHETRIA 313
             + +       W+FW+L  +  +  +L ++F PET      + RT    K +  +   +
Sbjct: 246 IGAAMQVAEGWRWIFWLLLWMCAATLILLIIFFPETHHGNILYRRTNRLKKMTGDDRYYS 305

Query: 314 RQVRGLSE 321
           +Q +  SE
Sbjct: 306 KQAKKESE 313

>NCAS0B00490 Chr2 complement(71160..73154) [1995 bp, 664 aa] {ON}
           Anc_8.723
          Length = 664

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 87/220 (39%), Gaps = 11/220 (5%)

Query: 83  DDHLKKTKKGIILNPQPSECKKD-------PLNWPIWRRDIALVCVGWHCFVGGGQTSML 135
           DD ++K  +G      P     D       P NWP W++    +     C      +S  
Sbjct: 43  DDEVQKVSEGEEETVDPRTLDWDGPDDMANPHNWPSWKKWYTTMVAALLCLAVTMGSSTY 102

Query: 136 ASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGS 195
            S   +L A   +  +Q   L G     LG+ ++  +P + +FG++ +YL  + I M+ +
Sbjct: 103 VSSVPELVARYGI--NQTLALAGLTFYLLGLSTVIGAPLSEVFGRKPIYLFSLPISMLFT 160

Query: 196 IGCACSTSFNWLLIS-RVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXX 254
           +G   S     +++  R  SG   S   S+ S TI +I+   + +  +  +         
Sbjct: 161 MGVGLSNGHMRIILPLRFFSGVFGSPCLSIGSGTIMDIFDVDQVSVAMTFFCLSPFLGPV 220

Query: 255 XXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPET 294
                     E+    W  WI  + AG   +  ++ +PET
Sbjct: 221 ISPFIAGFATEYQGWRWAEWI-QLFAGGLILPFIVLMPET 259

>TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.241
           YIL121W
          Length = 557

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 62/130 (47%), Gaps = 10/130 (7%)

Query: 178 FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHE 237
            G+R + ++ +L++    +G ACS S+  ++  R +   G+S V ++ S  + ++    E
Sbjct: 133 LGRRPIVILSVLVYFSACVGLACSQSYAQIIALRCLQAAGISPVIAINSGIMGDVTTRAE 192

Query: 238 RAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPE 293
           R    G Y               +L+   LS+ W    +FW L I +G+  V  +LF+PE
Sbjct: 193 R----GGYVGYVSGCQVVGSAFGALIGAGLSSRWGWRSIFWFLAIGSGACLVATVLFLPE 248

Query: 294 TFWDRTPVPN 303
           T   RT V N
Sbjct: 249 T--KRTVVGN 256

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 63/119 (52%), Gaps = 1/119 (0%)

Query: 126 FVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYL 185
           F+     +++++  + +++E    LS++S++    +LS           + +FG++ + +
Sbjct: 122 FLAAIDNTIVSTTSAHVASEFN-QLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLV 180

Query: 186 VGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGI 244
              + F+IG + C  S SF WL+I+R V+G G   + S+ S TI ++    ERA   GI
Sbjct: 181 FTNVAFLIGCLMCGLSKSFWWLVIARFVAGVGGGGLTSMSSITITDLVPLRERAMYQGI 239

>YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presumed
           antiporter of the DHA1 family of multidrug resistance
           transporters; contains 12 predicted transmembrane spans;
           expression of gene is up-regulated in cells exhibiting
           reduced susceptibility to azoles
          Length = 514

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 66/148 (44%), Gaps = 1/148 (0%)

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
           LG+G +F SP + L+G+R+ +L  + + +I       S +   ++  R +SGF  S   S
Sbjct: 122 LGIGPLFLSPLSELYGRRITFLYALTLSIIWQCLTIWSKTITGVMFGRFLSGFFGSAFLS 181

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +    IA+I+   +    + IYT                ++ H S  W F  L I +G  
Sbjct: 182 VAGGAIADIFDKDQIGIPMAIYTTSAFLGPSLGPIIGGALY-HQSYKWTFITLLITSGCC 240

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETR 311
            V+ +  +PET+     +   + L + +
Sbjct: 241 LVMIIFTIPETYKPMLLIRKAKRLRKEK 268

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 58/144 (40%), Gaps = 7/144 (4%)

Query: 433 HAYKDIYGFSSASVGLVYIAPFIGGCLGS---LIAGRGSDVNTRLLAAHNHGIYEPEFRL 489
           + +K +Y F    +   YI   +G  L +   L+  +  +   +     N+G+  PE R 
Sbjct: 330 YVFKKLYNFGPMEIACSYIGIMVGMILSAPTCLLFQKTFEWRVK----RNNGVKTPEMRF 385

Query: 490 FMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFS 549
             +        +GL  F ++  +  HWI P I   + G G     T    Y VD+Y+ ++
Sbjct: 386 EPLFYGAFLTPVGLFIFAFTCYKHVHWIAPIIGSAIFGSGVYFVFTGVFAYTVDAYRRYA 445

Query: 550 QEALVTLNMVKNILGFAVSFFNVK 573
              +     V+ I+      F ++
Sbjct: 446 ASGMACNTFVRCIMAGVFPLFGLQ 469

>KNAG0I03080 Chr9 (617011..618789) [1779 bp, 592 aa] {ON} Anc_4.30
           YLL028W
          Length = 592

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 93/470 (19%), Positives = 180/470 (38%), Gaps = 73/470 (15%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NW + ++ +  V +   C      +S+ AS   ++  +  V   Q+  ++G  +  LG
Sbjct: 143 PFNWSLKKKVMICVVLCLDCLCITMASSIFASAVPQICEKYHV--IQVVAILGITLFVLG 200

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  I  +P + ++G++ V ++    F +     A + +   + I R   G   +   +
Sbjct: 201 FAASPIIYAPLSEIYGRKGVLVIAAFGFALFQFAVATAENLQTIFICRFFGGLIGAAPMA 260

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A  A+++  + R   + +++              S + +  +  WL +++   A  N
Sbjct: 261 VVPAAFADMFDTNMRGKAICLFSLGVFVGPILSPVMGSYIAQRTTWRWLEYVVGCFASFN 320

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           F+L        F+D T  P    +   R A+Q+R  + N  I               H  
Sbjct: 321 FLLL-----SYFYDETHHP----IILVRKAKQMRRETNNWGI---------------HAA 356

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
            + V + + D          + TR  I    E  + I + IY+                 
Sbjct: 357 HESVELSIKDIIQK------TVTRPLIMLCVEPTLLI-ITIYNS---------------- 393

Query: 404 LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL-GSL 462
                        + Y ++ L++ +  I   + + YG+      L YIA  IG  +  + 
Sbjct: 394 -------------FVYGILYLMLEAYPI--VFVEGYGYRENG-ELPYIALIIGMLVCAAF 437

Query: 463 IAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWIIPS 520
           I     D   R+  A   G   PE RL+ ++ A +   IG+L F W+    ++ HWI P+
Sbjct: 438 IWYFEGDYLKRVRKA---GKLVPEARLYPMIYAGIVFPIGILWFCWTGYYPKKIHWICPT 494

Query: 521 IFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFF 570
           I    +GFG        + Y ++SY   +  A+     +++  G A   F
Sbjct: 495 IGGSFIGFGLMGIFLPCLNYIIESYLLVAASAVAANTFLRSAFGAAFPLF 544

>ZYRO0E10054g Chr5 complement(804765..806651) [1887 bp, 628 aa] {ON}
           similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force- dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 628

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 108/538 (20%), Positives = 202/538 (37%), Gaps = 84/538 (15%)

Query: 87  KKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAEL 146
           K  K+ ++L   P +  ++P NW +  +      +       G  T+  +SG  +++   
Sbjct: 64  KDGKEWVMLTFAPGD-PENPFNWSLRLKWFLTTLLCLMTLFIGLATTAYSSGIDRMAKHF 122

Query: 147 QVPLSQISYLVGPMML-----SLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACS 201
                  S  VG + L     +  +  +F +P   L G++++Y  G L F +  IG A  
Sbjct: 123 NS-----SSEVGQLGLFTFNETCSIAPLFLAPFCELVGRKVIYTGGYLCFCLCFIGLALG 177

Query: 202 TSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXS 261
            +   ++  R   G        L   T  +++ A ERA  +                   
Sbjct: 178 KNMATIICLRACLGLFGCIGTILVGGTFDDMFVADERAIPMA------------------ 219

Query: 262 LVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETF-WDRTPVPNKRSLHETRIARQVRGLS 320
                     LF  + I+      ++  F+ +   W              R    ++GLS
Sbjct: 220 ----------LFAYVAILGTVGAPIYAGFIDQAIGW--------------RWIEGIQGLS 255

Query: 321 ENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQM-A 379
            NV +  +    L  +E+ G V        L   + +   +TG +     + +S++++ A
Sbjct: 256 -NVPLLII--IFLFFKETRGGVT-------LQKRAKSLRKDTGDE-----RWVSKEELEA 300

Query: 380 IGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIY 439
            GL       ++    M++  P V F      FG W+     ++ + +S VI   +    
Sbjct: 301 PGLKDALYNSSVKAIKMLISEPVVFF------FGLWISFAWFLTFLFLS-VIGITFSHFK 353

Query: 440 GFSSASVGLVYIAPFIG---GCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAV 496
            +S    GL YI+  IG   G L + +  R  + N R  + +      PE RL+  +   
Sbjct: 354 HWSEGVAGLPYISLVIGVTIGFLTNFLQIRKYE-NMRKKSKYP---LPPENRLYGAMTGA 409

Query: 497 LCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTL 556
           +   IGL+ + ++     HWI P+I    +  G      +  +Y  D Y   +  A+   
Sbjct: 410 VFLPIGLMIYSFTQYHWLHWIGPNIGLACISLGIFFIFESCYSYTSDCYGPDASSAIAGQ 469

Query: 557 NMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNR 614
             ++N LG     F     L+   + A    +L+   + L    LY++G   R+ + R
Sbjct: 470 GFMRNTLGAVSPLFGKYMFLNMHSQWAGLLCSLVAFGLTLLPFVLYKFGPAIRARSKR 527

>YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin; may have a role in potassium uptake
          Length = 542

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 8/134 (5%)

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESL 224
           G+   F    A   G+R V LV I+I+    IG AC+ ++  +++ R +   G+S V ++
Sbjct: 111 GLAPTFMGGFADSLGRRPVVLVAIVIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAI 170

Query: 225 PSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIA 280
            S  + ++    ER    G Y               +L+   LS+ W    +FW L I +
Sbjct: 171 NSGIMGDVTTRAER----GGYVGYVAGFQVLGSAFGALIGAGLSSRWGWRAIFWFLAIGS 226

Query: 281 GSNFVLHLLFVPET 294
           G  F+   L +PET
Sbjct: 227 GICFLASFLILPET 240

>ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 538

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 129/333 (38%), Gaps = 68/333 (20%)

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESL 224
           G+   F    A   G+R V LV +LI+ +  +G A   +++ L+  R +   G+S V ++
Sbjct: 102 GLSPSFMGNMADTLGRRPVILVSVLIYFVACLGIASCNTYSQLIGLRCLQAAGISPVIAI 161

Query: 225 PSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIA 280
            S  + +I    ER    G Y               +L+   LS+ W    +FW L+I +
Sbjct: 162 NSGMMTDITTRAER----GGYVGYTSGCQVLGSAFGALIGAGLSSRWGWRSVFWFLSIGS 217

Query: 281 GSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAG 340
           G   V+  L +PET   RT V N      +   R +   S  ++I  VR      RE   
Sbjct: 218 GICLVISTLLLPET--KRTIVGN-----ASITPRSILNRSPILAIPAVR------REL-- 262

Query: 341 HVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLR 400
           H+          D  + Q  E   K            M I L  Y           ++L 
Sbjct: 263 HL----------DNPDLQTLEPSPK------------MNI-LASYK----------ILLT 289

Query: 401 PFV--LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGC 458
           P +  L     + F  W      +SL +  +         Y  S A +GL ++   I   
Sbjct: 290 PEIDLLLFVAGLQFATWTTHQTALSLNLSKK---------YNLSVAKIGLCFLPSGISTL 340

Query: 459 LGSLIAGRGSDVN-TRLLAAHNHGIYEPEFRLF 490
           L  + +GR  + N  R LA HN+ + E + +LF
Sbjct: 341 LSVVFSGRFLNWNYKRRLALHNNWLQEQKKQLF 373

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/248 (21%), Positives = 101/248 (40%), Gaps = 26/248 (10%)

Query: 73  DMKGQESGGSDDHLKKTKKGIILNP----QPSECKKDPLNWPIWRR-----DIALVCVGW 123
           D+   +S  +D  +K  +   +  P    + ++ + D  N P + R      +ALV    
Sbjct: 29  DLSEVDSEDNDKMIKTNEDEAVKEPIYRTRSNQTEPDIANAPPYSRFDAKYKMALV---L 85

Query: 124 HCFVGGGQTSMLASGF----SKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFG 179
            C   G  ++M  + +    S +  +  +    ++  V    +  G+        A   G
Sbjct: 86  QCAYTGLFSTMAGAIYYPVLSVIEKQFHITEELVNITVVVYFIFQGIAPTLMGGLADSLG 145

Query: 180 KRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERA 239
           +R V L  + ++    IG AC+ ++  +++ R +   G+S V ++ S  I ++    ER 
Sbjct: 146 RRPVVLFAVTVYFGACIGLACAQTYAQIVVLRCLQAAGISPVIAINSGIIGDVTTRAER- 204

Query: 240 YRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPETF 295
              G Y               +L+   LS+ W    +FW L I +G   V  ++ +PET 
Sbjct: 205 ---GGYVGYISGFQVLGSAFGALIGAGLSSRWGWRSIFWFLAIGSGVCLVFSIIMLPET- 260

Query: 296 WDRTPVPN 303
             RT V N
Sbjct: 261 -KRTIVGN 267

>Kwal_23.4803 s23 complement(875449..877074) [1626 bp, 541 aa] {ON}
           YBR008C (FLR1) - Major Facilitator Transporter [contig
           5] FULL
          Length = 541

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 83/429 (19%), Positives = 157/429 (36%), Gaps = 84/429 (19%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
           + PLNW   ++   +V +     V     S+   G   +  E  V      ++VG + LS
Sbjct: 86  EHPLNWGRGKKAFVVVQIMILTCVTYMGASIYTPGQEYIQQEFHV-----GHVVGTLNLS 140

Query: 164 L-----GVGSIFASP--TAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF 216
           +     G+G +  SP   +   G++ +Y+V + +FM+  IG A   +   L++ R +SG 
Sbjct: 141 MYVLGYGLGPMIFSPLSESARMGRQHIYIVTLFLFMLFQIGAATVHNIGGLIVIRFISGV 200

Query: 217 GLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWIL 276
             S   +  + ++ +          +G++               + +    +  W+FW+L
Sbjct: 201 LCSPALATGAGSMGDFIVPERVPIFIGLWAVGAVAAPVMAPLLGAAITVAKNWRWIFWLL 260

Query: 277 TIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPR 336
             +  +  ++ + F PET             H++ I  +             R+ R+  R
Sbjct: 261 MWLVAATLLVLVAFFPET-------------HQSNILHR-------------RAVRIR-R 293

Query: 337 ESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCM 396
           E              T +S     E   + +   K      +               + +
Sbjct: 294 E--------------TGDSRYYTKEERIEDQVKFKDFLSDTL------------YRPFAI 327

Query: 397 VMLRPFVLFS--YPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPF 454
           ++  P VL    Y A+ +GA+   +    L+ +          IY F+   VGL Y    
Sbjct: 328 IIHEPIVLAFDIYIALCYGAFYLFFEAFPLVFVG---------IYNFTLVEVGLAY---- 374

Query: 455 IGGCLGSLIAGRGSDV--NTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLER 512
           +G C+G +IA     V     +     +  + PE  L + +       + L  FGW+   
Sbjct: 375 LGFCVGCVIAYIVLMVFLAKSIAPKFKNNTFTPEAFLKLAMAVCWSLPLSLFLFGWT--A 432

Query: 513 QDHWIIPSI 521
             HWI+P I
Sbjct: 433 HVHWILPII 441

>KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 61/130 (46%), Gaps = 10/130 (7%)

Query: 178 FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHE 237
            G+R V L  ++I+    IG ACS ++  ++  R +   G+S V ++ S  + ++    E
Sbjct: 143 LGRRPVILCSVIIYFCACIGLACSNNYAQVIALRCLQAAGISPVIAINSGMMGDVTTKAE 202

Query: 238 RAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPE 293
           R   +G  +              +L    LS+ W    +FW L I +G+  ++ LL +PE
Sbjct: 203 RGGYVGYVSGFQVVGTATGAVFGAL----LSSRWGWRSIFWFLAIGSGACSIVSLLLLPE 258

Query: 294 TFWDRTPVPN 303
           T   RT V N
Sbjct: 259 T--KRTIVGN 266

>TBLA0B03550 Chr2 (824481..825134) [654 bp, 217 aa] {ON} Anc_8.723
           YOR273C
          Length = 217

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 85/180 (47%), Gaps = 26/180 (14%)

Query: 83  DDHLKKTK----KGIILNPQ-----PSECKKDPLNWPIWRR---DIALVCVGWHCFVGGG 130
           DD   K K    K  ++NP+      S+   +P NW +W++    +    +G+ C +G  
Sbjct: 37  DDTKHKVKYSNEKTRVINPEYLEWDGSDDLDNPHNWSVWKKWYVTLTAAALGFICTMG-- 94

Query: 131 QTSMLASGFSKLSAEL----QVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLV 186
            +S+  S  S +  E     ++ LS +++ +      +G+ ++  +P + +FG++LVYLV
Sbjct: 95  -SSLYVSDISSMKEEFGYGEEISLSGLTFYL------IGLSTVICAPLSKIFGRKLVYLV 147

Query: 187 GILIFMIGSIGCACSTS-FNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIY 245
            + + M  ++G   S      +L  R + G   S   S+ S TI +I+   E +  +  +
Sbjct: 148 SLPLCMRCTMGIVLSHGHMKIILPLRYLGGMFASPPLSVGSGTIIDIFDNDETSIAMTFF 207

>SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} similar
           to uniprot|P38776 Saccharomyces cerevisiae YHR048W
           Hypothetical ORF
          Length = 533

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 60/135 (44%), Gaps = 4/135 (2%)

Query: 478 HNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTA 537
            N+GI  PEFR   +        IGL+ F W+     HWI P I   + G G        
Sbjct: 391 RNNGIRVPEFRFDPLFYGAFATPIGLMIFAWTCYSHVHWIGPVIGTSIFGAGVFFVFVGV 450

Query: 538 ITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLW 597
             Y VD+Y+ ++  A+   + V++ +      F ++  +++G    +  + L  + I + 
Sbjct: 451 FGYTVDAYRLYTASAMACNSFVRSTMSGIFPLFGLQ--MYKGMGINWAGFLLAMVAIAMI 508

Query: 598 AIP--LYRWGKLCRS 610
            IP   +++G   RS
Sbjct: 509 PIPFLFHKYGPYLRS 523

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 78/182 (42%), Gaps = 17/182 (9%)

Query: 161 MLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLST 220
           +  LG G +F SP + ++G+++ +++ + + ++  +    S +   +   R ++GF  S+
Sbjct: 136 IFGLGFGPLFLSPLSEMYGRKITFVMSLSMSIVWQVLTVWSPTIVGMFFGRFLAGFFGSS 195

Query: 221 VESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIA 280
             S+    I++I+   E    + +YT                ++  +S  W F  L I +
Sbjct: 196 FLSVAGGVISDIFTRQEIGIPMTVYTTSPFLGPALGPVVSGALY-GVSYKWTFIALLIAS 254

Query: 281 GSNFVLHLLFVPETFWDRTPV----PNKRSLHET---------RIARQVRGLSENVSIAT 327
           G   VL    VPET+    PV      KR   ET          I R+   ++  V ++T
Sbjct: 255 GVCLVLIAFTVPETY---QPVLLIGKAKRMRQETGDHGYFAPLEIVRRETNITSAVLLST 311

Query: 328 VR 329
            R
Sbjct: 312 RR 313

>Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W
           (REAL)
          Length = 542

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 59/134 (44%), Gaps = 8/134 (5%)

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESL 224
           G+   F    A   G+R V L  I+I+    IG AC+ ++  +++ R +   G+S V ++
Sbjct: 111 GLAPTFMGGFADSLGRRPVVLAAIIIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAI 170

Query: 225 PSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIA 280
            S  + +I    ER    G Y               +L+   LS  W    +FW L I +
Sbjct: 171 NSGIMGDITTRAER----GGYVGYAAGFQVLGSAFGALIGAGLSFRWGWRAIFWFLAIGS 226

Query: 281 GSNFVLHLLFVPET 294
           G  F+   L +PET
Sbjct: 227 GICFLASFLILPET 240

>Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W
           (REAL)
          Length = 591

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 59/134 (44%), Gaps = 8/134 (5%)

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESL 224
           G+   F    A   G+R V L  I+I+    IG AC+ ++  +++ R +   G+S V ++
Sbjct: 135 GLAPTFMGGFADSLGRRPVVLAAIIIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAI 194

Query: 225 PSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIA 280
            S  + +I    ER    G Y               +L+   LS  W    +FW L I +
Sbjct: 195 NSGIMGDITTRAER----GGYVGYAAGFQVLGSAFGALIGAGLSFRWGWRAIFWFLAIGS 250

Query: 281 GSNFVLHLLFVPET 294
           G  F+   L +PET
Sbjct: 251 GICFLASFLILPET 264

>KLTH0H09856g Chr8 (848950..850599) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 549

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 90/435 (20%), Positives = 162/435 (37%), Gaps = 87/435 (20%)

Query: 99  PSECKKDPLNWPIWRRDIALV------CV---GWHCFVGGGQTSMLASGFSKLSAELQVP 149
           PS+  ++P NW   ++   +V      CV   G   +  G +      G   +   L + 
Sbjct: 90  PSD-PENPHNWSRSKKGFVVVQIMILTCVTYMGASIYTPGQEYIQQEFGVGHVVGTLNLS 148

Query: 150 LSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLI 209
           L  + Y +GPM+ S        S TA  FG++ +YLV + +FMI  +G A   +   L++
Sbjct: 149 LYVLGYGLGPMVFSP------LSETA-RFGRQHIYLVTLFLFMIFQVGAATVHNIGGLVV 201

Query: 210 SRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLST 269
            R +SG   S   +  + ++ +          +G++               + +    + 
Sbjct: 202 IRFISGVLCSPALATGAGSMGDFISPELVPIFIGMWAVGAVAAPVLAPLLGAAMTVAENW 261

Query: 270 HWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVR 329
            W+FW+L  +A + F+L   F PET+          ++   R AR  R   +N       
Sbjct: 262 RWIFWLLMWLAAATFLLLAAFFPETY--------ASNILHRRAARIRRETGDN------- 306

Query: 330 STRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRH 389
             R   ++                    + AE+  KT+  I  I                
Sbjct: 307 --RYYTKQ--------------------ERAESEIKTKDFISEI---------------- 328

Query: 390 TIDNWCMVMLRPF-VLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGL 448
                   + RPF ++F  P +L      A    +  +  +     +  IY F+   +GL
Sbjct: 329 --------LYRPFEIIFKEPIVLAFDIYIALCYGAFYLFFEAFPIVFVGIYNFTLIELGL 380

Query: 449 VYIAPFIGGCLGSLIAGRG--SDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGF 506
                F+G C+G +IA     + +   ++    +  + PE  L + +       + L  F
Sbjct: 381 A----FLGFCVGCVIAYIAFLTFLAKVIMPKFKNNTFTPESFLLLAMSVCWSLPLSLFLF 436

Query: 507 GWSLERQDHWIIPSI 521
           GW+     HWI+P I
Sbjct: 437 GWA--AGVHWILPMI 449

>YLL028W Chr12 (84804..86564) [1761 bp, 586 aa] {ON}  TPO1Polyamine
           transporter that recognizes spermine, putrescine, and
           spermidine; catalyzes uptake of polyamines at alkaline
           pH and excretion at acidic pH; phosphorylation enhances
           activity and sorting to the plasma membrane
          Length = 586

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 90/446 (20%), Positives = 169/446 (37%), Gaps = 75/446 (16%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NWP+ ++ +  + +          +S+ AS   ++     V   ++  ++G  +  LG
Sbjct: 137 PFNWPMKKKVLLCLVLCLDSIAIAMCSSIFASAVPQICEIYHV--IEVVAILGITLFVLG 194

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  +  +P + L+G++ V ++    F +     A + +   + I R   GF  +   +
Sbjct: 195 FAASPVIYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTIFICRFFGGFIGAAPMA 254

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A  A+++  + R   + +++              S + +  +  WL +++   A + 
Sbjct: 255 VVPAAFADMFDTNVRGKAIALFSLGVFVGPILSPVMGSYIAQRTTWRWLEYVVGCFASAV 314

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           FV  +LF  ET    T + NK        A+Q+R  S N  I             A H  
Sbjct: 315 FVAIVLFFEETH-HPTILVNK--------AKQMRKQSNNWGI------------HAAH-- 351

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
                                     IK I +K +                     RP +
Sbjct: 352 --------------------EDVELSIKDIVQKTVT--------------------RPII 371

Query: 404 -LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL-GS 461
            LF  P +LF     ++    L ++ +     + + YGF+     L YIA  IG  +  +
Sbjct: 372 MLFVEPLLLFVTIYNSFVYGILYLLLEAYPLVFVEGYGFTENG-ELPYIALIIGMMVCAA 430

Query: 462 LIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWIIP 519
            I    +D   R  A    G   PE RL+ ++ A     IG+L F W+     + HW++P
Sbjct: 431 FIWYMDNDYLKRCRA---KGKLVPEARLYAMVIAGTVFPIGILWFCWTGYYPHKIHWMVP 487

Query: 520 SIFFGVLGFGSSMCSTTAITYAVDSY 545
           ++    +GFG        + Y ++SY
Sbjct: 488 TVGGAFIGFGLMGIFLPCLNYIIESY 513

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 70/169 (41%), Gaps = 14/169 (8%)

Query: 178 FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHE 237
           FG+R + L  IL +    IG AC+ ++  +L  R +   G+S V ++ S  + ++    E
Sbjct: 132 FGRRPIVLWAILAYFCACIGLACAHNYAQILALRCLQAAGISPVIAINSGIMGDVTTKVE 191

Query: 238 RAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPE 293
           R    G Y               +L+   LS+ W    +FW L I +G   V   L +PE
Sbjct: 192 R----GGYVGLVAGFQVVGTAFGALIGAGLSSKWGWRAIFWFLAIGSGICLVFSTLLMPE 247

Query: 294 TFWDRTPVPN----KRSLHETRIARQVRGLSENVSIATVRSTRLNPRES 338
           T   RT V N     RS     +   V  + + + +       L PR S
Sbjct: 248 T--KRTLVGNGSVTPRSFLNRSLILHVGSVKKTLHLDDPDPETLEPRTS 294

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 64/143 (44%), Gaps = 10/143 (6%)

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESL 224
           G+   F    A   G+R V L  IL++    IG A S ++  +++ R +   G+S V ++
Sbjct: 150 GLAPSFMGGLADSLGRRPVVLFSILVYCCACIGLALSQNYTQIVVLRCLQAAGISPVIAI 209

Query: 225 PSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIA 280
            S    +I    ER    G Y               +L+   LS+ W    +FW LTI +
Sbjct: 210 NSGICGDITTRAER----GAYVGYVSGFIVIGSAFGALIGAGLSSTWGWRSIFWFLTIGS 265

Query: 281 GSNFVLHLLFVPETFWDRTPVPN 303
           G   ++ ++ +PET   RT V N
Sbjct: 266 GICLMISIIVLPET--KRTLVGN 286

>Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W -
           Hypothetical ORF [contig 5] FULL
          Length = 529

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 54/117 (46%)

Query: 178 FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHE 237
           FG+R V L  + ++M   IG ACS ++  +L+ R +   G+S V ++ S  + ++    +
Sbjct: 83  FGRRPVVLWSVALYMAACIGIACSKTYAQILVLRCLQSAGISPVIAVNSGIMGDVTTREQ 142

Query: 238 RAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPET 294
           R   +G+                  +    S   +FW L I +G + V+  + +PET
Sbjct: 143 RGGYVGLTAGFQVIGSAFGALIGGGIVSTWSWRAVFWFLAIASGFSLVVTFIMLPET 199

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 32/77 (41%)

Query: 488 RLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKE 547
           RL ++   +L +    + FGW L+         +F GV    S+     A T  VD Y +
Sbjct: 369 RLEIIFAPLLLSGAAFIAFGWCLDVHAPLATVLVFSGVASLFSNCVIACATTLVVDLYPK 428

Query: 548 FSQEALVTLNMVKNILG 564
            S  A   +N  + I+ 
Sbjct: 429 KSSTATGCVNFARCIMA 445

>YOR273C Chr15 complement(834452..836431) [1980 bp, 659 aa] {ON}
           TPO4Polyamine transport protein, recognizes spermine,
           putrescine, and spermidine; localizes to the plasma
           membrane; member of the major facilitator superfamily
          Length = 659

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 97/237 (40%), Gaps = 14/237 (5%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NW   ++    +   + C V    +S+  S   +L     V  SQ   L G     L
Sbjct: 82  NPHNWSSLKKWYTTMTSAFLCLVVTMGSSLYVSSVPELVERYHV--SQTLALAGLTFYLL 139

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS-RVVSGFGLSTVES 223
           G+ ++  +P + +FG++ VYL  + + M+ ++G   S     +++  R +SG   S   S
Sbjct: 140 GLSTVIGAPLSEVFGRKPVYLFSLPVSMLFTMGVGLSNGHMRIILPLRFLSGVFASPALS 199

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + S TI +I+   + +  +  +                   E     W  WI  +IAG  
Sbjct: 200 VGSGTILDIFDVDQVSVAMTYFVLSPFLGPVLSPIMAGFATEAKGWRWSEWI-QLIAGGL 258

Query: 284 FVLHLLFVPET-----FWDRTPVPNKRSLHETRIARQVRG--LSENVSIATVRSTRL 333
            +  +  +PET        R     KR++   + +R+ +   L   V+I  +R  ++
Sbjct: 259 ILPFIALMPETHKGIILRKRA---KKRNIALKKFSREAQKEFLKTTVTITILRPLKM 312

>SAKL0H25498g Chr8 complement(2229233..2231041) [1809 bp, 602 aa]
           {ON} similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force-dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 602

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 102/520 (19%), Positives = 197/520 (37%), Gaps = 92/520 (17%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NW   ++      +  +C      +S+ +S   ++SA   V   Q+  ++G  +  LG
Sbjct: 152 PYNWTFKKKVFLCTILCLNCIGITMGSSIFSSAILQISAIYHV--HQVVAILGITLFVLG 209

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  +  +P + L+G++ V ++    F +     A +     ++I R   GF  +   +
Sbjct: 210 FAASPVIYAPLSELYGRQGVLVISSFGFALFQFAVATAKDLQTIMICRFFGGFIGAAPLA 269

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A  ++++    R   + ++               S + +H +  W+ ++  I A   
Sbjct: 270 VVPAAFSDMFDNKSRGTAVALFALGVFVGPILSPVFGSYITQHTTWRWVEYVTGIFASVV 329

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           FVL  +F  ET             H + + ++ + +         R+   N    A H  
Sbjct: 330 FVLVAIFFEETH------------HPSILVKKAKFM---------RAKTGNWGIHAAH-- 366

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAH-IKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPF 402
                    +++     E   KT A  IK +  + + + L IY       N  +  +   
Sbjct: 367 ---------EDAELSVKEIAQKTVARPIKMLFTEPILLLLTIY-------NSFVYGILYL 410

Query: 403 VLFSYPAILF-GAWLYAYAVVSLI--IISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCL 459
           +L +YP +   G   YA   +  I  II  +++ A+ +IY                    
Sbjct: 411 LLEAYPIVFIKGYHFYANGELPYIALIIGMIVNAAF-NIY-------------------- 449

Query: 460 GSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQD--HWI 517
                    D   R+ A  N G   PE RLF ++ + +   IG+L F W+    D  H++
Sbjct: 450 ------MERDYVKRVEA--NGGKPVPEARLFPMMVSGIIFPIGILWFCWTGNYPDKVHFM 501

Query: 518 IPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLH 577
           +P++    +GFG          Y +DSY   +  A+     ++       S F   F L 
Sbjct: 502 VPTVAGSFIGFGLMGIFLPCFNYIIDSYLFLAASAIAGNTFMR-------SGFGAVFPLF 554

Query: 578 EGYKNAFTCYALIEIFIGLWA---IPL----YRWGKLCRS 610
            G+           + +GL+A   +P+    Y++GK+ R 
Sbjct: 555 AGFMFDGMGTNWAGLLLGLFAAAMVPVPFLFYKYGKVLRQ 594

>TBLA0E02500 Chr5 (628027..629757) [1731 bp, 576 aa] {ON} 
          Length = 576

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 80/432 (18%), Positives = 154/432 (35%), Gaps = 75/432 (17%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NW  W++ + +  +     +    +S+   G  ++  E  V     +  +   +L  
Sbjct: 122 NPHNWKPWKKYLMMAEIMLLTCINYMGSSIYTPGEEEIQREFHVGHVVATLNLSMYVLGY 181

Query: 165 GVGSIFASPTA--VLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVE 222
           G+G +  SP +    FG+  +YLV   +F +  +G A   +   L++ R ++G   S   
Sbjct: 182 GIGPMILSPLSEYARFGRLYIYLVTFFMFGLFQVGSATVKTIGGLVVIRFIAGVLCSPAL 241

Query: 223 SLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGS 282
           +   A++++        Y LG+++              + +       W+FW L  +  +
Sbjct: 242 ATGGASLSDFLSTTSMPYFLGLWSIGAIAAPVLAPLLGACMVVAKDWRWIFWFLLFLVAA 301

Query: 283 NFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHV 342
             ++   F PET             H   I  +             R  RL         
Sbjct: 302 LLLVLSFFFPET-------------HAGNILHR-------------RCKRLR-------- 327

Query: 343 NDDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPF 402
                   +T +     A+   ++   +    +K                     +L+PF
Sbjct: 328 -------KITGDDRYYTAQYKKESTLEVNEFLKK--------------------CLLKPF 360

Query: 403 -VLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGS 461
            ++F  P IL      A A     +  +     +  IY F+   +GL     F+G C+G 
Sbjct: 361 RLIFQEPIILAFDLYTAVAYGIFYLFFEAFPIVFVGIYNFTVIELGLA----FLGFCVGC 416

Query: 462 LIAGRGSDVN--TRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIP 519
           + A     V     +     +G + PE  + + +   +   + L  FGW+   + HWI+P
Sbjct: 417 VFAYAIWVVFMWKYISPKFANGTFVPENMVVLGMYLCMFLPLTLFFFGWT--AKVHWILP 474

Query: 520 SI---FFGVLGF 528
            I   FF +  F
Sbjct: 475 IISELFFVIFTF 486

>TPHA0F00330 Chr6 (67642..69396) [1755 bp, 584 aa] {ON} Anc_4.30
           YLL028W
          Length = 584

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/191 (18%), Positives = 84/191 (43%), Gaps = 4/191 (2%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NWP+ ++ I  V +   C      +S+  +G ++L  E  +  + +  ++G  +  LG
Sbjct: 135 PFNWPLRKKVILCVILCLDCIAISMGSSIFGNGIAQLREEYGI--ATVVGILGVTLYVLG 192

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  +  +P + ++G++ V ++    F I     A + +   + I R   G   +   +
Sbjct: 193 FAASPVIYAPLSEIYGRKGVIIISAFGFSIFQFAVATAENLQTIFICRFFGGLIGAAPMA 252

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A  A+++  + R   + +++              S + +H +  WL +++   +   
Sbjct: 253 VVPAAFADMFDNNMRGKAISLFSLGVFVGPVLGPVIGSYIVQHTTWRWLEYVIGCFSALI 312

Query: 284 FVLHLLFVPET 294
           FVL  +F+ ET
Sbjct: 313 FVLICIFMEET 323

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 44/89 (49%), Gaps = 2/89 (2%)

Query: 485 PEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWIIPSIFFGVLGFGSSMCSTTAITYAV 542
           PE RL+ ++ + +  AIG+L F W+    ++ H+++P++    +GFG        + Y +
Sbjct: 449 PEIRLYPIIYSGVVFAIGILWFCWTGYYPKKIHFMVPTVAGAFIGFGLFGIFLPCLNYII 508

Query: 543 DSYKEFSQEALVTLNMVKNILGFAVSFFN 571
           +SY   +  A+     +++  G     F 
Sbjct: 509 ESYLFVAASAVAANTFLRSGFGAVFPLFT 537

>SAKL0B12628g Chr2 complement(1091243..1092856) [1614 bp, 537 aa]
           {ON} similar to uniprot|P38124 Saccharomyces cerevisiae
           YBR008C FLR1 Plasma membrane multidrug transporter
           member of the major facilitator superfamily involved in
           efflux of fluconazole diazaborine benomyl methotrexate
           and other drugs
          Length = 537

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 89/211 (42%), Gaps = 27/211 (12%)

Query: 97  PQPSECKKDPLNWPIWRRDIA------LVCVGWHCFVGGGQTSMLASGFSKLSAELQVPL 150
           P+ SE   +PLNW   ++ +       L CV          T M AS ++    E+Q   
Sbjct: 78  PKDSE---NPLNWSKGKKAVVVFEVMLLTCV----------TYMGASIYTPGQVEIQEEF 124

Query: 151 SQISYLVGPMMLSL-----GVGSIFASPTAVL--FGKRLVYLVGILIFMIGSIGCACSTS 203
             + ++VG + LSL     G+G +  SP + +   G++ +Y+  +  F I  IG A   +
Sbjct: 125 G-VGHVVGTLNLSLYVLGYGLGPMVFSPLSEVASIGRQQIYMWTLFFFAIFQIGAATVKN 183

Query: 204 FNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLV 263
              L++ R +SG   S   +  + ++ +I         +G++               + +
Sbjct: 184 IGGLIVIRFISGMLCSPALATGAGSMGDIMAPEIVPIFIGLWAVGAVAAPVMAPLLGAAM 243

Query: 264 FEHLSTHWLFWILTIIAGSNFVLHLLFVPET 294
                  W FW+L  ++   FV+ + F PET
Sbjct: 244 VVAKGWRWTFWLLLWLSAGTFVMLVAFFPET 274

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 62/131 (47%)

Query: 151 SQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS 210
           S+I +L+    LS  + ++     AV+FG +   +V I+IF IGS+  A S S + ++  
Sbjct: 55  SKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLVIAVSNSMDMIIGG 114

Query: 211 RVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTH 270
           RV++G G S +++L  A    +   H R   + + +                + E+++  
Sbjct: 115 RVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSLSYAVASALGPYIGGALTEYVTWR 174

Query: 271 WLFWILTIIAG 281
           W F+I   I G
Sbjct: 175 WCFYINLPIGG 185

>TBLA0E01510 Chr5 (346010..348025) [2016 bp, 671 aa] {ON} Anc_4.30
           YLL028W
          Length = 671

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 84/185 (45%), Gaps = 15/185 (8%)

Query: 400 RPFV-LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGC 458
           RP V LF+ P +LF     ++    L ++ +     + + YG+ +  + L Y +  +G  
Sbjct: 453 RPIVMLFTEPILLFITIYNSFVYGILYLMLEAYPIVFVEGYGYKTNGI-LPYCSLIVGMV 511

Query: 459 LGS-LIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDH 515
           L S  I     D   R+      G   PE RL+ ++P+ +  + G+L F W+   +R+ H
Sbjct: 512 LCSTFIWYMEKDYLRRV---ERKGKLVPEARLYPMIPSGVLFSAGILWFCWTGAWQRRIH 568

Query: 516 WIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNVKFC 575
           W++P+I   ++GFG        + Y ++SY   +  A+     ++       S F   F 
Sbjct: 569 WVVPTIAGSLIGFGLIGIFLPCLNYIIESYLLLTASAVAANTFMR-------SAFAGVFP 621

Query: 576 LHEGY 580
           L  GY
Sbjct: 622 LFAGY 626

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/236 (19%), Positives = 103/236 (43%), Gaps = 9/236 (3%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NWP+W+R +  + +   C      +S+ +SG  +L  +  +   ++  ++G  +  LG
Sbjct: 222 PFNWPLWKRSVLSLLLCLDCLNVSVGSSIFSSGMPQLEEKYHI--IEVVAILGVTLYVLG 279

Query: 166 VG--SIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGF-GLSTVE 222
                +  +P + L+G+R V ++    F +     A + +   ++I R  +GF G +   
Sbjct: 280 FAFSPVIYAPLSELYGRRGVIVISAFGFSLFQFAVATAENIQTIMICRFFAGFLGAAPFP 339

Query: 223 SLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGS 282
            +P+A  A+++  + R   + +++              S + ++ +  WL +++      
Sbjct: 340 VVPAA-FADMFDTNLRGKAICLFSMGVFLGPVIAPVMGSYMAKYTTWRWLNYLVACTGAF 398

Query: 283 NFVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIA---TVRSTRLNP 335
            FVL  LF  ET      V   + + +    + +R   E+V ++    +R T   P
Sbjct: 399 LFVLLFLFFDETNHPTILVNKAKEIRKKTNNKMIRAAHEDVELSIKLIIRDTVSRP 454

>KAFR0A04120 Chr1 complement(828182..829957) [1776 bp, 591 aa] {ON}
           Anc_8.723 YOR273C
          Length = 591

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 108/559 (19%), Positives = 203/559 (36%), Gaps = 100/559 (17%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NWP W++    +     C V    +S+  S  ++L   ++  + +   L G     L
Sbjct: 30  NPHNWPTWKKWYTTMASACMCLVVTMGSSLYVSSVTELV--MRYGIDRTLALSGLTFYLL 87

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS-RVVSGFGLSTVES 223
           G+ ++  +P + +FG++ +YL+ + +  + ++G   S     +++  R ++G   S   S
Sbjct: 88  GLSTVIGAPLSEVFGRKPIYLISLPLSCLCTMGVGLSNGHMRIILPLRFLAGVFASPALS 147

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           + S TI +I+   E +  +  +                         W  WI  + +G  
Sbjct: 148 IGSGTILDIFDVDEVSVAMTFFCLAPFMGPVLAPIMGDFACAARGWRWGSWIQLLASGLV 207

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           +   ++ +PET                 I  Q R    N+++  ++ T+           
Sbjct: 208 YPF-IILMPET--------------HKGIILQRRAKKRNLNL--IKPTK----------- 239

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
                    D  N  +          +K ++ + + +   IY                 V
Sbjct: 240 --------EDRKNFLKITMTITVFRPLKMLTVEPIVLVFSIY-----------------V 274

Query: 404 LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLI 463
            F + A+LF A+  AY V+            Y+ +Y  SS   GL ++   IG  +GSL 
Sbjct: 275 AFIF-AVLF-AFFEAYPVI------------YQSVYMMSSGVSGLPFLGIGIGLWIGSLF 320

Query: 464 ------------AGRGS---DVNTRLLAAHNHGIYEPEF-RLFMVLPAVL---CN----- 499
                       A  G+   +  T        G  +PE  +L  ++P  L   C      
Sbjct: 321 YILLDRKLLFPKAPEGTPELENPTSKRVQPYRGHRDPETNQLLPLIPEQLLLPCKIGAVA 380

Query: 500 -AIGLLGFGWSLERQDHWIIPSIFFGV-LGFGSSMCSTTAITYAVDSYKEF-SQEALVTL 556
             + L    W+     HW+ P I  GV  GFG  +   + I Y    Y        L   
Sbjct: 381 LPVALFWQAWTARTDVHWMAP-IAAGVPFGFGLILIFFSVIMYFSACYPPLVVASTLAAN 439

Query: 557 NMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLC--RSWTNR 614
           N+++ ++      F ++       K A T +ALI I +        R+GK    RS    
Sbjct: 440 NLLRYVMSSIFPLFTIQMYEKMKIKWASTLFALICIVMVPIPWIFERYGKKLRRRSMFGY 499

Query: 615 KNLLQFSYRVNDDGKDEKD 633
             +++   + + +G D ++
Sbjct: 500 AAMMKTEEKADTNGDDSQE 518

>TBLA0D01160 Chr4 (296153..298081) [1929 bp, 642 aa] {ON} Anc_8.723
           YOR273C
          Length = 642

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 80/191 (41%), Gaps = 4/191 (2%)

Query: 105 DPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSL 164
           +P NW   ++    +     C V    +S+  +G  ++   LQ   SQ   L G      
Sbjct: 63  NPHNWSTLKKWSCTMIAAILCLVVTMGSSLYVTGVPEMV--LQYHYSQTLALAGLTFYLF 120

Query: 165 GVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS-RVVSGFGLSTVES 223
           G+ +   +P + +FG++ VY++ + + M+ ++G A S     +++  R  SG   S   S
Sbjct: 121 GLSTTMGAPLSEVFGRKPVYVISLPLSMLFAMGVALSGGKQRIILPLRFFSGVFASPALS 180

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +   TI +++   E +  +  +               S   E     W  +I  +IAG  
Sbjct: 181 VAGGTIMDVFDIDEVSVSMTFFCLAPFLGPVISPVMASFATEKKGWRWATYI-QLIAGGV 239

Query: 284 FVLHLLFVPET 294
            +  L+ +PET
Sbjct: 240 IMPFLILMPET 250

>NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 64/140 (45%), Gaps = 10/140 (7%)

Query: 179 GKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHER 238
           G+R + L  I ++    IG AC  ++  +++ R +   G+S V ++ S  + +I    ER
Sbjct: 145 GRRPIVLCSIAVYFCACIGLACCQTYPQIVVLRCLQAAGISPVIAINSGIMGDITTRAER 204

Query: 239 AYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPET 294
               G +               +L+   +S+ W    +FW L I +G   ++  + +PET
Sbjct: 205 ----GGFVGYVSGFQVMGSAFGALIGAGISSTWSWRAIFWFLAIGSGICLIISFIILPET 260

Query: 295 FWDRTPVPNKRSLHETRIAR 314
              RT V N   + ++++ R
Sbjct: 261 --KRTIVGNGSIIPKSKLNR 278

>ZYRO0F02090g Chr6 complement(169045..170850) [1806 bp, 601 aa] {ON}
           similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force- dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 601

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 90/222 (40%), Gaps = 14/222 (6%)

Query: 396 MVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFI 455
           M++  P V F      FG W+     ++ + +S VI   + +   +S    GL YI+  I
Sbjct: 317 MLLSEPVVFF------FGMWIAFTWFITFLFLS-VITITFSEQKHWSEGIAGLPYISLCI 369

Query: 456 GGCLG---SLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWSLER 512
           G  LG   + +  R  D     + +   G   PE RL+  +   +   IGL  + ++   
Sbjct: 370 GVTLGFFLNFLQIRKYDK----IRSKATGAIAPEHRLYGAMAGGIFLPIGLFIYSFTQYH 425

Query: 513 QDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFFNV 572
             HWI P+I    + FG      +  +Y  D Y   +  A+   + ++N LG     F  
Sbjct: 426 WLHWIGPNIGLVCIAFGIFFIFESCYSYTSDCYGPSASSAIAGQSYLRNELGAVAPLFAA 485

Query: 573 KFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWTNR 614
           +       + A    +L+   + L    L+++G   R  + R
Sbjct: 486 QMFRGMHSEWAGLLCSLVGTGLSLLPFILFKFGPSIRGKSKR 527

>SAKL0H05412g Chr8 (486897..488639) [1743 bp, 580 aa] {ON} similar
           to uniprot|Q12256 Saccharomyces cerevisiae YOR273C TPO4
           Polyamine transport protein
          Length = 580

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 87/207 (42%), Gaps = 6/207 (2%)

Query: 101 ECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPM 160
           E   +P NW   ++  A +     C V    +S+  +G  +L     V  ++   L G  
Sbjct: 28  EDMDNPHNWSSLKKWYATMVAALLCLVVTMGSSLYVAGVPELVVSYGV--NETLALAGLT 85

Query: 161 MLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACS-TSFNWLLISRVVSGFGLS 219
              LG+ ++  +P + +FG++ +Y+  + + M+ ++G   S      +L  R  SG   S
Sbjct: 86  FYLLGLSTVIGAPLSEVFGRKPIYVASLPLSMLFTMGVGLSGGKMRVILPLRFFSGVFAS 145

Query: 220 TVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTII 279
              S+ S TI +I+   E +  +  +                   +     W  WI  +I
Sbjct: 146 PALSVASGTIVDIWDMDEVSIAMAFFCLAPFLGPVISPVMAGFAAQSKGWRWPSWI-QLI 204

Query: 280 AGSNFVLHLLFVPETFWDRTPVPNKRS 306
           AG   +  ++F+PET   +T +  KR+
Sbjct: 205 AGGIILPFIVFMPET--HKTVLLTKRA 229

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 46/115 (40%), Gaps = 6/115 (5%)

Query: 484 EPEFRLFMVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVD 543
           +PE  L +     +   IGL   GWS +   HW+ P       GFG  +   + + Y   
Sbjct: 368 KPERFLLICKVGAISLPIGLFWLGWSAKASVHWMAPVSAGVPFGFGLILIFFSVMMYFSA 427

Query: 544 SYKE-FSQEALVTLNMVKNILGFAVSFFNVKFC--LHEGYKN---AFTCYALIEI 592
           SY   F   AL   N+++ I       F ++    LH  +     AF C  ++ +
Sbjct: 428 SYPPLFVASALAANNLLRYITCCIFPLFTLQMYERLHIDWATSLFAFVCLGMLPL 482

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 58/114 (50%), Gaps = 1/114 (0%)

Query: 126 FVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYL 185
           F+G    ++L++    +++E +  L  IS++    +LS  +        + +FG++ + L
Sbjct: 163 FLGSLDGTILSTLLDYIASEFEA-LPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILL 221

Query: 186 VGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERA 239
              L+F +G + C  + +  WLL  R V+G G   + S+PS  I++I     RA
Sbjct: 222 FSNLMFGLGCLVCGTAPTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSRA 275

>KAFR0D05140 Chr4 (1010805..1012529) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/199 (19%), Positives = 83/199 (41%), Gaps = 16/199 (8%)

Query: 105 DPLNWPIWRRDIALV------CVGWH--CFVGGGQTSMLAS-GFSKLSAELQVPLSQISY 155
           +P NW  +++ + ++      C+ +        GQ+S+  + G  ++ A L + L  + Y
Sbjct: 120 NPQNWSNFKKVLIMIEIMLLTCITYMGASIYSIGQSSIQETFGVGQVVATLNLSLYALGY 179

Query: 156 LVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSG 215
            +GP++ S             + G++++Y +   +F +  IG A   +   L++ R ++G
Sbjct: 180 GIGPVIFS-------PFSEVAMVGRQVIYTLTFFVFTMFQIGAATVQNIGGLIVLRFLTG 232

Query: 216 FGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWI 275
              S   +   AT+ +I         L I+               + +    +  W+FW 
Sbjct: 233 IVCSPALATGGATVGDIITPKNLPLCLSIWDLGPTFAPIIGPLLGASMMVAKNWRWIFWF 292

Query: 276 LTIIAGSNFVLHLLFVPET 294
           +T I+G   +  +   PET
Sbjct: 293 MTWISGFTLITMIFLFPET 311

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 59/129 (45%), Gaps = 2/129 (1%)

Query: 175 AVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYF 234
           A ++G+R V L G+L++++ SIG A   S+  ++  R +   G+S + ++ S  + +   
Sbjct: 158 ADIYGRRPVILFGMLVYVVASIGIAACNSYGVIIFLRCLQSTGISPLIAISSGAVGDFTV 217

Query: 235 AHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPET 294
             ER   +G  +              + +    +   +FW L I  G+   +  + +PET
Sbjct: 218 KAERGTFVGAVSGLVLMGQAFGSLIGAALAAAYNWRAIFWFLAIGCGACMAIAGIVLPET 277

Query: 295 FWDRTPVPN 303
              RT V N
Sbjct: 278 --KRTLVGN 284

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 79/164 (48%), Gaps = 12/164 (7%)

Query: 81  GSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFS 140
           GS D+   ++ G+  +P P +           +  +  + +    F+     +++++  +
Sbjct: 56  GSIDNEDDSRDGVASSPVPPD-----------KLLVITLSMYLGIFLAAADGTLVSTIMA 104

Query: 141 KLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCAC 200
            +++E    L +IS++    +LS           + +FG++ + ++  ++F++G + C  
Sbjct: 105 HIASEFN-ELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGL 163

Query: 201 STSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGI 244
           + SF  L+ +R +SG G   V S+ S TI++I    +RA   G+
Sbjct: 164 TPSFWGLVGARFISGIGGGGVTSMCSITISDIVPLRDRALYQGM 207

>KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS- MDR)
          Length = 563

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 8/121 (6%)

Query: 178 FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHE 237
           FG+R + +  I +++   IG ACS ++  +L+ R +   G+S V ++ S  + ++    +
Sbjct: 107 FGRRPIVMWSIALYLAACIGIACSRTYAQILVLRCLQSAGISPVIAVNSGIMGDVTTRAQ 166

Query: 238 RAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPE 293
           R    G Y               +L+   + + W    +FW L I +G + V   L +PE
Sbjct: 167 R----GGYVGLTAGFQVLGSAFGALIGGGIVSTWGWRAIFWFLAIGSGCSLVCSSLLLPE 222

Query: 294 T 294
           T
Sbjct: 223 T 223

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 75/203 (36%), Gaps = 41/203 (20%)

Query: 398 MLRPFVLFSYPAI----LFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAP 453
           +L P  +F  P I    L     ++  V  L  +S +++   KD Y    A VGL Y+  
Sbjct: 272 LLAPLDVFRRPEIALLLLVTGLQFSLWVCHLTALSSLLE---KD-YHLKVAEVGLSYLPS 327

Query: 454 FIGGCLGSLIAGRGSDVN-TRLLAAHNHGIYEPEFRLF---------------------- 490
            I   +  + AGR  + N  R L+ HN  I E   RL                       
Sbjct: 328 GICTLISVVGAGRVLNWNYRRRLSKHNLFIEEATQRLLAENDNDEKRVDKILSTDISYTF 387

Query: 491 ---------MVLPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYA 541
                    M +P +L    G +GFGW L+     +   +F G     S+     A T  
Sbjct: 388 NIFRARLEIMFVPLLLSGG-GFMGFGWCLDAHTPLVAVLVFSGFASLFSNCVIACATTLV 446

Query: 542 VDSYKEFSQEALVTLNMVKNILG 564
           VD Y + S  A   +N  + +L 
Sbjct: 447 VDLYPQKSSTATGCVNFSRCVLA 469

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 69/167 (41%), Gaps = 14/167 (8%)

Query: 178 FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHE 237
           FG+R V L  +L +    IG A S ++  +L  R +   G+S V ++ S  + ++    E
Sbjct: 128 FGRRPVVLWAVLTYCCACIGLASSHNYAQILALRCLQAAGISPVIAINSGIMGDVTTKVE 187

Query: 238 RAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPE 293
           R    G Y               +L+   LS+ W    +FW L I +G   V+  L +PE
Sbjct: 188 R----GGYVGLVSGFQVVGTAFGALIGAGLSSRWGWRAIFWFLAIGSGICLVVSALLLPE 243

Query: 294 TFWDRTPVPN----KRSLHETRIARQVRGLSENVSIATVRSTRLNPR 336
           T   RT V N     RS     +   V  + + + +       L PR
Sbjct: 244 T--KRTLVGNGSITPRSFLNRALILHVASVRKTLHLDAPELDTLEPR 288

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 65/132 (49%), Gaps = 1/132 (0%)

Query: 113 RRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFAS 172
           R  I ++ +    F+     +++++  + +++E    L +IS++    +LS         
Sbjct: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFN-ELPRISWVATAYLLSSATFQPIYG 177

Query: 173 PTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEI 232
             + +FG+++V +   + F +GS+ C  S SF WL+  R ++G G   + S+ S T ++I
Sbjct: 178 KISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDI 237

Query: 233 YFAHERAYRLGI 244
                RA   GI
Sbjct: 238 VPLRNRALYQGI 249

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 116 IALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTA 175
           I+ +C+G   F+     +++ +  S +++E    LS IS++    +LS           +
Sbjct: 64  ISSMCLG--SFLAALDNTIVTTLLSHIASEFN-ELSHISWIATAYLLSSATFQPLYGKIS 120

Query: 176 VLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFA 235
            +FG+R + ++  L F++G + C  S +   L+  R ++G G   V SL S T ++I   
Sbjct: 121 DIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVPL 180

Query: 236 HERAYRLGIY 245
             RA   GI+
Sbjct: 181 RSRALYQGIF 190

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 80/172 (46%), Gaps = 7/172 (4%)

Query: 76  GQESGGS---DDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQT 132
           G +S G+   DD    + +  +  P PSE  +  L+    R  I ++ +    F+     
Sbjct: 43  GHDSYGATAVDDRTATSARCDLTFP-PSETPEFALSSS--RIRIIMISMFLGIFLAALDG 99

Query: 133 SMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFM 192
           +++++  +++ +E    L ++S++    +LS           +   G++ + +   ++F 
Sbjct: 100 TIVSTLLTRIGSEFN-SLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFS 158

Query: 193 IGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGI 244
           IG + C  STS  W+++ R VSG G   +  L S  I+++    ERA   G+
Sbjct: 159 IGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGL 210

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 62/144 (43%), Gaps = 1/144 (0%)

Query: 151 SQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLIS 210
           + + +LV    LS  + ++     A L G +   ++ +LIF IGS+  A S S   L+  
Sbjct: 78  NDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVSNSMGMLIAG 137

Query: 211 RVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTH 270
           RVV+G G S ++SL       +     R   + + T                + EH S  
Sbjct: 138 RVVAGAGGSGIQSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNAGGPILGGALNEHASWR 197

Query: 271 WLFWI-LTIIAGSNFVLHLLFVPE 293
           W F+I L I   + F+L L + P 
Sbjct: 198 WCFFINLPIGGAAAFMLFLCYNPS 221

>NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa]
           {ON} 
          Length = 587

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 62/141 (43%), Gaps = 10/141 (7%)

Query: 178 FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHE 237
            G+R V L  + ++    +G AC+ ++  +++ R +   G+S V ++ S  + ++    E
Sbjct: 157 LGRRPVVLFSVAVYFCACVGLACAQTYPQIIVLRCLQAAGISPVIAINSGIMGDVTTRAE 216

Query: 238 RAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPE 293
           R    G Y               +L+   +S+ W    +FW L I +G   +   + +PE
Sbjct: 217 R----GGYVGYVSGFQVLGNSFGALIGAGISSTWSWRAIFWFLAIGSGICLLASFIVLPE 272

Query: 294 TFWDRTPVPNKRSLHETRIAR 314
           T   RT   N   + ++R  R
Sbjct: 273 T--KRTIAGNGSIIPKSRFNR 291

>KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 59/130 (45%), Gaps = 10/130 (7%)

Query: 178 FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHE 237
            G+R V L  ++I+    +G A   ++  ++  R V   G+S V ++ S  + ++    E
Sbjct: 144 LGRRPVVLSSVIIYFCACVGLARCNTYAQIIALRCVQAAGISPVIAINSGMMGDVTTKAE 203

Query: 238 RAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPE 293
           R   +G  +              +L    LS+ W    +FW L I +G+  ++ LL +PE
Sbjct: 204 RGGYVGYVSGFQVVGTATGAVFGAL----LSSRWGWRSIFWFLAIGSGACSIVSLLLLPE 259

Query: 294 TFWDRTPVPN 303
           T   RT V N
Sbjct: 260 T--KRTIVGN 267

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 71/155 (45%), Gaps = 13/155 (8%)

Query: 144 AELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTS 203
            E QV +S + Y +   +    +G +  S      G+R V L  I+++    IG A  T+
Sbjct: 133 TEEQVNVSVVVYFIFQALSPTLMGGLADS-----LGRRPVVLSSIVLYFCACIGLARCTN 187

Query: 204 FNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLV 263
           ++ L+  R +   G+S V ++ S  + ++    ER   +G+ +              +L+
Sbjct: 188 YSQLIGLRCLQAAGISPVIAVNSGIMGDVTTKAERGGYMGLVS----GTQVLGTAFGALI 243

Query: 264 FEHLSTHW----LFWILTIIAGSNFVLHLLFVPET 294
              LS+ W    +FW L I +G   ++ ++ +PET
Sbjct: 244 GAGLSSRWSWRSIFWFLVIGSGICLIVSIIVLPET 278

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 64/133 (48%), Gaps = 3/133 (2%)

Query: 113 RRDIALVCVGWHCFVGGGQTSMLASGFSKLSAEL-QVPLSQISYLVGPMMLSLGVGSIFA 171
           + +I +  +    F+     +++++  + + +E  Q+P  ++ ++    +LS  V     
Sbjct: 395 KMNIIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIP--KVPWVATSYLLSSAVFQPLY 452

Query: 172 SPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAE 231
              + +FG++ + +   LIF  G I C  S S N L+  R V+G G   + S+ + T+++
Sbjct: 453 GKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAGIGGGGITSMTTITVSD 512

Query: 232 IYFAHERAYRLGI 244
           I     RA   GI
Sbjct: 513 IVPLRSRAVYQGI 525

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 66/141 (46%), Gaps = 1/141 (0%)

Query: 104 KDPLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLS 163
            D  N    R  +A+  +    F+     +++++  +++ +E    L +IS++    +LS
Sbjct: 84  NDKNNLSPTRLRLAMSSMYLGIFLSALDNTIVSTLLARIGSEFN-ELPRISWIATAYLLS 142

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
                      + +FG+++V     + F IG + C  + SF  L+I R +SG G   + S
Sbjct: 143 SATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAKSFWVLVIGRFISGVGGGGITS 202

Query: 224 LPSATIAEIYFAHERAYRLGI 244
           + + T+++I     RA   G+
Sbjct: 203 MSTITVSDIIPLRNRALYQGV 223

>ZYRO0D11088g Chr4 complement(937064..938680) [1617 bp, 538 aa] {ON}
           similar to uniprot|Q04162 Saccharomyces cerevisiae
           YDR387C Hypothetical ORF
          Length = 538

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 58/129 (44%), Gaps = 2/129 (1%)

Query: 167 GSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPS 226
           GSI A PTA  +G++    +   +F++ +I  A STS  +L+I R++ G  +        
Sbjct: 105 GSIIAFPTADKYGRKSTMALCCTVFVVAAIWMALSTSLTFLVIGRLIVGVAVGVAAQCVP 164

Query: 227 ATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWI-LTIIAGSNFV 285
             ++EI  A  R   L + T              SL  +++   W +   L  +    F+
Sbjct: 165 VYLSEISPASTRGLVLALNT-LAITGGQLISYVVSLSMQNVQHSWRYLFGLAALPAIIFL 223

Query: 286 LHLLFVPET 294
           L L F+PE+
Sbjct: 224 LILDFIPES 232

>CAGL0G03927g Chr7 complement(372896..374599) [1704 bp, 567 aa] {ON}
           highly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028w TPO1 polyamine transport protein
          Length = 567

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 85/469 (18%), Positives = 174/469 (37%), Gaps = 71/469 (15%)

Query: 106 PLNWPIWRRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLG 165
           P NW +  + I  + +  +C      +S+ ASG  ++     V    +  ++G  +   G
Sbjct: 118 PFNWSMKTKTIICIVLCLNCICISMGSSIFASGVPQICKIYHV--IPVVAILGVTLYVFG 175

Query: 166 VGS--IFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
             +  +  +P + ++G+R V ++    F +     A S     ++I R   G   +   +
Sbjct: 176 FAASPVIYAPLSEVYGRRGVLVISAFGFAVFQFAVATSKDLQSIMICRFFGGLIGAAPMA 235

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A  A+++    R   + +++              S + +  +  WL ++    A + 
Sbjct: 236 VVPAAFADMFDVRVRGKAICLFSLGVFVGPILSPVMGSYIAQRTTWRWLEYVTGCFASAL 295

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTRLNPRESAGHVN 343
           FV   L    TF        K + H T + ++ + + ++ +   + +          HV 
Sbjct: 296 FVAVAL----TF--------KETHHPTILVQKAKEMRKSTNNWGIHAAH-------EHV- 335

Query: 344 DDGVPVGLTDESNAQEAETGSKTRAHIKSISEKQMAIGLGIYHGRHTIDNWCMVMLRPFV 403
                     E +  E    + TR  IK +  + + + + IY+                 
Sbjct: 336 ----------ELSVSEIAKKTITRP-IKMLFTEPLLLIITIYNS---------------- 368

Query: 404 LFSYPAILFGAWLYAYAVVSLIIISQVIDHAYKDIYGFSSASVGLVYIAPFIGGCLGSLI 463
                        + Y ++ L++ +  I   + + YGF  A+  L YIA  IG  + +  
Sbjct: 369 -------------FVYGILYLMLEAYPI--VFVEGYGFE-ANGELPYIALIIGMLVCTAF 412

Query: 464 AGRGSDVNTRLLAAHNHGIYEPEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWIIPSI 521
                  N  L      G   PE RL  ++ A +   IG+L F W+     + HW+ P++
Sbjct: 413 LWYFE--NDYLKRIQKAGKLVPEARLIPMVYAGVIFPIGILWFCWTGYYPHKIHWMCPTV 470

Query: 522 FFGVLGFGSSMCSTTAITYAVDSYKEFSQEALVTLNMVKNILGFAVSFF 570
               +GFG        + Y ++SY   +  A+     +++  G     F
Sbjct: 471 AGSFIGFGLMGIFLPCLNYIIESYLPLAASAVAANTFMRSAFGAVFPLF 519

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 59/130 (45%), Gaps = 10/130 (7%)

Query: 178 FGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHE 237
            G+R V L  ++I+    IG A S ++  ++I R +   G+S V ++ S  + ++    E
Sbjct: 138 LGRRPVVLWSVVIYFGACIGLALSQNYTQIIILRCLQAAGISPVIAINSGIMGDVTTKAE 197

Query: 238 RAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPE 293
           R    G Y               +L+   LS+ W    +FW L I +G+  ++    +PE
Sbjct: 198 R----GGYVGYVAGFQILGSALGALIGAALSSRWDWRAIFWFLAIGSGACALVSFFVLPE 253

Query: 294 TFWDRTPVPN 303
           T   RT V N
Sbjct: 254 T--KRTVVGN 261

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 58/145 (40%), Gaps = 4/145 (2%)

Query: 175 AVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYF 234
           A L G +   L  I+IF +GS+  A + S + L+  RV++G G S V+SL     + +  
Sbjct: 102 ATLVGFKTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVE 161

Query: 235 AHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPET 294
              R   + + +                   H++  W F+I   + G  F L L F    
Sbjct: 162 ERNRGLIIAVMSSSFGIASVVGPFLGGAFTTHVTWRWCFYINLPVGGLAFFLFLTFYNPE 221

Query: 295 FWDRTPVPNKRSLHETRIARQVRGL 319
            W    V NK +  +  +     GL
Sbjct: 222 KW----VVNKDTAEDEVVGNGRLGL 242

>Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON}
           (12238..13980) [1743 nt, 581 aa]
          Length = 580

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 63/137 (45%), Gaps = 20/137 (14%)

Query: 485 PEFRLFMVLPAVLCNAIGLLGFGWS--LERQDHWIIPSIFFGVLGFGSSMCSTTAITYAV 542
           PE RL+ ++ A +   IG+L F W+     + HWI+P+I    +GFG        + Y +
Sbjct: 445 PEARLYPMIVAGVVFPIGILWFCWTGYYPHKIHWIVPTIAGSFIGFGLMGIFLPCLNYII 504

Query: 543 DSYKEFSQEALVTLNMVKNILGFAVSFFNVKFCLHEGY--KNAFTCYALIEIFIGLWA-- 598
           +SY   +  A+     ++       S F   F L  GY   N  T +A   + +GL+A  
Sbjct: 505 ESYLFLAASAVAANTFMR-------SMFGAVFPLFAGYMFHNMGTGWA--GLVLGLFAAA 555

Query: 599 -IP----LYRWGKLCRS 610
            IP    L ++GK  R 
Sbjct: 556 MIPVPLLLLKYGKAIRQ 572

>ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON}
           similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force-dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 592

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/229 (19%), Positives = 91/229 (39%), Gaps = 4/229 (1%)

Query: 106 PLNWPIWRRDIALVC-VGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYL-VGPMMLS 163
           P NW I ++ + L C +   C      +S+ ASG  ++  E+   +  ++ L +   +L 
Sbjct: 143 PFNWSI-KKKVWLCCWLCLDCIAIAMGSSIFASGVEQI-CEIYHVIPVVAILGIALYVLG 200

Query: 164 LGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVES 223
                I  +P + L+G+R V ++    F I     A +     ++I R  +GF  +   +
Sbjct: 201 FAASPIIYAPLSELYGRRGVLVISSFGFAIFHFAVATAKDLQTIMICRFFAGFIGAAPMA 260

Query: 224 LPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSN 283
           +  A   +++  + R   + ++               S + +H +  WL ++    +   
Sbjct: 261 VVPAAFTDMFDTNFRGKVMALFALGVFVGPIIGPVMGSYIVQHTTWRWLEYVTACFSSLV 320

Query: 284 FVLHLLFVPETFWDRTPVPNKRSLHETRIARQVRGLSENVSIATVRSTR 332
           FV  +LF  ET      V     L +      +R   E+V ++     +
Sbjct: 321 FVGIILFYDETHHATILVSKASELRKKSGNWGIRASHEDVELSIAEIAK 369

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 66/163 (40%), Gaps = 6/163 (3%)

Query: 152 QISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISR 211
            I +LV    LS  V  +     A + G +   ++ +++F IGS+  A S S   L+  R
Sbjct: 44  NIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGR 103

Query: 212 VVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW 271
           VV+GFG S +ESL       I   + R   +                      EHLS  W
Sbjct: 104 VVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHLSWRW 163

Query: 272 LFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIAR 314
            F+I   I    F++        F + +  P+++    ++I +
Sbjct: 164 CFYINLPIGAFAFIIL------AFCNTSGEPHQKMWLPSKIKK 200

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 53/121 (43%), Gaps = 1/121 (0%)

Query: 174 TAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIY 233
           TA L G +    + I IF +GSI  A +TS + L++ RV++G G S +++L     + I 
Sbjct: 116 TASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVGRVIAGVGGSGLQTLSLVIGSSIV 175

Query: 234 FAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWI-LTIIAGSNFVLHLLFVP 292
               RA  + I                     H+   W FWI L I A +  + +  + P
Sbjct: 176 EEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHVIWRWCFWINLPIGAVTALLFYFTYNP 235

Query: 293 E 293
           +
Sbjct: 236 K 236

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 49/118 (41%), Gaps = 1/118 (0%)

Query: 177 LFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAH 236
           L G +   L+ I IF +GSI  A +TS N L++ RVV+G G S ++++       +    
Sbjct: 136 LLGFQSSMLISIFIFEVGSIVSATATSMNNLVVGRVVAGIGGSGLQTVSMIIGCSLVEER 195

Query: 237 ERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGS-NFVLHLLFVPE 293
            R   + +                     H +  W FWI   + GS  F+    + PE
Sbjct: 196 NRTIVIAVIMSAFAVSSLIGPFIGGAFTTHATWRWCFWISLPVGGSAAFLFFFTYNPE 253

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 61/148 (41%), Gaps = 5/148 (3%)

Query: 175 AVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYF 234
           A + G +   L  I+IF +GS+  A + S + L+  RV++G G S +++L    I+ +  
Sbjct: 114 AAVCGFKSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVE 173

Query: 235 AHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPET 294
             +R   +                       H++  W FWI   I G  F   +LF    
Sbjct: 174 ESKRGLLIACMGSAFGIASVVGPFLGGAFTTHVTWRWCFWINLPIGGLAFAFFILFYNPH 233

Query: 295 FWDRTPVPNKRSLHETRIARQVRGLSEN 322
             D+T V      + T   +QV G  +N
Sbjct: 234 GSDQTFVG-----YVTDFFKQVGGWLKN 256

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 62/131 (47%), Gaps = 1/131 (0%)

Query: 113 RRDIALVCVGWHCFVGGGQTSMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFAS 172
           RR I   C+  + F     +S+L    SK+++E    L ++S +V   +LS  +G +   
Sbjct: 247 RRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFH-ELWRLSLIVSVYLLSNAIGQLLFL 305

Query: 173 PTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEI 232
             +++   +L+  +    F++GS     S+ F   + +R V+GFG  ++ +L S  +   
Sbjct: 306 KLSIISSVKLLLCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRF 365

Query: 233 YFAHERAYRLG 243
              +E  Y L 
Sbjct: 366 SQKNESRYSLS 376

>NDAI0A04360 Chr1 (981092..982726) [1635 bp, 544 aa] {ON} Anc_5.469
          Length = 544

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 57/130 (43%), Gaps = 2/130 (1%)

Query: 166 VGSIFASPTAVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLP 225
           +GSI A P A   G+R+   +  ++F+I  I  A S S  +L++ R++ G  +       
Sbjct: 95  LGSIIAFPLADRCGRRITLAICCMVFIISGIWMALSRSLLFLVVGRLIVGIAVGVAAQCT 154

Query: 226 SATIAEIYFAHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWI-LTIIAGSNF 284
              ++EI  A+ R + L +                + V   LS  W +   ++ I    F
Sbjct: 155 PIYLSEISPANVRGFMLTL-NSVAITGGQLLSYMFAFVLRDLSQSWRYLFGISAIPAIMF 213

Query: 285 VLHLLFVPET 294
           +  L F+PE+
Sbjct: 214 ISLLDFIPES 223

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 53/120 (44%), Gaps = 1/120 (0%)

Query: 175 AVLFGKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYF 234
           A + G +   LV ILIF  GS+  A S S N L+  RVV+G G S ++SL     + +  
Sbjct: 177 ATIIGFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVIASTLTP 236

Query: 235 AHERAYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHWLFWILTIIAGSNF-VLHLLFVPE 293
              R   + + +                +  H++  W F+I   I G  F VL +++ P 
Sbjct: 237 DRSRVIIISVLSCSYAVAAVVGPFLGGALTTHVTWRWCFYINLPIGGLAFVVLAMVYNPS 296

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 57/129 (44%), Gaps = 10/129 (7%)

Query: 179 GKRLVYLVGILIFMIGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHER 238
           G+R + L  I ++ +  IG A + ++  +L  R +   G+S V ++ +  I +I    ER
Sbjct: 143 GRRPIVLCSIALYAVACIGLASAQNYGEVLFLRCLQSAGISPVVAVNNGIIGDITTKAER 202

Query: 239 AYRLGIYTXXXXXXXXXXXXXXSLVFEHLSTHW----LFWILTIIAGSNFVLHLLFVPET 294
              LG+                +L+   ++  W    +FW L I +G +  +    +PET
Sbjct: 203 GGYLGLMA----GTQVIGSAFGALIGAGITARWGWRAIFWFLAIGSGFSLAVASFLLPET 258

Query: 295 FWDRTPVPN 303
              RT V N
Sbjct: 259 --KRTVVGN 265

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,973,964
Number of extensions: 2292137
Number of successful extensions: 8392
Number of sequences better than 10.0: 572
Number of HSP's gapped: 8093
Number of HSP's successfully gapped: 742
Length of query: 638
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 522
Effective length of database: 40,180,143
Effective search space: 20974034646
Effective search space used: 20974034646
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)