Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_72562.532ON24324312031e-169
Agos_YGOB_Anc_2.5322.532ON1871951975e-18
SAKL0A09460g2.532ON2402401972e-17
KLTH0D06820g2.532ON2601781631e-12
Kwal_26.80162.532ON2402331593e-12
ZYRO0B01980g2.532ON1882001476e-11
TPHA0C041802.532ON2641801435e-10
NCAS0D026402.532ON2602181303e-08
CAGL0K02981g2.532ON2782091303e-08
TBLA0G022202.532ON2782411261e-07
Kpol_1018.342.532ON2921751252e-07
YMR069W (NAT4)2.532ON2851751242e-07
Smik_13.2482.532ON2552151198e-07
NDAI0I022702.532ON2771921144e-06
TDEL0A030602.532ON2442631135e-06
KAFR0A018502.532ON2562381101e-05
Skud_13.2252.532ON254167993e-04
KLLA0E18569g2.532ON215181910.003
KNAG0C058202.532ON27164830.039
KLLA0A12089gsingletonON18176810.044
Kwal_26.88778.697ON16265800.054
Suva_13.2442.532ON257161790.13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_7256
         (243 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...   468   e-169
Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...    80   5e-18
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...    80   2e-17
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...    67   1e-12
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    66   3e-12
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    61   6e-11
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...    60   5e-10
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...    55   3e-08
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...    55   3e-08
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...    53   1e-07
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...    53   2e-07
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...    52   2e-07
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...    50   8e-07
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...    49   4e-06
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...    48   5e-06
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...    47   1e-05
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...    43   3e-04
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    40   0.003
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...    37   0.039
KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} simil...    36   0.044
Kwal_26.8877 s26 (987655..988143) [489 bp, 162 aa] {ON} YOR253W ...    35   0.054
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...    35   0.13 

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score =  468 bits (1203), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 226/243 (93%), Positives = 226/243 (93%)

Query: 1   MEYPAEILALYINDAFPEQLACRNGCTLSRDIIITDRLSVAARQKFAKQLTAIIERTLGC 60
           MEYPAEILALYINDAFPEQLACRNGCTLSRDIIITDRLSVAARQKFAKQLTAIIERTLGC
Sbjct: 1   MEYPAEILALYINDAFPEQLACRNGCTLSRDIIITDRLSVAARQKFAKQLTAIIERTLGC 60

Query: 61  FYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGGAIAGFVSLLFCDEPHW 120
           FYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGGAIAGFVSLLFCDEPHW
Sbjct: 61  FYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGGAIAGFVSLLFCDEPHW 120

Query: 121 PAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEIHVSPSFQNQGLGSCM 180
           PAGNG            GPSGRSAEPAFEET     CKVVYVMEIHVSPSFQNQGLGSCM
Sbjct: 121 PAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVMEIHVSPSFQNQGLGSCM 180

Query: 181 LLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTATNTEFFLSNSELTVMY 240
           LLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTATNTEFFLSNSELTVMY
Sbjct: 181 LLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTATNTEFFLSNSELTVMY 240

Query: 241 CSI 243
           CSI
Sbjct: 241 CSI 243

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score = 80.5 bits (197), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 89/195 (45%), Gaps = 50/195 (25%)

Query: 49  QLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGGAIAG 108
            LTA++   L   Y  HA LLYPRL     W   KRAEL      H+LYR  +P G +A 
Sbjct: 43  DLTALVAAGLAPLYRAHARLLYPRLRDPAAWPRCKRAELLDPAALHILYR--DPAGRLAC 100

Query: 109 FVSLLFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEIHVS 168
           F+SLL                        GP    A+P            V+Y++E+HV+
Sbjct: 101 FISLLL----------------------PGP----ADP------------VLYILELHVA 122

Query: 169 PSFQNQGLGSCMLLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTATNTE 228
             F+ +GL + +L  A +  +        L  LELTVFT NR ALALY R GF+      
Sbjct: 123 APFRRRGLAAALLDAATRTARAA-----GLTRLELTVFTANRPALALYARAGFRPRRAL- 176

Query: 229 FFLSNSELTVMYCSI 243
               + +LT+M C +
Sbjct: 177 ----HPDLTIMVCRL 187

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score = 80.5 bits (197), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 99/240 (41%), Gaps = 54/240 (22%)

Query: 1   MEYPAEILALYINDAFPEQLACRNGCTLSRDIIITDRLSVA---------------ARQK 45
           ++YPA +L  Y+ D+FP  +  ++G   +R +++ D  S                 +   
Sbjct: 2   VDYPANVLLPYVLDSFPTSITLKDGSLATRKVLVIDEPSSGIAPSGQVCTWSGDRQSSNS 61

Query: 46  FAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGGA 105
              Q   +++  LG  Y   +  LY     +R W  +K  E+Q +G  +V Y +   G +
Sbjct: 62  LLIQFLKVLDLNLGSKYRSVSATLY---GNTRSWTENKLEEMQTIGLVYVGYFQ---GVS 115

Query: 106 IAGFVSLLFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEI 165
              F+S L  DEP +                        +P           KVVY+ EI
Sbjct: 116 PLMFLSFLLTDEPDF----------------------LPDP----------VKVVYLYEI 143

Query: 166 HVSPSFQNQGLGSCML-LCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTA 224
            + P  Q Q LG+ ML +  +  V  +    P LKG+ELTVF+ N  AL LY   G   A
Sbjct: 144 QLLPEVQGQRLGTQMLQVYLKNTVHSLSRLDPLLKGIELTVFSDNDAALHLYYSIGMALA 203

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 78/178 (43%), Gaps = 36/178 (20%)

Query: 48  KQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGGAIA 107
            QL +++   LG  Y  HA  +Y    +S  W A KRAE++  G  +V+Y   +    + 
Sbjct: 79  DQLLSLVTANLGPMYTRHARAIYGAGRQS--WPARKRAEMETPGLVYVVYSDSHSQPLV- 135

Query: 108 GFVSLLFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEIHV 167
            F+SLL  DEP                               E       +V+Y+ EIHV
Sbjct: 136 -FMSLLLTDEP-------------------------------ELGQELAARVLYLFEIHV 163

Query: 168 SPSFQNQGLGSCMLL-CARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTA 224
           S   + QGLG+ +L  C    +  +  + P + G ELTVF+ N++AL LY   G   A
Sbjct: 164 SDIIRGQGLGTHLLRDCLGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGMHVA 221

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 65.9 bits (159), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 105/233 (45%), Gaps = 44/233 (18%)

Query: 2   EYPAEILALYINDAFPEQLACRNGCTLSRDIIITDRLSVAARQKFA-----KQLTAIIER 56
           +YPA+ L  ++ D+FP  L   +G  + R +      +V +R +       +QL A+++ 
Sbjct: 3   DYPADYLVPHVTDSFPTTLTLASGQRIQRAVYGVPMDTVRSRAEIPDPCLLEQLLALVDS 62

Query: 57  TLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYR--KENPG--GAIAGFVSL 112
            LG  Y  HA  LY     S  W+  KR E+   G  +V+YR   E  G  G    F+SL
Sbjct: 63  NLGPVYAQHAKALYGDQCGS--WKERKRQEMVTPGLVYVVYRAVDEETGKEGLPLAFLSL 120

Query: 113 LFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEIHVSPSFQ 172
           L  DEP                   GP+     PA           VVY+MEIHV+   +
Sbjct: 121 LLTDEPE-----------------LGPA-----PA----------AVVYLMEIHVADIIR 148

Query: 173 NQGLGSCMLL-CARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTA 224
             GLG  +L       V+  + + P ++G ELTVFT N  AL LY R G + A
Sbjct: 149 GLGLGGTLLREGVAGTVRGARRAHPFIQGTELTVFTDNEGALRLYLRLGMQIA 201

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 61.2 bits (147), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 81/200 (40%), Gaps = 45/200 (22%)

Query: 28  LSRDIIITDRLSVAARQKFAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAEL 87
             R+I I++     +  K  ++   +IE  LG +Y+ +   +Y    R   WQ++K  E+
Sbjct: 7   FKREICISN-----SNDKILEKQLQLIEINLGSYYNKYNKTIYKNNKR---WQSNKWQEM 58

Query: 88  QGLGTCHVLYRKENPGGAIAGFVSLLFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPA 147
                 HV Y        +  F S++ C+E                              
Sbjct: 59  CSENLFHVSYWNV-ESNELVCFCSIMPCEES----------------------------- 88

Query: 148 FEETXXXXXCKVVYVMEIHVSPSFQNQGLGSCMLLCARQLVQHMQPSFPQLKGLELTVFT 207
                      ++Y+ EIHV+P ++NQ  G  +L     L + + P    L G+ELTVF+
Sbjct: 89  ---IVEGEMSNIIYLYEIHVAPEWRNQKFGKSIL---NALKEKLCPK-AHLSGIELTVFS 141

Query: 208 GNRQALALYRRQGFKTATNT 227
            N +A+  YR  GF  + ++
Sbjct: 142 SNERAINFYRNNGFTLSYDS 161

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 77/180 (42%), Gaps = 35/180 (19%)

Query: 45  KFAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGG 104
           +F+K LT I++  LG  Y +    LY     S+PW+ +K  E++  G  +V+Y  E+   
Sbjct: 66  EFSKILT-ILDNNLGDIYTIKNKKLY---GNSKPWKENKIQEMKTEGLIYVVYHLEDEKK 121

Query: 105 AIAGFVSLLFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVME 164
            ++ ++S     E  +                  P      P            V+Y+ E
Sbjct: 122 TVSLYLSFTLTKESGFL-----------------PDIDVFSP------------VIYLYE 152

Query: 165 IHVSPSFQNQGLGSCMLLCARQ--LVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFK 222
           I ++P  +N GLG+ ++    +  LV   +     + G+ELTVF+ N  A+  Y   G K
Sbjct: 153 IQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYETIGMK 212

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 87/218 (39%), Gaps = 54/218 (24%)

Query: 22  CRNGCTLSRDIIITDRLSVAARQKFAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQA 81
           C +G   S+D++   + S     K   Q   I++  LG  Y   +  +Y     +RPW+ 
Sbjct: 42  CTSGKN-SQDVVYM-KCSTDQGDKMLDQFLDILDVNLGEKYTKVSKKIY---ENARPWKV 96

Query: 82  HKRAELQGLGTCHVLYRKENPGGAIAGFVSLLFCDEPHWPAGNGXXXXXXXXXXXXGPSG 141
           +K  E++  G  +V Y  E     +  F+S +  +E  +                     
Sbjct: 97  NKLEEMRSPGLVYVSYWDEESDEPML-FLSFMLTEEDGF--------------------- 134

Query: 142 RSAEPAFEETXXXXXCKVVYVMEIHVSPSFQNQGLGSCMLLCARQLVQHMQPSFPQLK-- 199
                    T       VVY+ EI + PS +N+ LG+      R L +H+Q +  +L+  
Sbjct: 135 ---------TEDDKLLSVVYLYEIQILPSLRNRKLGT------RLLAEHLQDACSRLRSE 179

Query: 200 ----------GLELTVFTGNRQALALYRRQGFKTATNT 227
                     G+ELTVF+ N  A+  Y+  G +   ++
Sbjct: 180 NGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDS 217

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 87/209 (41%), Gaps = 44/209 (21%)

Query: 22  CRNGCTLSRDIIITDRLSVAARQKFAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQA 81
           C     L+ ++++  +  +   +     L  ++++ LG  Y++ +  +Y      +PW+ 
Sbjct: 55  CLANKALTNEVVLRSK-HIKESKNILSSLLELLDQNLGQKYEISSKEMY---GNKKPWKE 110

Query: 82  HKRAELQGLGTCHVLY--RKENPGGAIAGFVSLLFCDEPHWPAGNGXXXXXXXXXXXXGP 139
           +K  E+   G  +V Y  + ++       F+S +  +E +                    
Sbjct: 111 NKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFMLTEEENL------------------- 151

Query: 140 SGRSAEPAFEETXXXXXCKVVYVMEIHVSPSFQNQGLG-----SCMLLCARQLVQH--MQ 192
                      T       V+++ EI +S   + QGLG     +C+  CA++L+ +  + 
Sbjct: 152 -----------THNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLN 200

Query: 193 PSFPQLKGLELTVFTGNRQALALYRRQGF 221
             FP   G+ELTVF  N  A+ LY++ G 
Sbjct: 201 LEFP-FAGIELTVFADNLPAINLYQKLGM 228

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 91/241 (37%), Gaps = 68/241 (28%)

Query: 8   LALYINDAFPEQLACRNGCTLSRDIII--------------------------TDRLSVA 41
           L   +++AFP+ ++ + G TL R I I                           DR +  
Sbjct: 6   LVQLVDNAFPKSISTKQGITLERKIYIIGDSENNSLLSDQNNNSNDDEIYWYFKDRKNPT 65

Query: 42  ARQKFAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYR--K 99
                  Q+  +I+  LG  Y   +  +Y        W  +KR E+      ++ Y   K
Sbjct: 66  VENIIKTQIFQLIDENLGKLYKKKSKKIYEN---DLDWSINKREEMFTSNMIYITYWDCK 122

Query: 100 ENPGGAIAGFVSLLFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKV 159
           +N   ++A F+S+L C+E +    N                                 +V
Sbjct: 123 QN---SVALFLSILSCEETYILENNDQ------------------------------GEV 149

Query: 160 VYVMEIHVSPSFQNQGLGSCML--LCARQLVQ--HMQPSFPQLKGLELTVFTGNRQALAL 215
           +Y+ EIH++  +Q QG+G  ++      +L++   ++       GLELTVF+ N  A   
Sbjct: 150 LYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQDNNFIGLELTVFSENNDAQNF 209

Query: 216 Y 216
           Y
Sbjct: 210 Y 210

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 75/175 (42%), Gaps = 27/175 (15%)

Query: 49  QLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGGAIAG 108
           +L  I++  LG  Y   +  +Y      +PW+ +K  E++  G  +V+Y  +     +  
Sbjct: 71  KLLDILDNNLGPIYLEKSSKIY---CNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLL- 126

Query: 109 FVSLLFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEIHVS 168
           F+S +  D+P                    P+   +      T       V+Y+ EI + 
Sbjct: 127 FMSFMITDDPSLVV----------------PTDNDSNELSNST-----AAVIYLYEIQLL 165

Query: 169 PSFQNQGLGSCMLLC-ARQLVQHMQPSFPQ-LKGLELTVFTGNRQALALYRRQGF 221
              +NQ LG+ ++    ++ ++ +   + + +  LELTVF+ N  A+  Y++ G 
Sbjct: 166 ELIRNQKLGTILITNYLKKTIEILNKDYQKNIIALELTVFSNNINAINFYKKIGM 220

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 74/175 (42%), Gaps = 36/175 (20%)

Query: 53  IIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGGAIAGFVSL 112
           +I++ LG  Y   + ++Y      +PW+A+K AE++  G  +V Y      G +  F S 
Sbjct: 107 LIDKHLGAKYRRASRIMY---GNRKPWKANKLAEMKSAGLVYVCYWDN---GVLGAFTSF 160

Query: 113 LFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEIHVSPSFQ 172
           +  +E     G+                      A  E        V+Y+ E+HV+ + +
Sbjct: 161 MLTEETGLVEGD----------------------ALHEVS----VPVIYLYEVHVASAHR 194

Query: 173 NQGLGSCML---LCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTA 224
             G+G  +L   LC   + +H +       G+ LTVF+ N +A  LY   GF  A
Sbjct: 195 GHGIGRRLLEHALCD-GVARHTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRA 248

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 85/215 (39%), Gaps = 41/215 (19%)

Query: 18  EQLACRNGCTLSRDII-----ITDRLSVAARQKFAKQLTAIIERTLGCFYDVHAHLLYPR 72
           E L    G + S+D I     +  RL  +           +I+  LG  Y   +  +Y  
Sbjct: 37  EMLFIPEGDSNSQDNIEIPTCVNYRLHKSRGNHILDSCVQLIDEHLGAKYRRASRTMY-- 94

Query: 73  LTRSRPWQAHKRAELQGLGTCHVLYRKENPGGAIAGFVSLLFCDEPHWPAGNGXXXXXXX 132
               +PW+A+K AE++     +V Y      GA+A F S +  +E     G+        
Sbjct: 95  -GNRKPWKANKLAEMKSPNLVYVSYWDN---GALAAFASFMLTEETGLVEGDA------- 143

Query: 133 XXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEIHVSPSFQNQGLGSCML---LCARQLVQ 189
                                     V+Y+ E+HV+   +  G+G  +L   LC   + +
Sbjct: 144 -------------------AHEVSVPVIYLYEVHVACVHRGHGIGRRLLERALC-EGVAR 183

Query: 190 HMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTA 224
           H++  + +  G+ LTVF+ N +A  LY   GF  A
Sbjct: 184 HVRCLYEEFFGVALTVFSDNTRARRLYEALGFYRA 218

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 78/192 (40%), Gaps = 30/192 (15%)

Query: 43  RQKFAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENP 102
           R     +   I++  LG  Y   +  +Y      + W+++K  E+   G  +V Y  E  
Sbjct: 63  RSDVLNKFLNILDVNLGAKYTKVSKTIY---ENDKSWKSNKLEEMLSPGLIYVSYWDEKY 119

Query: 103 GGAIAGFVSLLFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYV 162
              +  F+S +  +      G+G               G  +    E         V+Y+
Sbjct: 120 QEPLL-FLSFMLTE------GDGFI-------------GTHSNDDDENEHNDQLMSVIYL 159

Query: 163 MEIHVSPSFQNQGLGSCMLL------CARQLVQHMQPSFPQ-LKGLELTVFTGNRQALAL 215
            EI + P  + QG+G+ +L       C+  + ++ +   P  L G+ELTVF+ N +A+  
Sbjct: 160 YEIQILPQLRGQGIGTKLLSVHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINF 219

Query: 216 YRRQGFKTATNT 227
           Y+  G K   ++
Sbjct: 220 YKSIGMKLTPDS 231

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 97/263 (36%), Gaps = 65/263 (24%)

Query: 11  YINDAFPEQLACRNGCTLSRDI--IITDRLSVAARQ------------KFAKQLTAIIER 56
           Y N  FP  +    G  L+R +  I T+   V   Q            K   QL  I++ 
Sbjct: 12  YANQNFPTTINA-AGIQLTRKLLAIDTEEYPVETDQCISYVHSPREAEKLLWQLLEILDE 70

Query: 57  TLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLY----------RKENPGGAI 106
            LG  Y   +  LY     +RPW+ +K  E+   G  +V+Y          R+  P   +
Sbjct: 71  NLGQKYAGSSRALY---HNTRPWRVNKWREMLTPGLVYVIYSTAATTTATQRRNAPFSPL 127

Query: 107 AGFVSLLFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEIH 166
             F+S +  +E                       G  A+   E         V+Y+ E+ 
Sbjct: 128 L-FLSFMLTEE----------------------DGLVADDPTE------VWTVLYLYELQ 158

Query: 167 VSPSFQNQGLGSCML-----LCARQLVQHMQP---SFPQLKGLELTVFTGNRQALALYRR 218
           + P  +  GL + +L      C RQL    +    S  +  GLELTVF  N  A+ LY  
Sbjct: 159 LLPRVRRLGLAARLLGDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYES 218

Query: 219 QGFKTATNTEFFLSNSELTVMYC 241
            G + A ++   L    L  +Y 
Sbjct: 219 LGMQLAADSPTVLDTDSLYRLYV 241

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/238 (21%), Positives = 96/238 (40%), Gaps = 64/238 (26%)

Query: 12  INDAFPEQLACRNGCTLSRDIIITDRLSVAARQKFAKQLTAIIE--------------RT 57
           ++D FP++L  + G  L R I     L +A+  +  K+  ++I               + 
Sbjct: 14  VSDEFPKELRTK-GQNLKRKI-----LYIASEDEENKESDSVINEQDDLTKFTEGIGSKL 67

Query: 58  LGCFYDVHAHLL---YPRLTR-----SRPWQAHKRAELQGLGTCHVLYRKENPGGAI-AG 108
           L  F ++  + L   Y +++R     +  W+ +K  E++  G  +V Y KE       A 
Sbjct: 68  LDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCAL 127

Query: 109 FVSLLFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEIHVS 168
           F+S +  +E                                         V+Y+ EI + 
Sbjct: 128 FLSFMLTEEDFV------------------------------VDDIRKFSVIYLYEIQLI 157

Query: 169 PSFQNQGLGSCMLLCARQLVQ----HMQPSFPQLKGLELTVFTGNRQALALYRRQGFK 222
             ++   LG+ ++     + Q     ++P+FP L G++LTVF+ N++A+  Y R G K
Sbjct: 158 EKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFP-LIGIQLTVFSDNKRAIKFYERIGMK 214

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 66/167 (39%), Gaps = 38/167 (22%)

Query: 63  DVHAHLLYPRLTRSR-----PWQAHKRAELQGLGTCHVLYRKENPGGAIAGFVSLLFCDE 117
           D H    Y R +R+      PW+A+K AE++  G  +V Y      GA+  F S +  +E
Sbjct: 78  DEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGN---GALGAFASFMLTEE 134

Query: 118 PHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEIHVSPSFQNQGLG 177
                G+                                  V+Y+ EIHV+ + +  GLG
Sbjct: 135 TGLVEGDAAHEVS--------------------------VPVIYLYEIHVAHAHRGHGLG 168

Query: 178 SCML---LCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGF 221
             +L   LC   + + ++       G+ LTVF  N +A  LY   GF
Sbjct: 169 RRLLERALC-EGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 68/181 (37%), Gaps = 48/181 (26%)

Query: 52  AIIERTLGCFYDVHAHLLYPRLTRSR-----PWQAHKRAELQGLGTCHVLYRKENPGGAI 106
           AII++ L  FY++H   +Y      +      W   K  E+      +++  K +    I
Sbjct: 54  AIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRDTT-KI 112

Query: 107 AGFVSLLFCDEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEIH 166
            GF S+   D                             P  + +     C  +Y  EIH
Sbjct: 113 VGFTSVALSD--------------------------PLNPELDHSKLNRPCLFLY--EIH 144

Query: 167 VSPSFQNQGLGSC-----MLLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGF 221
           +   +Q++GLGS      ++  AR L     PS      +EL VFT N  A   Y+R GF
Sbjct: 145 LMGEYQSRGLGSLIFNGLLIPLARDLTC---PS------IELCVFTANDVACRWYKRLGF 195

Query: 222 K 222
           +
Sbjct: 196 Q 196

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score = 36.6 bits (83), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 4/64 (6%)

Query: 158 KVVYVMEIHVSPSFQNQGLGSCMLLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYR 217
           +VVY+ EI +  + + Q LG  ++      +       P++  + LTVF+ N +AL  Y 
Sbjct: 159 RVVYLYEIQLIEAIRRQKLGQAIV----SYLTECALESPEVAAVALTVFSDNEKALKFYE 214

Query: 218 RQGF 221
           R  F
Sbjct: 215 RLNF 218

>KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} similar
           to uniprot|Q5WCY3 Bacillus clausii ABC3243 paiA
           Septation and degradation transcriptional repressor of
           sporulation
          Length = 181

 Score = 35.8 bits (81), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 160 VYVMEIHVSPSFQNQGLGSCMLLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQ 219
           V +  I++   +Q +GLG  ++     + Q    S+ + K + L V+  N++A+  Y++ 
Sbjct: 100 VELQRIYILQKYQGKGLGRVLMDKVHDIAQ----SYGK-KKIWLGVWEHNQKAIDFYKKF 154

Query: 220 GFKTATNTEFFLSNSE 235
           GF+   +  FF+ + E
Sbjct: 155 GFEITGDHSFFVGDDE 170

>Kwal_26.8877 s26 (987655..988143) [489 bp, 162 aa] {ON} YOR253W
           (ARD2) -  [contig 68] FULL
          Length = 162

 Score = 35.4 bits (80), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 7/65 (10%)

Query: 160 VYVMEIHVSPSFQNQGLGSCMLL-CARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRR 218
           VYV  + V  +++ +G+GS +LL    Q  +H Q +      L + V T N +AL+ Y++
Sbjct: 79  VYVQILAVLENYRGKGIGSQLLLFVEEQCKKHFQHN------LYVHVATDNEKALSWYQK 132

Query: 219 QGFKT 223
           +GFK 
Sbjct: 133 KGFKV 137

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 58/161 (36%), Gaps = 33/161 (20%)

Query: 63  DVHAHLLYPRLTRSR-----PWQAHKRAELQGLGTCHVLYRKENPGG--AIAGFVSLLFC 115
           D H    Y R +R+      PW+A+K AE++  G  +V Y   +  G  A+  F S +  
Sbjct: 78  DEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGNDAQGERALGAFASFMLT 137

Query: 116 DEPHWPAGNGXXXXXXXXXXXXGPSGRSAEPAFEETXXXXXCKVVYVMEIHVSPSFQNQG 175
           +E     G+                          T       V+Y+ E+H     +  G
Sbjct: 138 EETGLVEGD--------------------------TAHEQSVPVIYLYEVHXXHRGRGLG 171

Query: 176 LGSCMLLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALY 216
                      +   ++ +   L G+ LTVF  N +A  LY
Sbjct: 172 RRLLAKALCEGVAARVRRTCDDLFGVALTVFGDNTRARRLY 212

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,702,873
Number of extensions: 761516
Number of successful extensions: 1566
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1579
Number of HSP's successfully gapped: 30
Length of query: 243
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 136
Effective length of database: 41,212,137
Effective search space: 5604850632
Effective search space used: 5604850632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)