Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_72552.533ON54435010561e-137
AGL071C2.533ON3962706122e-73
SAKL0A09482g2.533ON3881493103e-30
KNAG0C058102.533ON5541512827e-26
TBLA0G022302.533ON2161372641e-25
TDEL0A030702.533ON2391352617e-25
KAFR0A018602.533ON4901342721e-24
Kpol_1018.332.533ON5891382731e-24
Smik_13.2492.533ON4731342682e-24
KLLA0E18547g2.533ON4311382673e-24
YMR070W (MOT3)2.533ON490642631e-23
TPHA0G035102.533ON3871342591e-23
Skud_13.2262.533ON475642622e-23
Suva_13.2462.533ON419642592e-23
NDAI0K018602.533ON7301452642e-23
NDAI0H014002.533ON5411382586e-23
Kwal_26.80212.533ON5071332577e-23
ZYRO0B02002g2.533ON2941362471e-22
TBLA0I014802.533ON513622533e-22
CAGL0K03003g2.533ON6471352543e-22
KLTH0D06842g2.533ON506662523e-22
NCAS0A048002.533ON5111362472e-21
NCAS0F009002.533ON525612419e-21
KAFR0J003402.533ON218632051e-17
TPHA0C041902.533ON417551944e-15
KNAG0A070402.533ON352581819e-14
Smik_11.1862.598ON641691698e-12
YKL062W (MSN4)2.598ON630691698e-12
Skud_11.1672.598ON628691671e-11
Kpol_185.32.598ON647571617e-11
NDAI0C005602.598ON972571592e-10
TPHA0C025802.598ON365491552e-10
KAFR0A023202.598ON443611553e-10
NCAS0A129102.598ON822491563e-10
CAGL0F05995g2.598ON597481553e-10
Ecym_23012.598ON767611564e-10
TBLA0G019202.598ON523571554e-10
ZYRO0F01012g2.598ON584571554e-10
ABR089C2.598ON571611536e-10
TPHA0N014602.598ON519571536e-10
KLTH0D08734g2.598ON677611538e-10
TDEL0B069102.598ON437571511e-09
SAKL0B11330g2.598ON499611511e-09
CAGL0M13189g2.598ON541491501e-09
KNAG0H005502.598ON620571501e-09
KAFR0F020702.598ON370571482e-09
KLLA0F26961g2.598ON694611502e-09
Kwal_26.83512.598ON698611502e-09
NCAS0H030802.598ON730571492e-09
Suva_13.2062.598ON709561483e-09
Suva_11.1642.598ON639561483e-09
Skud_13.1932.598ON704561483e-09
YMR037C (MSN2)2.598ON704561474e-09
Smik_13.2072.598ON703561474e-09
TPHA0D010508.144ON439481454e-09
TBLA0H028302.598ON746571457e-09
Kpol_1013.212.598ON494571438e-09
NDAI0B019308.144ON436481438e-09
KNAG0M023102.598ON660481421e-08
NCAS0C040708.144ON289571382e-08
NDAI0B013402.598ON769571422e-08
KLLA0C17072g8.144ON474481412e-08
Ecym_84038.144ON573481403e-08
CAGL0K02145g8.144ON317481373e-08
SAKL0H24816g8.144ON410481393e-08
NCAS0B046008.144ON547481393e-08
ACL057W8.144ON520481375e-08
KLTH0E06688g8.144ON397481358e-08
KNAG0D021208.144ON402501358e-08
Skud_5.2488.144ON442481359e-08
Smik_5.2768.144ON442481359e-08
Suva_5.2518.144ON449481359e-08
YER130C8.144ON443481341e-07
CAGL0L06072g8.144ON300511321e-07
TDEL0B046708.144ON312481311e-07
Kwal_47.172418.144ON403481322e-07
TBLA0I027004.214ON737581332e-07
KNAG0G012808.144ON472481313e-07
ZYRO0B07568g4.214ON616571313e-07
ZYRO0G19140g8.144ON557481303e-07
AFR580C4.214ON838561305e-07
Kpol_1031.428.144ON359511276e-07
ACR264W2.162ON769771287e-07
Ecym_27604.214ON938561288e-07
TBLA0F003708.144ON687511271e-06
Kpol_472.104.214ON830611261e-06
KAFR0B021608.144ON453481251e-06
KNAG0I020702.162ON572481251e-06
NDAI0C06260na 1ON582511252e-06
Suva_2.3838.425ON1319691262e-06
CAGL0K04631g4.214ON1013581252e-06
Ecym_54242.162ON775771242e-06
KAFR0C029808.144ON225481193e-06
TBLA0B012802.162ON823551233e-06
Smik_4.4638.425ON1324651234e-06
NCAS0B069602.162ON839771225e-06
NCAS0F009202.531ON354521196e-06
Kwal_47.178882.162ON786771216e-06
SAKL0H04070g4.214ON899561216e-06
Ecym_4128na 2ON312541186e-06
TDEL0F026904.80ON350521187e-06
KLTH0E09724g2.162ON768771207e-06
Ecym_62951.326ON663791207e-06
KNAG0G018708.234ON875581207e-06
SAKL0E10714g2.162ON819771208e-06
NCAS0A023104.214ON879661208e-06
SAKL0F01980g3.518ON385521189e-06
YDR216W (ADR1)8.425ON1323591191e-05
KAFR0F012106.256ON311581161e-05
KAFR0B063608.425ON627621181e-05
KLLA0F20636gsingletonON285501151e-05
TDEL0E015904.214ON770661181e-05
TPHA0B029102.162ON717771181e-05
TBLA0G032403.298ON511661171e-05
KAFR0B045802.162ON729771171e-05
KNAG0H034802.162ON796731172e-05
Kwal_26.80112.531ON190511122e-05
KLLA0F13046g8.425ON1379511172e-05
NDAI0G034208.144ON484481162e-05
Skud_4.4788.425ON1323591172e-05
Suva_8.1662.162ON948771162e-05
Kpol_1072.582.162ON794771162e-05
TBLA0F038308.234ON967531162e-05
AGR186Cna 2ON287481132e-05
AGR172W8.425ON1057541162e-05
Kpol_1023.635.586ON556621153e-05
KLLA0B07909g4.214ON922721153e-05
TBLA0H006608.425ON1311511153e-05
Smik_4.7425.586ON528781143e-05
TPHA0A019408.234ON912531153e-05
TBLA0E042208.234ON519771143e-05
TDEL0B052502.162ON714771143e-05
KAFR0B025508.234ON890531143e-05
CAGL0E04884g8.425ON1489451144e-05
TPHA0C021608.425ON1375541144e-05
ADL051Wna 3ON173501074e-05
TDEL0F055008.425ON1207451144e-05
KAFR0C057105.586ON442901125e-05
NCAS0G012706.256ON274631115e-05
NDAI0B060203.518ON426651125e-05
SAKL0H12958g8.425ON1129451135e-05
ZYRO0B11770g8.234ON867531135e-05
ZYRO0D13992g5.586ON587671135e-05
ZYRO0G20526g1.326ON849661135e-05
NCAS0B05750singletonON505511125e-05
Kwal_47.190453.518ON266501105e-05
NDAI0C048608.425ON1350501135e-05
Smik_15.2912.162ON909771135e-05
KLLA0F01463g1.326ON781481135e-05
YOR113W (AZF1)2.162ON914771126e-05
Kpol_529.138.425ON1410451136e-05
Skud_15.2762.162ON917771126e-05
TBLA0E04210singletonON454501116e-05
Kpol_1050.193.518ON221621086e-05
ZYRO0B16148g2.162ON930771127e-05
KLLA0F23782g2.162ON782761127e-05
KNAG0D041904.214ON1010571127e-05
KAFR0G030504.214ON749551127e-05
Kpol_1032.528.234ON824531127e-05
Smik_6.1504.214ON806701127e-05
ZYRO0A09416g8.425ON1346451127e-05
Kpol_505.152.162ON510631117e-05
KNAG0C060305.586ON314831107e-05
KNAG0B033505.586ON600621118e-05
KAFR0A067205.586ON235791088e-05
NCAS0B028408.425ON1152501128e-05
AEL174W1.326ON661481118e-05
TDEL0A013008.234ON837531118e-05
Kpol_541.398.116ON291501098e-05
Suva_16.766.256ON392521108e-05
YPL230W (USV1)6.256ON391481108e-05
KNAG0E016003.518ON338781098e-05
TPHA0A04530singletonON501531109e-05
Suva_6.1321.326ON878541119e-05
NDAI0H011105.586ON454621101e-04
KAFR0B068104.351ON1155691111e-04
KNAG0J022503.296ON296511081e-04
Kwal_47.166214.351ON1178741111e-04
NDAI0B042902.162ON1064771111e-04
Smik_6.4356.256ON386481091e-04
CAGL0L11880g8.234ON980531101e-04
YDR463W (STP1)5.586ON519711101e-04
Skud_7.3644.214ON810621101e-04
Smik_4.3378.234ON894531101e-04
Skud_4.7395.586ON514631091e-04
Ecym_8387na 4ON179561041e-04
NDAI0D042404.214ON1169541101e-04
YDR096W (GIS1)8.234ON894531101e-04
Suva_2.6395.586ON516631091e-04
KLTH0G01826g3.518ON307501081e-04
CAGL0E04312g5.586ON688761091e-04
NDAI0C006905.586ON650741091e-04
TBLA0A089104.80ON390741081e-04
Skud_4.3548.234ON916531101e-04
Suva_5.1243.518ON406581081e-04
Suva_2.2558.234ON894531091e-04
KLLA0F10109g5.586ON623621091e-04
SAKL0H20988g4.80ON548741091e-04
Skud_16.486.256ON398481081e-04
Suva_7.3494.214ON812621091e-04
TPHA0K002105.586ON481621081e-04
SAKL0G18062g4.351ON1238541091e-04
KAFR0A008001.326ON753481092e-04
YGR067C4.214ON804621092e-04
ADL050Wna 4ON146541022e-04
Skud_13.614.351ON1253711092e-04
SAKL0H20394g8.117ON359511072e-04
KNAG0B005903.518ON439511072e-04
TBLA0I020603.298ON833521082e-04
Ecym_8388na 3ON223501042e-04
Suva_7.2404.80ON515521072e-04
YER169W (RPH1)8.234ON796531082e-04
TBLA0A016058.486ON224581042e-04
NCAS0A079005.586ON367711072e-04
TPHA0F018102.162ON425481072e-04
TPHA0B003804.351ON1310451082e-04
Suva_13.704.351ON777721082e-04
TBLA0B061604.351ON1384541082e-04
Skud_10.1521.326ON879541082e-04
Smik_5.3418.234ON798531082e-04
Skud_5.3088.234ON802531072e-04
KNAG0D037104.80ON459521072e-04
TBLA0I032803.518ON330551062e-04
KNAG0A044608.425ON1290451082e-04
YJL056C (ZAP1)1.326ON880541072e-04
KAFR0F036004.80ON335521062e-04
NCAS0H028905.586ON532621072e-04
TBLA0E028205.586ON312621052e-04
Ecym_8379na 5ON305561052e-04
TBLA0B060502.303ON762561073e-04
Suva_5.3038.234ON797531073e-04
NDAI0D037504.80ON493521063e-04
NDAI0F014006.256ON394681063e-04
KAFR0C04550singletonON467771063e-04
Skud_8.555.586ON535621063e-04
Kpol_1001.14.351ON1341681073e-04
TPHA0D034003.518ON338631053e-04
KLLA0C17710g8.234ON821691073e-04
AER159C4.351ON1191541073e-04
SAKL0D06776g1.326ON767801063e-04
CAGL0A01628g4.80ON424521053e-04
KLLA0B04477g4.351ON1332541073e-04
CAGL0G08107g8.234ON625711063e-04
KNAG0B067104.351ON1053541063e-04
TBLA0F013001.326ON985611063e-04
CAGL0C02519g3.518ON318561043e-04
NDAI0I009906.256ON409491053e-04
KAFR0C003403.298ON394501053e-04
CAGL0E06116g6.256ON613491063e-04
Suva_8.625.586ON545621053e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_7255
         (544 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   411   e-137
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   240   2e-73
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   124   3e-30
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   113   7e-26
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   106   1e-25
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   105   7e-25
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   109   1e-24
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   109   1e-24
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   107   2e-24
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   107   3e-24
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...   105   1e-23
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   104   1e-23
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...   105   2e-23
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...   104   2e-23
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   106   2e-23
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   103   6e-23
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   103   7e-23
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   100   1e-22
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...   102   3e-22
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   102   3e-22
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...   101   3e-22
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   100   2e-21
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    97   9e-21
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       84   1e-17
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    79   4e-15
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    74   9e-14
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    70   8e-12
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    70   8e-12
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    69   1e-11
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    67   7e-11
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     66   2e-10
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    64   2e-10
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    64   3e-10
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    65   3e-10
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    64   3e-10
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    65   4e-10
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    64   4e-10
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    64   4e-10
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    64   6e-10
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    64   6e-10
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    64   8e-10
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    63   1e-09
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    63   1e-09
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    62   1e-09
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    62   1e-09
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    62   2e-09
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    62   2e-09
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    62   2e-09
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    62   2e-09
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    62   3e-09
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    62   3e-09
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    62   3e-09
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    61   4e-09
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    61   4e-09
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    60   4e-09
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    60   7e-09
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    60   8e-09
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     60   8e-09
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    59   1e-08
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      58   2e-08
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     59   2e-08
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    59   2e-08
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    59   3e-08
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    57   3e-08
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    58   3e-08
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    58   3e-08
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    57   5e-08
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    57   8e-08
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    57   8e-08
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    57   9e-08
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    57   9e-08
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    57   9e-08
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    56   1e-07
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    55   1e-07
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    55   1e-07
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    55   2e-07
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    56   2e-07
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    55   3e-07
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    55   3e-07
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    55   3e-07
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    55   5e-07
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    54   6e-07
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    54   7e-07
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    54   8e-07
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    54   1e-06
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    53   1e-06
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    53   1e-06
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    53   1e-06
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             53   2e-06
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    53   2e-06
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    53   2e-06
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    52   2e-06
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    50   3e-06
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    52   3e-06
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    52   4e-06
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    52   5e-06
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     50   6e-06
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    51   6e-06
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    51   6e-06
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    50   6e-06
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    50   7e-06
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    51   7e-06
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    51   7e-06
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    51   7e-06
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    51   8e-06
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    51   8e-06
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    50   9e-06
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    50   1e-05
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    49   1e-05
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    50   1e-05
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    49   1e-05
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    50   1e-05
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    50   1e-05
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     50   1e-05
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    50   1e-05
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    50   2e-05
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    48   2e-05
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    50   2e-05
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    49   2e-05
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    50   2e-05
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    49   2e-05
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    49   2e-05
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    49   2e-05
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    48   2e-05
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    49   2e-05
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    49   3e-05
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    49   3e-05
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    49   3e-05
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    49   3e-05
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    49   3e-05
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    49   3e-05
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    49   3e-05
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    49   3e-05
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    49   4e-05
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    49   4e-05
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    46   4e-05
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    49   4e-05
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    48   5e-05
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      47   5e-05
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    48   5e-05
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    48   5e-05
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    48   5e-05
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    48   5e-05
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    48   5e-05
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    48   5e-05
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    47   5e-05
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    48   5e-05
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    48   5e-05
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    48   5e-05
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    48   6e-05
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    48   6e-05
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    48   6e-05
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             47   6e-05
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    46   6e-05
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    48   7e-05
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    48   7e-05
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    48   7e-05
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    48   7e-05
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    48   7e-05
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    48   7e-05
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    48   7e-05
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    47   7e-05
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    47   7e-05
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    47   8e-05
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    46   8e-05
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    48   8e-05
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    47   8e-05
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    47   8e-05
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    47   8e-05
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    47   8e-05
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    47   8e-05
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    47   8e-05
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             47   9e-05
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    47   9e-05
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     47   1e-04
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    47   1e-04
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               46   1e-04
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    47   1e-04
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    47   1e-04
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    47   1e-04
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    47   1e-04
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    47   1e-04
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    47   1e-04
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    47   1e-04
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    47   1e-04
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    45   1e-04
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    47   1e-04
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    47   1e-04
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    47   1e-04
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    46   1e-04
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    47   1e-04
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    47   1e-04
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    46   1e-04
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    47   1e-04
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    46   1e-04
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    47   1e-04
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    47   1e-04
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    47   1e-04
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    46   1e-04
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    47   1e-04
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    46   1e-04
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    47   1e-04
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    47   2e-04
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    47   2e-04
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    44   2e-04
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    47   2e-04
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    46   2e-04
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    46   2e-04
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     46   2e-04
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    45   2e-04
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    46   2e-04
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    46   2e-04
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                45   2e-04
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    46   2e-04
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    46   2e-04
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    46   2e-04
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    46   2e-04
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    46   2e-04
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    46   2e-04
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    46   2e-04
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    46   2e-04
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    46   2e-04
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    45   2e-04
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    46   2e-04
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    46   2e-04
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    45   2e-04
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    46   2e-04
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    45   2e-04
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    45   2e-04
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    46   3e-04
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    46   3e-04
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      45   3e-04
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     45   3e-04
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               45   3e-04
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    45   3e-04
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    46   3e-04
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    45   3e-04
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    46   3e-04
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    46   3e-04
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    45   3e-04
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    45   3e-04
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    46   3e-04
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    45   3e-04
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    45   3e-04
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    45   3e-04
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    45   3e-04
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    45   3e-04
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    45   3e-04
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    45   3e-04
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    45   3e-04
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    45   3e-04
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    45   4e-04
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    45   4e-04
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    45   4e-04
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    44   4e-04
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    45   4e-04
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    45   4e-04
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    45   4e-04
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    45   4e-04
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    45   4e-04
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    45   4e-04
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    45   4e-04
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    45   4e-04
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    43   4e-04
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    45   4e-04
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    45   5e-04
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    45   5e-04
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    45   5e-04
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    44   5e-04
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    45   5e-04
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    45   5e-04
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    45   5e-04
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    44   5e-04
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    44   5e-04
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    43   5e-04
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    45   5e-04
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    44   6e-04
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    45   6e-04
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    44   6e-04
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    44   6e-04
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    43   6e-04
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               44   6e-04
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    44   6e-04
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    45   6e-04
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    44   6e-04
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    44   7e-04
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    44   7e-04
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    44   7e-04
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    44   7e-04
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    44   7e-04
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    44   7e-04
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      44   7e-04
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    44   7e-04
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    44   8e-04
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    44   8e-04
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    44   8e-04
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    44   8e-04
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    44   8e-04
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    43   8e-04
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    44   8e-04
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    44   8e-04
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    44   9e-04
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    44   9e-04
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    44   0.001
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    44   0.001
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    44   0.001
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    42   0.001
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    44   0.001
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    44   0.001
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     44   0.001
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    44   0.001
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     44   0.001
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    44   0.001
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    44   0.001
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    43   0.001
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    44   0.001
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    44   0.001
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    44   0.001
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    42   0.001
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    44   0.001
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    44   0.001
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    43   0.001
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     44   0.001
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    44   0.001
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    44   0.001
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    43   0.001
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    43   0.001
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    43   0.001
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    43   0.002
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    43   0.002
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    42   0.002
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    43   0.002
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    42   0.002
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    43   0.002
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    43   0.002
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    43   0.002
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    43   0.002
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    43   0.002
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    43   0.002
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    43   0.002
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    42   0.002
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    43   0.002
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    43   0.002
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    43   0.002
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    43   0.002
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    42   0.002
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               42   0.002
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    42   0.002
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    41   0.002
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    42   0.002
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    41   0.002
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    42   0.002
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    42   0.002
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    42   0.003
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    42   0.003
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    42   0.003
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    40   0.003
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                41   0.003
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    39   0.003
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    42   0.003
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    42   0.003
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    42   0.003
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    42   0.003
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    42   0.003
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    42   0.003
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    42   0.003
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    41   0.003
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    42   0.003
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    42   0.003
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    42   0.003
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    42   0.003
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    42   0.003
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    42   0.004
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    41   0.004
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    42   0.004
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    42   0.004
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    42   0.004
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    42   0.004
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    41   0.004
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    42   0.004
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    42   0.004
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    41   0.004
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    40   0.004
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    42   0.004
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    41   0.004
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      41   0.004
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    42   0.004
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    42   0.004
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    42   0.004
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    41   0.005
KLTH0G05104g Chr7 (412304..413920) [1617 bp, 538 aa] {ON} simila...    42   0.005
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    41   0.005
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    41   0.005
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    41   0.005
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    41   0.005
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    41   0.005
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    41   0.006
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    41   0.006
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    41   0.006
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    41   0.006
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    41   0.007
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    41   0.007
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    40   0.008
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                40   0.008
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    40   0.008
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    41   0.008
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    39   0.009
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    41   0.009
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    40   0.009
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    40   0.009
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    39   0.009
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    40   0.010
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    38   0.010
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    39   0.011
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    40   0.011
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    40   0.011
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    40   0.011
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  40   0.011
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    40   0.011
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    40   0.012
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    39   0.012
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    40   0.012
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    39   0.012
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               40   0.013
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    40   0.013
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    40   0.013
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    40   0.014
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    40   0.014
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    39   0.015
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    39   0.015
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    40   0.015
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    40   0.016
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    39   0.016
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    39   0.016
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    39   0.016
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    40   0.017
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    40   0.017
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    40   0.017
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      39   0.018
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    40   0.018
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    40   0.018
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    40   0.019
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    39   0.019
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    40   0.019
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    40   0.020
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    39   0.020
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    39   0.022
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    39   0.024
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    39   0.024
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    38   0.024
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    39   0.025
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    39   0.026
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    39   0.026
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    39   0.027
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    39   0.027
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    39   0.028
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    39   0.028
YGL254W Chr7 (22304..23203) [900 bp, 299 aa] {ON}  FZF1Transcrip...    39   0.030
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    39   0.030
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    39   0.031
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    39   0.032
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    39   0.033
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    39   0.033
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    37   0.033
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    39   0.034
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    37   0.034
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    39   0.035
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    37   0.035
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    39   0.035
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    39   0.035
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    38   0.036
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    38   0.036
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    39   0.037
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                38   0.037
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    37   0.038
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                38   0.044
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    39   0.044
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     39   0.047
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    38   0.048
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    38   0.048
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    38   0.050
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    38   0.051
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    38   0.058
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    38   0.060
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    37   0.060
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    38   0.067
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    37   0.067
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    37   0.070
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    37   0.072
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    38   0.073
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               38   0.073
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    37   0.074
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    38   0.078
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    37   0.078
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    37   0.079
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    37   0.080
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    37   0.087
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       35   0.091
Smik_7.7 Chr7 (16965..17897) [933 bp, 310 aa] {ON} YGL254W (REAL)      37   0.11 
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    37   0.11 
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    37   0.12 
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     37   0.13 
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    37   0.13 
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    37   0.14 
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    37   0.15 
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    37   0.15 
Kpol_388.8 s388 (25278..26939) [1662 bp, 553 aa] {ON} (25278..26...    37   0.16 
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 37   0.16 
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    37   0.16 
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    37   0.17 
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    36   0.17 
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    36   0.18 
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    36   0.19 
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    36   0.20 
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    36   0.20 
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      36   0.21 
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    36   0.22 
NCAS0C05820 Chr3 complement(1197669..1199426) [1758 bp, 585 aa] ...    36   0.23 
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    35   0.23 
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    36   0.24 
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     36   0.25 
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    35   0.25 
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    36   0.25 
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    36   0.25 
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    36   0.25 
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    36   0.27 
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      36   0.29 
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    35   0.29 
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    35   0.30 
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    35   0.31 
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    35   0.32 
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    35   0.34 
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    35   0.35 
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    36   0.35 
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    35   0.36 
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    34   0.36 
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    35   0.36 
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    35   0.38 
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    35   0.39 
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    35   0.40 
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    35   0.40 
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    35   0.40 
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    35   0.41 
Kwal_55.20634 s55 (498959..500218) [1260 bp, 419 aa] {ON} YHL027...    35   0.42 
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    34   0.43 
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    35   0.48 
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    35   0.49 
SAKL0H25674g Chr8 complement(2249157..2250503) [1347 bp, 448 aa]...    35   0.51 
KLTH0E05962g Chr5 (539474..540739) [1266 bp, 421 aa] {ON} weakly...    35   0.54 
Kpol_1031.73 s1031 complement(186968..187513) [546 bp, 181 aa] {...    34   0.55 
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    35   0.66 
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    34   0.68 
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    34   0.79 
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    34   0.84 
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  34   0.84 
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    34   0.85 
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    34   0.87 
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    33   0.89 
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    34   0.96 
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    33   0.96 
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    34   0.97 
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    34   1.0  
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    34   1.1  
Suva_1.89 Chr1 complement(157170..157334) [165 bp, 55 aa] {ON} Y...    30   1.1  
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    33   1.2  
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    33   1.3  
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    34   1.3  
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    33   1.5  
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    33   1.6  
NCAS0F01370 Chr6 complement(270474..270977) [504 bp, 167 aa] {ON}      32   1.6  
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    33   1.7  
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    33   1.8  
Kwal_47.16577 s47 complement(9960..12605) [2646 bp, 881 aa] {ON}...    33   1.9  
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    33   2.1  
KLTH0E03124g Chr5 complement(280411..283056) [2646 bp, 881 aa] {...    33   2.2  
Suva_7.7 Chr7 (16721..17614) [894 bp, 297 aa] {ON} YGL254W (REAL)      32   2.5  
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    33   2.6  
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    32   2.8  
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    32   2.9  
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    33   3.0  
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    32   3.0  
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    33   3.1  
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    32   3.3  
NCAS0J02140 Chr10 complement(410960..415012) [4053 bp, 1350 aa] ...    32   3.5  
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    32   3.6  
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    32   4.0  
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    32   4.2  
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    32   4.2  
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    32   4.4  
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    32   4.6  
NCAS0B04020 Chr2 complement(726291..727118) [828 bp, 275 aa] {ON}      32   5.0  
KLTH0F06710g Chr6 complement(585209..586648) [1440 bp, 479 aa] {...    32   5.1  
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    31   5.4  
KNAG0A04030 Chr1 (542889..543515) [627 bp, 208 aa] {ON} Anc_8.48...    31   5.4  
Kwal_33.14227 s33 complement(577899..579554) [1656 bp, 551 aa] {...    32   6.0  
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    32   6.8  
TPHA0G03750 Chr7 complement(794102..795142) [1041 bp, 346 aa] {O...    31   7.4  
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    32   7.5  
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    31   8.5  

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  411 bits (1056), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 223/350 (63%), Positives = 223/350 (63%)

Query: 195 PYYSWGMPHTYQYSIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGXXXX 254
           PYYSWGMPHTYQYSI                                       LG    
Sbjct: 195 PYYSWGMPHTYQYSIPHPQMQQTQQPQPMQQAQQHHQQQQHSQQPQQYVQTIPQLGAIPP 254

Query: 255 XXXXXXXXXXXXGVSNVTSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPY 314
                       GVSNVTSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPY
Sbjct: 255 PAATAPATSTSIGVSNVTSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPY 314

Query: 315 SCPWCHSRHKRKDNLSQHLKLKHAEMLLERLSSNPNTASHLMNRLHXXXXXXXXXXXXXX 374
           SCPWCHSRHKRKDNLSQHLKLKHAEMLLERLSSNPNTASHLMNRLH              
Sbjct: 315 SCPWCHSRHKRKDNLSQHLKLKHAEMLLERLSSNPNTASHLMNRLHSGANGAVAVTAASA 374

Query: 375 XXXXXXXXXXXXXXXXXXXXXIKDMIDSGMLSKNEVKKTLNSLINSDIADTVGHNTPSMQ 434
                                IKDMIDSGMLSKNEVKKTLNSLINSDIADTVGHNTPSMQ
Sbjct: 375 DSSATMVSSSSSSAAGPTTFSIKDMIDSGMLSKNEVKKTLNSLINSDIADTVGHNTPSMQ 434

Query: 435 VGXXXXXXXXXXXXXXXXXXXXXXTTTAINVPGNNNTNVSVXXXXXXXXXXXXXXXSAGA 494
           VG                      TTTAINVPGNNNTNVSV               SAGA
Sbjct: 435 VGALSSLSSSASSASSASSASSSSTTTAINVPGNNNTNVSVHQQQPHHQHHHHHHHSAGA 494

Query: 495 PNLVVAARPPSTSAAPDATNQSNIPPPLAVSVAPTITGSGNLTSMGNLHP 544
           PNLVVAARPPSTSAAPDATNQSNIPPPLAVSVAPTITGSGNLTSMGNLHP
Sbjct: 495 PNLVVAARPPSTSAAPDATNQSNIPPPLAVSVAPTITGSGNLTSMGNLHP 544

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 61/116 (52%)

Query: 1   MEYEGHHHHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYQRHIVSAGS 60
           MEYEGHHHH                                         YQRHIVSAGS
Sbjct: 1   MEYEGHHHHQQQSAAAAAAQQQQQQQPQQPQQPQQPQQPQQPQQPQQPQQYQRHIVSAGS 60

Query: 61  GDLYDTKYVPNMPMPMHMXXXXXXXXXXXXXXFHDDPHAQVAVYHQLQQQLPHLMN 116
           GDLYDTKYVPNMPMPMHM              FHDDPHAQVAVYHQLQQQLPHLMN
Sbjct: 61  GDLYDTKYVPNMPMPMHMSLSTYPTPSTTPYYFHDDPHAQVAVYHQLQQQLPHLMN 116

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  240 bits (612), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 138/270 (51%), Positives = 155/270 (57%), Gaps = 47/270 (17%)

Query: 275 QLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           QLMD NSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLK
Sbjct: 174 QLMDLNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLK 233

Query: 335 LKHAEMLLERLSSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 394
           LKHAEMLLERLSSNPNT + L+NRLH                                  
Sbjct: 234 LKHAEMLLERLSSNPNTPTSLINRLH---------------SSDAAAGSAAAAAGTPAAF 278

Query: 395 XIKDMIDSGMLSKNEVKKTLNSLINSDIADTVGHNTPSMQVGXXXXXXXXXXXXXXXXXX 454
            IKDMIDSGMLSKNEVKKTLNSLIN ++ D+  H+    Q+G                  
Sbjct: 279 SIKDMIDSGMLSKNEVKKTLNSLINPEVGDSASHH----QLGPS---------------- 318

Query: 455 XXXXTTTAINVPGNNNTNVSVXXXXXXXXXXXXXXXSAGAPNLVVAARPPSTSAAPDATN 514
                       G +   +S                +A   + V +A   +++    +  
Sbjct: 319 ------------GGDGAGISSLSSSASSASSASAATAAPISSSVSSAGHATSAGHAASAG 366

Query: 515 QSNIPPPLAVSVAPTITGSGNLTSMGNLHP 544
            S+IPPPLAVSVAP I GSG L SMGNLHP
Sbjct: 367 TSSIPPPLAVSVAPAIAGSGGLASMGNLHP 396

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 44/66 (66%), Gaps = 5/66 (7%)

Query: 51  YQRHIVSAGSGDLYDTKYVPNMPMPMHMXXXXXXXXXXXXXXFHDDPHAQVAVYHQLQQQ 110
           YQRH+     G+LYD KYVPN+P+PM M              FH+DPH+QV VYHQLQQQ
Sbjct: 46  YQRHV----GGELYDAKYVPNVPVPMPMSMSTYPTPSTTPYYFHEDPHSQV-VYHQLQQQ 100

Query: 111 LPHLMN 116
           LPHLM+
Sbjct: 101 LPHLMS 106

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 13/15 (86%), Positives = 15/15 (100%)

Query: 195 PYYSWGMPHTYQYSI 209
           PYYSWGMPH+YQYS+
Sbjct: 118 PYYSWGMPHSYQYSV 132

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  124 bits (310), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 81/149 (54%), Gaps = 9/149 (6%)

Query: 271 VTSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLS 330
           V   Q  +P   EN H+CH C+K+FKRKSWLKRHLLSHS++KP++CPWC SRHKRKDNL 
Sbjct: 243 VQPHQGQNPADPENPHQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLL 302

Query: 331 QHLKLKHAEMLLERLSSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 390
           QH+KLKH   +L+ L S           +H                              
Sbjct: 303 QHMKLKHTPQVLQELQS---------AGVHPIVSNITLINLASTAGQNGVPSLVPVHGDM 353

Query: 391 XXXXXIKDMIDSGMLSKNEVKKTLNSLIN 419
                IK MID G L+K++VK+ LN LIN
Sbjct: 354 SMMTSIKTMIDDGTLNKDDVKRVLNMLIN 382

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  113 bits (282), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 83/151 (54%), Gaps = 20/151 (13%)

Query: 268 VSNVTSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKD 327
           ++ +T+S    P++F  IHKCH CEK+FKR+SWLKRHLLSHS  + Y CPWC SRHKRKD
Sbjct: 420 ITTLTNSDNSSPSNF--IHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKD 477

Query: 328 NLSQHLKLKHAEMLLERLSSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXX 387
           NL QH+KLKH+  LL+ L  N N + +                                 
Sbjct: 478 NLLQHMKLKHSNYLLDEL-KNANVSFNW-----------------GTYDGQNSTDSMPKT 519

Query: 388 XXXXXXXXIKDMIDSGMLSKNEVKKTLNSLI 418
                   IK ++  G+L+K++VK+ LN +I
Sbjct: 520 LSGYPDSSIKKLLYRGILNKDDVKRVLNKII 550

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  106 bits (264), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 72/137 (52%), Gaps = 39/137 (28%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           HKC  CEK FKRKSWLKRH+LSHS  + YSCPWC SRHKRKDNL QH+KLKH + +L++L
Sbjct: 113 HKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMKLKHTDEVLKKL 172

Query: 346 SS----NPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMID 401
                   +    +MNR                                     I+ M+ 
Sbjct: 173 KMTCYLEGDDGEEMMNR-----------------------------------DNIRTMLY 197

Query: 402 SGMLSKNEVKKTLNSLI 418
            G+L K+EVKK LN L+
Sbjct: 198 EGLLDKDEVKKVLNELL 214

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  105 bits (261), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 72/135 (53%), Gaps = 34/135 (25%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344
           +HKCH C K+FKRKSWL+RHLLSHS  + +SCPWC S+HKRKDNL QH+KLKH + +L+ 
Sbjct: 133 VHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKRKDNLLQHMKLKHTDYVLQE 192

Query: 345 LSSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMIDSGM 404
           L  N    S                                          I+ ++  G 
Sbjct: 193 LRLNNVYVS----------------------------------TEGSCKNNIRTLLYEGR 218

Query: 405 LSKNEVKKTLNSLIN 419
           L+K+EVKK LNSLI+
Sbjct: 219 LNKDEVKKVLNSLID 233

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  109 bits (272), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/134 (41%), Positives = 73/134 (54%), Gaps = 27/134 (20%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344
           IH CH CEK+F+RKSWLKRHLLSHST + + CPWC SRHKRKDNL QH+KLKH+  L+  
Sbjct: 352 IHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKRKDNLLQHMKLKHSNYLVIE 411

Query: 345 LSSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMIDSGM 404
           L  N N     +N                                      I+++I  G+
Sbjct: 412 LKKN-NAVFSCVN--------------------------GGNREKLNDTDDIRNLISLGV 444

Query: 405 LSKNEVKKTLNSLI 418
           ++K++VKK +N LI
Sbjct: 445 INKDDVKKVINKLI 458

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 75/138 (54%), Gaps = 36/138 (26%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           H CH C K FKRKSWL+RHLLSHS+ + + CPWC S+HKRKDNL QH+KLKHAE +LE+L
Sbjct: 477 HVCHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENVLEQL 536

Query: 346 -----SSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMI 400
                ++NPN  S                                          I+ ++
Sbjct: 537 RINLKANNPNDNSE-------------------------------PTLEGNGDHNIRTLM 565

Query: 401 DSGMLSKNEVKKTLNSLI 418
             G+L+K+EVKK LNSL+
Sbjct: 566 GEGILNKDEVKKLLNSLV 583

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  107 bits (268), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/134 (41%), Positives = 73/134 (54%), Gaps = 2/134 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344
           IH+C FCEK+FKRKSWLKRHLLSHS  + + CPWC SR KRKDNL QH+KLKH   LL+ 
Sbjct: 337 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 396

Query: 345 LSSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMIDSGM 404
           L  N    ++  +                                      IK +I+ G+
Sbjct: 397 LKKNNIIFNYNNSS--INSNNSNNNNSASGSGGGSAAAAPENEDGNSYDPNIKTLINDGV 454

Query: 405 LSKNEVKKTLNSLI 418
           L+K++VK+ LN+LI
Sbjct: 455 LNKDDVKRVLNNLI 468

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  107 bits (267), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 70/138 (50%), Gaps = 12/138 (8%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           ++CH CEK F+RKSWLKRHLLSHS +K + CPWC S HKRKDNL QHLKLKH + LL   
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365

Query: 346 SSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMIDSGML 405
           +            L                                    I+DM+DS  L
Sbjct: 366 T------------LFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNAL 413

Query: 406 SKNEVKKTLNSLINSDIA 423
            K++VK+ LN +++S  +
Sbjct: 414 PKDQVKRCLNYIVDSKCS 431

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score =  105 bits (263), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 44/64 (68%), Positives = 50/64 (78%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344
           IH+C FCEK+FKRKSWLKRHLLSHS  + + CPWC SR KRKDNL QH+KLKH   LL+ 
Sbjct: 345 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 404

Query: 345 LSSN 348
           L  N
Sbjct: 405 LKKN 408

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  104 bits (259), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344
           I +C+ C K FKRKSWLKRHLLSHS+ + YSCPWC S+HKRKDNL QH+KLKH + +L+ 
Sbjct: 253 IFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLSKHKRKDNLLQHMKLKHKQQVLQE 312

Query: 345 LSSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMIDSGM 404
           +    +  S     L+                                   I  M+D+G 
Sbjct: 313 M----DKLSESSLELNDESSTGTDTASPIVNETALSMLNDDSGSSSNDNVSIIAMVDNGT 368

Query: 405 LSKNEVKKTLNSLI 418
           L K  VKK LNS+I
Sbjct: 369 LKKENVKKVLNSII 382

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score =  105 bits (262), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 44/64 (68%), Positives = 50/64 (78%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344
           IH+C FCEK+FKRKSWLKRHLLSHS  + + CPWC SR KRKDNL QH+KLKH   LL+ 
Sbjct: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386

Query: 345 LSSN 348
           L  N
Sbjct: 387 LKKN 390

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score =  104 bits (259), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 44/64 (68%), Positives = 50/64 (78%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344
           IH+C FCEK+FKRKSWLKRHLLSHS  + + CPWC SR KRKDNL QH+KLKH   LL+ 
Sbjct: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385

Query: 345 LSSN 348
           L  N
Sbjct: 386 LKKN 389

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 75/145 (51%), Gaps = 3/145 (2%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344
           + +C +C K+FKR SWLKRHLL+HS  + YSCPWC S+HKRKDNL QHLKLKH EM+L++
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQ 618

Query: 345 LSSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMIDSGM 404
           L       S +   +                                    IK ++  G 
Sbjct: 619 LRLENIEISTIEETMEDRRVDVHERSKSVDTGTSGVNDDIDIKNVKQPGTNIKTLLYDGR 678

Query: 405 LSKNEVKKTLNSLI---NSDIADTV 426
           L+K +VKK LN L+   NS  +D+ 
Sbjct: 679 LNKEDVKKVLNKLLDGTNSTFSDST 703

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  103 bits (258), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 72/138 (52%), Gaps = 4/138 (2%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           ++C  CEK FKR+SWLKRHLLSHS+ + Y CPWC SRHKR+DNL QH+KLKH   L+  L
Sbjct: 400 YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQHMKLKHPNNLINEL 459

Query: 346 S----SNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMID 401
                 +  TA+  +  +                                    IKD+I 
Sbjct: 460 KLRNFISSQTAAASVAFVTSAAPSIMSINDGMNNTVAGTVDNAVSTPGYETGITIKDLIS 519

Query: 402 SGMLSKNEVKKTLNSLIN 419
            G+++K +VK+ LN LI+
Sbjct: 520 EGLINKEDVKRLLNILID 537

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  103 bits (257), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 68/133 (51%), Gaps = 24/133 (18%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           ++C  C+K+FKR+SW KRHLLSHS+ KPYSCPWC SRHKR+DNL QH+K KH   +++ L
Sbjct: 389 YRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQEL 448

Query: 346 SSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMIDSGML 405
               +    +M+ +                                    IK +I  G +
Sbjct: 449 LEVGDVDGSVMSGMQ------------------------VTSDESAPEPSIKTLIQDGQV 484

Query: 406 SKNEVKKTLNSLI 418
            K  VK  LN++I
Sbjct: 485 KKERVKAVLNAVI 497

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score = 99.8 bits (247), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 71/136 (52%), Gaps = 37/136 (27%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           H C  C+K+FKRKSWL+RHLLSHS  + + CPWC S+HKRKDNL QH+KLKH E +LE+L
Sbjct: 192 HLCPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL 251

Query: 346 -SSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMIDSGM 404
            + N      + N                                      I+ ++  G 
Sbjct: 252 RNQNVGIDGEVRN------------------------------------DNIRTLLCEGR 275

Query: 405 LSKNEVKKTLNSLINS 420
           L+K +VKK LN LI+S
Sbjct: 276 LNKEDVKKVLNGLIDS 291

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score =  102 bits (253), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 52/62 (83%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344
           I +CH CEK+FKRKSWLKRHLLSHS  + +SCP C S+HKRKDNL QHLKLKH + +L++
Sbjct: 339 IFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYILKK 398

Query: 345 LS 346
           L+
Sbjct: 399 LN 400

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  102 bits (254), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 73/135 (54%), Gaps = 25/135 (18%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           H+CH C K FKRKSWLKRHLLSHS  + + CPWC+SRHKR+DNL QH+KLKH   LL+ +
Sbjct: 534 HRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVPNLLQEI 593

Query: 346 SS-NPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMIDSGM 404
           +S N      ++ RL                                     K +I  G+
Sbjct: 594 NSRNMRFNWPILERL------------------------SKQIDGTIEYPDTKTLIHEGL 629

Query: 405 LSKNEVKKTLNSLIN 419
           L+K+E+K  LN++I+
Sbjct: 630 LNKDELKNILNTVID 644

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score =  101 bits (252), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 40/66 (60%), Positives = 52/66 (78%)

Query: 280 NSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
           +S   +++C  CEK+FKRKSW +RHLLSHS+ KPY+CPWC SRHKR+DNL QH+K KH  
Sbjct: 382 SSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441

Query: 340 MLLERL 345
            +L+ L
Sbjct: 442 QVLQEL 447

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 69/136 (50%), Gaps = 25/136 (18%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344
           +++CH C K+F+R SWLKRHLL+HS+ + YSCP C S+HKRKDNL QHLKLKH   +LE+
Sbjct: 386 VYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVLEQ 445

Query: 345 LSSNPNTASHLMNRLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKDMIDSGM 404
           L  +                                               IK ++  G 
Sbjct: 446 LRQD-------------------------NIDIKTAKDEGEEDQGTASNTNIKTLLVEGR 480

Query: 405 LSKNEVKKTLNSLINS 420
           L+K +VKK LN LI+S
Sbjct: 481 LNKEDVKKVLNRLIDS 496

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score = 97.4 bits (241), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 49/61 (80%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344
           ++ CH C K FKR+SWLKRHLLSHS+ + Y CPWC SRHKR+DNL QH+KLKH++ L+  
Sbjct: 387 VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQHMKLKHSKNLINE 446

Query: 345 L 345
           L
Sbjct: 447 L 447

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 83.6 bits (205), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 49/63 (77%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLER 344
           +++C+ C K F+R++WL+RH LSH+  + + CPWC S+HKR+DNL +H+KLKH E+L++ 
Sbjct: 118 VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNLFKHIKLKHMELLMKA 177

Query: 345 LSS 347
           +  
Sbjct: 178 IRE 180

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 39/55 (70%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
            ++C  C K FKR SWLKRH  SHS +K +SC WC  ++KRKDNL QH++ KH +
Sbjct: 323 FYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKHRD 377

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 74.3 bits (181), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 42/58 (72%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE 343
           + C  C K+F+R +WLKRH ++H+   P+ C WC S HKR+DN+ +H+KLKH  +L++
Sbjct: 250 YPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNLLMK 307

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 5/69 (7%)

Query: 277 MDPNSFENIH--KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHL 333
           +DPN+++     KC  CEKAF+R   LKRH+ S HST +P++C +C  +  R DNLSQHL
Sbjct: 573 IDPNNYDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHL 632

Query: 334 KL--KHAEM 340
           K   KH + 
Sbjct: 633 KTHKKHGDF 641

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 5/69 (7%)

Query: 277 MDPNSFENIH--KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHL 333
           +DPN+++     KC  CEKAF+R   LKRH+ S HST +P++C +C  +  R DNLSQHL
Sbjct: 562 IDPNNYDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHL 621

Query: 334 KL--KHAEM 340
           K   KH + 
Sbjct: 622 KTHKKHGDF 630

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 5/69 (7%)

Query: 277 MDPNSFENIH--KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHL 333
           +DPN+++     KC  CEKAF+R   LKRH+ S HST +P++C +C  +  R DNLSQHL
Sbjct: 560 IDPNNYDKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHL 619

Query: 334 KL--KHAEM 340
           K   KH + 
Sbjct: 620 KTHKKHGDF 628

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 3/57 (5%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           KC  CEKAF+R   LKRH+ S HS+ +P++C +C  +  R DNLSQHLK   KH + 
Sbjct: 591 KCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLKTHKKHGDF 647

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           KC  CEKAF+R   LKRH  S HS  +P+ C +C  R  R DNLSQHLK   KH + 
Sbjct: 916 KCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLSQHLKTHKKHGDF 972

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 33/49 (67%), Gaps = 1/49 (2%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           KC+ CEK FKR   LKRH+ S HST +PY C +C     R DNLSQHLK
Sbjct: 309 KCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLK 357

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 38/61 (62%), Gaps = 3/61 (4%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAE 339
           E   KC  C KAF+R   LKRH+ S HST +P++C  C  +  R DNLSQHLK   KH E
Sbjct: 383 EKPFKCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLKTHKKHGE 442

Query: 340 M 340
           +
Sbjct: 443 L 443

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           KC  C KAF+R   LKRH+ S HS+ +P++CP C  +  R DNL+QH+K
Sbjct: 766 KCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIK 814

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           CH C KAFKR   LKRH+ S HST +P+SC  C  +  R DNLSQH+K
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 3/61 (4%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAE 339
           E   KC  C KAF+R   LKRH+ S HST +P+ C +C  +  R DNLSQHLK   KH +
Sbjct: 695 EKPFKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLKTHRKHGD 754

Query: 340 M 340
           +
Sbjct: 755 I 755

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 37/57 (64%), Gaps = 3/57 (5%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           KC  CEKAF+R   LKRH+ S HS+ +P+ C +C  R  R DNLSQHLK   KH + 
Sbjct: 467 KCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLKTHKKHGDF 523

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (64%), Gaps = 3/57 (5%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           KC  C KAF+R   LKRH+ S HS+ +P++C +C  +  R DNLSQHLK   KH + 
Sbjct: 528 KCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 584

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 38/61 (62%), Gaps = 3/61 (4%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAE 339
           E   KC  C KAF+R   LKRH+ S HS+ +P+ C +C  +  R DNLSQHLK   KH +
Sbjct: 501 EKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLKTHRKHGD 560

Query: 340 M 340
           +
Sbjct: 561 I 561

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 3/57 (5%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           KC+ CEKAF+R   LKRH+ S HS+ +P+ C +C  +  R DNLSQHLK   KH + 
Sbjct: 463 KCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLKTHKKHGDF 519

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (60%), Gaps = 3/61 (4%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAE 339
           E   KC  C KAF+R   LKRH+ S HST +P+ C +C  +  R DNLSQHLK   KH +
Sbjct: 617 EKPFKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLKTHKKHGD 676

Query: 340 M 340
            
Sbjct: 677 F 677

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 37/57 (64%), Gaps = 3/57 (5%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           KC  C KAF+R   LKRH+ S HST +P++C +C  +  R DNLSQHLK   KH + 
Sbjct: 381 KCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 437

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 37/61 (60%), Gaps = 3/61 (4%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAE 339
           E   KC  C KAF+R   LKRH+ S HS+ +P+ C +C  +  R DNLSQHLK   KH +
Sbjct: 439 EKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKHGD 498

Query: 340 M 340
            
Sbjct: 499 F 499

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           +C  C+KAF+R   LKRH+ S HST +P+ C +C  +  R DNLSQHLK
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLK 533

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           KC  C KAFKR   LKRH+ S HS  +P++C  C  +  R DNLSQHLK   KH + 
Sbjct: 564 KCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLKTHKKHGDF 620

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           KC  CEK FKR   LKRH  S HS  +P+ C  C  +  R DNLSQHLK   KH + 
Sbjct: 314 KCSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLKTHKKHGDF 370

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 37/61 (60%), Gaps = 3/61 (4%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAE 339
           E   KC  C K F+R   LKRH+ S HST +P+ C +C  +  R DNLSQHLK   KH +
Sbjct: 618 EKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLKTHKKHGD 677

Query: 340 M 340
           +
Sbjct: 678 I 678

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 37/61 (60%), Gaps = 3/61 (4%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAE 339
           E   KC  C KAF+R   LKRH+ S HS+ +P+ C +C  +  R DNLSQHLK   KH +
Sbjct: 638 EKPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKHGD 697

Query: 340 M 340
            
Sbjct: 698 F 698

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (64%), Gaps = 3/57 (5%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           KC  C KAF+R   LKRH+ S HS+ +P++C +C  +  R DNLSQHLK   KH + 
Sbjct: 674 KCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 730

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           CH C K+FKR   LKRH+ S HS  +P++C  C  +  R DNLSQH+K   KH ++
Sbjct: 654 CHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKKHGDI 709

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           C  C+KAF+R   LKRH+ S HS  +P++C +C  +  R DNLSQHLK   KH + 
Sbjct: 584 CKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLKTHKKHGDF 639

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           CH C K+FKR   LKRH+ S HS  +P++C  C  +  R DNLSQH+K   KH ++
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKKHGDI 704

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           CH C K+FKR   LKRH+ S HS  +P++C  C  +  R DNLSQH+K   KH ++
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKKHGDI 704

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 3/56 (5%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           CH C K+FKR   LKRH+ S HS  +P++C  C  +  R DNLSQH+K   KH ++
Sbjct: 648 CHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIKTHKKHGDI 703

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C +CE+ FKR+  LKRH+ S H  +KPY+C  C  +  R DNLSQH+K
Sbjct: 388 CDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIK 435

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           KC  C K F+R   LKRH+ S HS  +P+SC  C  +  R DNLSQHLK   KH ++
Sbjct: 690 KCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLKTHKKHGDI 746

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           KC  C K F+R   LKRH+ S HS  +P+ C +C  +  R DNLSQHLK   KH + 
Sbjct: 438 KCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLKTHKKHGDF 494

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C +CE+ FKR+  LKRH+ S H  +KPY+C  C     R DNLSQH+K
Sbjct: 386 CEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIK 433

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C  C KAFKR   LKRH+ S HS  +PY C  C  +  R DNLSQHLK
Sbjct: 605 CEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLK 652

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE 343
           CH C+K FKR   LKRH  + H  ++P+ C  CH R  R DNL+QH+++   + ++E
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIHEQQPIME 281

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 287 KCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKL--KHAEM 340
           +C  C K+F+R   LKRH+ S HS  +P++C  C  +  R DNLSQHLK   KH ++
Sbjct: 713 QCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLKTHKKHGDL 769

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C +C++ FKR+  LKRH+ S H   KPY C  C  +  R DNLSQHLK
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLK 467

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 28/56 (50%), Gaps = 7/56 (12%)

Query: 312 KPYSCPWCHSRHKRKDNLSQHLKLKH-------AEMLLERLSSNPNTASHLMNRLH 360
           KP+ C +C  R KR+++L +H++  H         +  ++ S + N + HL    H
Sbjct: 416 KPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLKTHTH 471

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C FCE+ FKR+  LKRH+ S H   KPY C  C  +  R DNL+QH+K
Sbjct: 516 CEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 563

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 18/26 (69%)

Query: 312 KPYSCPWCHSRHKRKDNLSQHLKLKH 337
           KP+ C +C  R KR+++L +H++  H
Sbjct: 512 KPFGCEFCERRFKRQEHLKRHVRSLH 537

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C FC++ FKR+  LKRH+ S H   KPY C  C+ +  R DNL+QH+K
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C FC++ FKR+  LKRH+ S H   KPY C  C  +  R DNL+QH+K
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIK 403

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C +CE+ FKR+  LKRH+ S H   KPY+C  C+    R DNL+QH+K
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C +CE+ FKR+  LKRH+ S H   KPY C  C  +  R DNL+QH+K
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 509

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 18/26 (69%)

Query: 312 KPYSCPWCHSRHKRKDNLSQHLKLKH 337
           KP+ C +C  R KR+++L +H++  H
Sbjct: 458 KPFGCEYCERRFKRQEHLKRHIRSLH 483

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C FC++ FKR+  LKRH+ S H   KP+ C  C  +  R DNL+QH+K
Sbjct: 342 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVK 389

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%), Gaps = 1/50 (2%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           + C +CE+ FKR+  LKRH+ S H   KPY+C  C  +  R DNL+QH K
Sbjct: 349 YSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTK 398

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 312 KPYSCPWCHSRHKRKDNLSQHLKLKH 337
           K YSC +C  R KR+++L +H++  H
Sbjct: 347 KHYSCEYCERRFKRQEHLKRHIRSLH 372

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C FC++ FKR+  LKRH+ S H   KP++C  C+    R DNL+QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C FC++ FKR+  LKRH+ S H   KP++C  C+    R DNL+QH+K
Sbjct: 390 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 437

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C FC++ FKR+  LKRH+ S H   KP++C  C+    R DNL+QH+K
Sbjct: 397 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 444

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C FC++ FKR+  LKRH+ S H   KP++C  C+    R DNL+QH+K
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           I KC  CE+ FKR+  LKRH+ S H   +PYSC  C     R DNL+QH +
Sbjct: 217 IFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQHKR 267

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C FC++ FKR+  LKRH+ S H   KP++C  C  +  R DNL+QH+K
Sbjct: 260 CEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIK 307

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C FC++ FKR+  LKRH+ S H   KP+ C  C  +  R DNL+QH+K
Sbjct: 348 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIK 395

>TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {ON}
           Anc_4.214 YGR067C
          Length = 737

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 32/58 (55%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE 343
           H C FC +AF R    KRH  SH  +KP+ C  C+    R+D L +H+K  H   LLE
Sbjct: 5   HVCAFCRRAFSRSEHRKRHERSHQGVKPFQCAVCNHVFVRRDLLKRHIKTVHRAWLLE 62

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C +C + FKR+  LKRH+LS H   K + CP C     R DNL+QH+K
Sbjct: 402 CKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIK 449

>ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 616

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLL 342
           + C FC KAF R     RH  SH+ MKP+ C  C     R+D L +H++  H E+LL
Sbjct: 8   YVCSFCSKAFSRSEHRARHERSHTGMKPFECKVCRHAFVRRDLLQRHIRTVHRELLL 64

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C +C++ FKR+  LKRH+ S H   KP+ C  C  +  R DNL+QH+K
Sbjct: 505 CEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIK 552

>AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR067C
          Length = 838

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE 343
           C FC +AF R     RH  SH+ +KP+SC  C+    R+D L +H++  H  MLLE
Sbjct: 10  CSFCAQAFSRSEHKTRHERSHTGVKPFSCKVCNHSFVRRDLLQRHIRTVHRSMLLE 65

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           +  C  C++ FKR+  LKRH+ S H   KP+SC  C  +  R DNL+QH+K
Sbjct: 302 LFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIK 352

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 14/24 (58%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTM 311
           CH CEK F R   L +H+ +HS  
Sbjct: 334 CHICEKKFSRSDNLNQHIKTHSNF 357

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE-- 343
           HKC +C K F + + L+ H+ SH   KP+ C +C  R  +  NL  H++L   E   E  
Sbjct: 487 HKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGERPYECD 546

Query: 344 ----RLSSNPNTASHLM 356
               R S   N A+H++
Sbjct: 547 KCGKRFSRKGNLAAHML 563

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 2/61 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  ++C  C K F RK  L  H+L+H   KP+ C    C+    +  N+  H    H + 
Sbjct: 540 ERPYECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQT 599

Query: 341 L 341
           L
Sbjct: 600 L 600

>Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {ON}
           similar to Ashbya gossypii AFR580C
          Length = 938

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 32/56 (57%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE 343
           C FC +AF R     RH  SH+ +KP+SC  C     R+D L +H++  H  MLLE
Sbjct: 10  CCFCARAFSRSEHRTRHERSHTGVKPFSCKVCSHSFVRRDLLQRHIRTVHRSMLLE 65

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           I  C +C + FKR+  LKRH  S H   KP+ C  C+ +  R DNL+QH+K
Sbjct: 633 IFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIK 683

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           H C +C +AF R     RH  SH+  KPY C  C     R+D L +H++  H  +LL + 
Sbjct: 9   HICSYCNRAFSRSEHKARHERSHTGTKPYECKVCLREFVRRDLLQRHIRTVHKSLLLSKA 68

Query: 346 S 346
           S
Sbjct: 69  S 69

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C +C++ FKR+  LKRH+ S H   KP+ C  C     R DNL+QH+K
Sbjct: 400 CEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIK 447

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 305 LLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKH 337
           LL   T K +SC +C  R KR+++L +H++  H
Sbjct: 390 LLDDGT-KQFSCEYCDRRFKRQEHLKRHIRSLH 421

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHL 333
           +KC +C K F +   LK H+  H+  KP+SC +C  R  RK NL+ HL
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHL 463

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHA------E 339
           H+C+ C K F + + L+ HL SH   KPY C WC     +  NL  H++L         E
Sbjct: 388 HECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCE 447

Query: 340 MLLERLSSNPNTASHLM 356
              +R S   N  +HL+
Sbjct: 448 FCSKRFSRKGNLTAHLV 464

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 2/63 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E    C FC K F RK  L  HL++H  ++P+ C    C     +  N+  H    H   
Sbjct: 441 EKPFSCEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFHQNT 500

Query: 341 LLE 343
           L E
Sbjct: 501 LTE 503

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 335
           +CH C K+  R S L+ H+L H+  +P+ C W  CH R   K N+++H KL
Sbjct: 492 QCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKL 542

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERLSS 347
           C  C +AF R+  LKRH  SH+  KPY C  C+    R+D L +H +  H+  L E +S 
Sbjct: 106 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLGETISQ 165

Query: 348 NPNTASHLM 356
           N  ++  ++
Sbjct: 166 NKKSSRTII 174

>CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]
           {ON} some similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067c
          Length = 1013

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE 343
           H C FC KAF R     RH  SH+ +KP+ C  C     R+D L +H++  H  +LL 
Sbjct: 12  HFCSFCNKAFSRSEHKTRHERSHAGVKPFECQVCSHSFVRRDLLQRHIRTVHRILLLR 69

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE-- 343
           H+C +C K F + + L+ H+ SH   KP+ C +C  R  +  NL  H++L   E   E  
Sbjct: 491 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGERPYECD 550

Query: 344 ----RLSSNPNTASHLM 356
               R S   N A+H++
Sbjct: 551 KCGKRFSRKGNLAAHML 567

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 2/61 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  ++C  C K F RK  L  H+L+H   KP+ C    C+    +  N+  H    H + 
Sbjct: 544 ERPYECDKCGKRFSRKGNLAAHMLTHENHKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQT 603

Query: 341 L 341
           L
Sbjct: 604 L 604

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C +C + F+R+  +KRH+ S H   KPYSC  C     R DNL QH K
Sbjct: 173 CQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQHRK 220

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEM 340
           ++C+FC K F +   LK H   H+  KPYSC  C+ R  RK NL+ H+ L H ++
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKICNKRFSRKGNLTAHV-LTHKKL 598

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 6/80 (7%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE--- 339
           +  H+C +C + F + + L+ H+ SH   KPY C +C  +  +  NL  H +L   E   
Sbjct: 514 KKTHQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNFCGKKFTQGGNLKTHQRLHTGEKPY 573

Query: 340 ---MLLERLSSNPNTASHLM 356
              +  +R S   N  +H++
Sbjct: 574 SCKICNKRFSRKGNLTAHVL 593

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  + C  C K F RK  L  H+L+H  +KPY C    C+    +  N+  H    H   
Sbjct: 570 EKPYSCKICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAHQNKFHYNT 629

Query: 341 LLE 343
           L+E
Sbjct: 630 LIE 632

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERLSS 347
           C  C +AF R+  LKRH  SH+  KPY C  C+    R+D L +H +  H+  L E +S 
Sbjct: 112 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLGETISQ 171

Query: 348 NPNTA 352
           N  ++
Sbjct: 172 NRKSS 176

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKL------KHAE 339
           HKC +C + F + + L+ H+ SH   KPY C +C  R  +  NL  H +L         E
Sbjct: 515 HKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGYCGKRFTQGGNLRTHQRLHTGEKPYECE 574

Query: 340 MLLERLSSNPNTASHLM 356
           +  ++ S   N A+HL+
Sbjct: 575 LCDKKFSRKGNLAAHLL 591

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQH---LKLKH 337
           E  ++C  C+K F RK  L  HLL+H  +KP+ C    C+    +  N+  H     L  
Sbjct: 568 EKPYECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAHQNRFHLDT 627

Query: 338 AEMLLERLSS-NPN 350
            +ML  +L+  NPN
Sbjct: 628 LKMLTTKLAEMNPN 641

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 334
           IHKC  C+K   R + L+ HLL H+  KPY C W  C +    K N+++H K
Sbjct: 295 IHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE-- 343
           H+C +C K F + + L+ H+ SH   KP+ C +C  R  +  NL  H++L   E   E  
Sbjct: 503 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEKPYECE 562

Query: 344 ----RLSSNPNTASHLM 356
               R S   N A+H +
Sbjct: 563 KCGRRFSRKGNLAAHRL 579

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  ++C  C + F RK  L  H L+H  +KP+ C    C+    +  N+  H    H + 
Sbjct: 556 EKPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQT 615

Query: 341 LLE 343
           L E
Sbjct: 616 LNE 618

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE 343
           C FC KAF R     RH  SH+ +KP++C  C     R+D L +H++  H   LL+
Sbjct: 10  CSFCAKAFSRSEHRTRHERSHTGVKPFTCTVCAHSFVRRDLLQRHIRTVHRTFLLQ 65

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEML 341
           C  C K+F R+S L+ HLL H+ +KP+ C +C      K NL++H ++   +++
Sbjct: 173 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRHERIHRQKVI 226

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLKL 335
           H C  C++AF+R     RHL +H+  KP++C  P C  R  R D L++H ++
Sbjct: 29  HVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRI 80

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE-- 343
           H+C +C K F + + L+ H+ SH   KP+ C +C  R  +  NL  H++L   E   E  
Sbjct: 486 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEKPYECE 545

Query: 344 ----RLSSNPNTASHLM 356
               R S   N A+H +
Sbjct: 546 KCGRRFSRKGNLAAHRL 562

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  ++C  C + F RK  L  H L+H  +KP+ C    C+    +  N+  H    H + 
Sbjct: 539 EKPYECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQT 598

Query: 341 LLE 343
           L E
Sbjct: 599 LNE 601

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 7/79 (8%)

Query: 274 SQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHL 333
           SQ +  +S E   KC FC+K F   S L+ H+ +H+  KP +C  C  R     NLS+H+
Sbjct: 562 SQHIRTHSGERPFKCQFCDKRFTTSSSLRIHIRTHTGEKPLACNVCGKRFNESSNLSKHM 621

Query: 334 KL-------KHAEMLLERL 345
           K+       KH +   +RL
Sbjct: 622 KIHERKYMCKHCKRSFDRL 640

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 291 CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
           C K F ++  L RH+  H+  KP+ CP C      +D LSQH++    E
Sbjct: 523 CTKHFAQRQKLLRHIKVHTGYKPFKCPHCSKTFSTEDILSQHIRTHSGE 571

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLL---- 342
           KC  C K F  +  L +H+ +HS  +P+ C +C  R     +L  H++    E  L    
Sbjct: 547 KCPHCSKTFSTEDILSQHIRTHSGERPFKCQFCDKRFTTSSSLRIHIRTHTGEKPLACNV 606

Query: 343 --ERLSSNPNTASHL 355
             +R + + N + H+
Sbjct: 607 CGKRFNESSNLSKHM 621

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 280 NSFENIHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           N +  ++ C  C++ F     L RH  S HS  KPYSCP C  R KR+D++ QHL  K
Sbjct: 754 NEYGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKK 811

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHA------E 339
           H+C +C K F + + L+ H+ SH   KP+ C +C  R  +  NL  H +L         E
Sbjct: 540 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHTRLHTGEKPYSCE 599

Query: 340 MLLERLSSNPNTASHLM 356
              +R S   N A+H++
Sbjct: 600 KCGKRFSRKGNLAAHML 616

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 34/74 (45%), Gaps = 6/74 (8%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQH---LKLKH 337
           E  + C  C K F RK  L  H+L+H  +KPY C    C     +  NL  H     L+ 
Sbjct: 593 EKPYSCEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFHLQT 652

Query: 338 AEMLLERLSS-NPN 350
              L +RL+  +PN
Sbjct: 653 LNQLTQRLAEMDPN 666

>NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {ON}
           Anc_4.214
          Length = 879

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%)

Query: 279 PNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHA 338
           P +F+    C FC K F R     RH  SH+ +KPY C  C     R D   +H+K  H 
Sbjct: 8   PTTFQKRFICSFCAKGFSRAEHKIRHERSHTGLKPYKCKVCTHCFVRSDLALRHIKTVHK 67

Query: 339 EMLLER 344
           + +L+R
Sbjct: 68  KEILQR 73

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLKL 335
           +KC  C K F R    +RH+ +H+  KP++C  P C  R  R D L +HL++
Sbjct: 25  YKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLRI 76

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERLS 346
           C  C +AF R+  LKRH  SH+  KPY C  C+    R+D L +H +  H+  L E +S
Sbjct: 106 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLGETIS 164

>KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.256
           YPL230W
          Length = 311

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%)

Query: 291 CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERLSSN 348
           C   F R   L RH+  H+  KP+ C  C     R DNL QH +  HA + ++ +S+N
Sbjct: 26  CHMTFARAEHLARHVRRHTGEKPFECNVCFKHFSRVDNLKQHKETVHANVFIDEMSNN 83

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEM-LLERLS 346
           C  C+KAF R+  L RHL SH+  KP+ C  C     R+D L +H    H++  +++R S
Sbjct: 51  CFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRHSNKLHSDTAIVQRKS 110

Query: 347 SN 348
            N
Sbjct: 111 CN 112

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 335
           C  C K F R S L+ H+L HS  KP+ C W  C+ +   K NL +HLKL
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKL 283

>TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.214
           YGR067C
          Length = 770

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERLSS 347
           C +C K F R     RH  SH+ +KP+ C  C     R+D L +H++  H E+LL   S 
Sbjct: 14  CSYCGKPFSRSEHKARHERSHTGVKPFECKVCRHSFVRRDLLQRHIRTVHRELLLVESSL 73

Query: 348 NPNTAS 353
            P   S
Sbjct: 74  EPAAGS 79

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKL------KHAE 339
           H+C +C + F + + L+ H+ SH   KP+ C +C  R  +  NL  H +L       + E
Sbjct: 409 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEFCGKRFTQGGNLRTHQRLHTGEKPYNCE 468

Query: 340 MLLERLSSNPNTASHLM 356
           M  +R S   N A+H +
Sbjct: 469 MCGKRFSRKGNLAAHAL 485

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 3/67 (4%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  + C  C K F RK  L  H L+H  +KPY C    C+    +  N+  H    H + 
Sbjct: 462 EKPYNCEMCGKRFSRKGNLAAHALTHQKLKPYICKLENCNKSFTQLGNMKAHQNRFHLKT 521

Query: 341 LLERLSS 347
           L+ RL+S
Sbjct: 522 LM-RLTS 527

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 272 TSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNL 329
           ++S  M PN     + C  C K F+R S LK H+  H+ +KPY CP+  C+     K N+
Sbjct: 401 SASNCMYPNPKNFKYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNM 460

Query: 330 SQHLKL 335
            +H KL
Sbjct: 461 LRHFKL 466

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKL------KHAE 339
           H+C +C + F + + L+ H+ SH  +KPY C +C  +  +  NL  H +L         E
Sbjct: 493 HECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQYCGKKFTQGGNLRTHERLHTGEKPYQCE 552

Query: 340 MLLERLSSNPNTASHLM 356
           +  +R S   N A+H++
Sbjct: 553 LCGKRFSRKGNLAAHVL 569

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  ++C  C K F RK  L  H+L+H  +KP+ C    C+    +  N+  H    H E 
Sbjct: 546 EKPYQCELCGKRFSRKGNLAAHVLTHKKIKPFICKLDNCNKSFTQLGNMKGHQNKFHLET 605

Query: 341 L 341
           L
Sbjct: 606 L 606

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEM--LLER 344
           +C FC K F +   L+ H   H+  KPY+C  C  R  RK NL+ H +L H E+   L +
Sbjct: 501 ECQFCGKRFTQGGNLRTHQRLHTGEKPYACQHCSKRFSRKGNLAAH-QLTHREVKPFLCK 559

Query: 345 LSSNPNTASHLMN 357
           L +   T + L N
Sbjct: 560 LDNCGKTFAQLGN 572

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 38/84 (45%), Gaps = 6/84 (7%)

Query: 279 PNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHA 338
           P   +  H+C +C   F + + L+ H+ SH   KP+ C +C  R  +  NL  H +L   
Sbjct: 465 PQQQQKKHECPYCHHKFAQTTHLEVHVRSHLGYKPFECQFCGKRFTQGGNLRTHQRLHTG 524

Query: 339 EM------LLERLSSNPNTASHLM 356
           E         +R S   N A+H +
Sbjct: 525 EKPYACQHCSKRFSRKGNLAAHQL 548

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  + C  C K F RK  L  H L+H  +KP+ C    C     +  N+  H    H++ 
Sbjct: 525 EKPYACQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNHQNRFHSQT 584

Query: 341 LLE 343
           +LE
Sbjct: 585 VLE 587

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 334
           ++C  C K F R S L+ HLL+H+  +P+ CP+  C      K N+ +HLK
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHA 338
           C  C +AF R+  L RH  SH+  KPY C  C  R  R+D L +H +  H 
Sbjct: 127 CKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQKLHG 177

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           C  C + F+R+  +KRH+ + H   +PY+C  C     R DNL+QHL+
Sbjct: 415 CTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLR 462

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERLS 346
           C  C +AF R+  LKRH  SH+  KPY C  C+    R+D L +H +  H+  L E +S
Sbjct: 106 CEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLGETIS 164

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
           (REAL)
          Length = 948

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE------ 339
           H+C +C + F + + L+ H+ SH   KP++C +C  R  +  NL  H +L   E      
Sbjct: 624 HECPYCHRLFSQATHLEVHVRSHIGYKPFACDYCGKRFTQGGNLRTHERLHTGEKPYSCD 683

Query: 340 MLLERLSSNPNTASHLM 356
           +  ++ S   N A+HL+
Sbjct: 684 ICDKKFSRKGNLAAHLV 700

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 2/61 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  + C  C+K F RK  L  HL++H  +KP+ C    C     +  N+  H    H E 
Sbjct: 677 EKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCDKTFTQLGNMKAHQNRFHKET 736

Query: 341 L 341
           L
Sbjct: 737 L 737

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHA------E 339
           H+C +C + F + + L+ H+ SH   KP+ C +C  R  +  NL  H +L         E
Sbjct: 508 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHQRLHTGERPYSCE 567

Query: 340 MLLERLSSNPNTASHLM 356
           +  ++ S   N A+H +
Sbjct: 568 LCGKKFSRKGNLAAHFL 584

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 2/63 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  + C  C K F RK  L  H L+H  +KPY C    C+    +  N+  H    H   
Sbjct: 561 ERPYSCELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAHQNRFHLNT 620

Query: 341 LLE 343
           L+E
Sbjct: 621 LME 623

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           I+ C  C++ F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 858 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKL 335
           C  C K+F R+S L+ HLL H+ +KP+ C +C      K NL++H ++
Sbjct: 169 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCDKEFNVKSNLNRHERI 216

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%)

Query: 279 PNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQH 332
           P+    +  CH C +AF R+  L RH  SH+  KPY C  C  R  R+D L +H
Sbjct: 42  PSGKPRLFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRH 95

>Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa]
           {ON} complement(144388..146058) [1671 nt, 557 aa]
          Length = 556

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 12/62 (19%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRKDNLSQHLKL 335
           CH+C+ +F+ + +L RH+  H+  K Y CP+          CH+     R+D    HLK+
Sbjct: 182 CHYCDASFRIRGYLTRHIKKHAIQKAYCCPFYNKSSPPDIRCHTSGGFSRRDTYKTHLKV 241

Query: 336 KH 337
           +H
Sbjct: 242 RH 243

>KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C
          Length = 922

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 33/72 (45%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERLSS 347
           C FC K F R     RH  SH+  KP+SC  C     R+D L +H++  H   L   L +
Sbjct: 10  CSFCAKPFSRSEHKARHERSHTGSKPFSCSICSHSFVRRDLLQRHIRTVHKSSLNSMLKT 69

Query: 348 NPNTASHLMNRL 359
                  +MN L
Sbjct: 70  GNKNMEEVMNSL 81

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHA 338
           C FC++AF R+  L RH  SH+  KP+ C  C     R+D L +H +  H 
Sbjct: 154 CDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIHG 204

>Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463W
           (REAL)
          Length = 528

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 14/78 (17%)

Query: 273 SSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR 322
           S++++D    E I  CH+C+  F+ + +L RH+  H+  K Y CP+          CH+ 
Sbjct: 149 STKILDNGEEEFI--CHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNNATPPDLRCHNS 206

Query: 323 --HKRKDNLSQHLKLKHA 338
               R+D    HLK +H 
Sbjct: 207 GGFSRRDTYKTHLKARHV 224

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           ++ C  C++ F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 776 VYICQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 828

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 7/77 (9%)

Query: 276 LMDPNSFENIHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           +++P+S+     C  C ++F     L RH  + H   KP+SCP C  R KR+D++ QHL 
Sbjct: 442 MINPSSY-----CFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQHLN 496

Query: 335 LKHAEMLLERLSSNPNT 351
            K      E L  NPN+
Sbjct: 497 -KKIPCSTENLIPNPNS 512

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKL------KHAE 339
           H+C +C + F + + L+ H+ SH   KP+ C +C  R  +  NL  H +L         E
Sbjct: 424 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCQYCGKRFTQGGNLRTHQRLHTGEKPYECE 483

Query: 340 MLLERLSSNPNTASHLM 356
           +  +R S   N A+H++
Sbjct: 484 LCGKRFSRKGNLAAHVV 500

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  ++C  C K F RK  L  H+++H  +KP+ C    C+    +  N+  H    H   
Sbjct: 477 EKPYECELCGKRFSRKGNLAAHVVTHQKLKPFICKLDGCNKTFTQLGNMKAHQNRFHLNT 536

Query: 341 LLE 343
           L E
Sbjct: 537 LNE 539

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           ++ C  C++ F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 780 VYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQHLNKK 832

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQH 332
           C  C +AF R+  L RH  SH+  KPY C  C  R  R+D L +H
Sbjct: 32  CQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRH 76

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEML 341
           C  C +AF R+  L RH  SH+  KPY C  C  +  R+D     L L+HA+ +
Sbjct: 46  CSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRD-----LLLRHAQKI 94

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 335
           C  C K+F RK+ L+ H+L H+  KPY CP+  C+     K NL +H ++
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERI 167

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 26/45 (57%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQH 332
           C  C +AF R+  L RH  SH+  KPYSC  C+    R+D L +H
Sbjct: 61  CQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRH 105

>KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON}
           Anc_5.586 YHR006W
          Length = 442

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 20/90 (22%)

Query: 268 VSNVTSSQLMDPNSF--------ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW- 318
           +S +T   +  P  F        E    CH+C+  FK + +L RH+  H+  K + CP+ 
Sbjct: 96  LSPITPESIASPKDFTPENKKNDEEAFICHYCDAKFKIRGYLTRHIRKHAIEKAFKCPYF 155

Query: 319 ---------CHSR--HKRKDNLSQHLKLKH 337
                    CHS     R+D    HLK +H
Sbjct: 156 NATLPKTLRCHSTGGFSRRDTFKIHLKSRH 185

>NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256
          Length = 274

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 282 FENIHKCHF---CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHA 338
           ++N  KC     C  AF R   L RH+  H+  KP+ C  C  R  R DNL QH +  HA
Sbjct: 15  YKNNFKCTGYGDCHMAFTRAEHLARHIRKHTGEKPFQCDVCLKRFSRVDNLKQHRESVHA 74

Query: 339 EML 341
            ++
Sbjct: 75  TVV 77

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 277 MDPNSF-----ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNL 329
            DP++F     E   +C FC + F R    KRH+ +H+  KP+ C  P C     R+D L
Sbjct: 7   QDPSTFAADNDERPFRCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFPHCKKGFSRRDEL 66

Query: 330 SQHLK 334
            +H++
Sbjct: 67  KRHIR 71

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQH 332
           C  C +AF R+  L RH  SH+  KPY C  C  R  R+D L +H
Sbjct: 61  CKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLLRH 105

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           ++ C  C++ F     L RH  S HS  KPYSCP C  + KR+D++ QHL  K
Sbjct: 787 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 839

>ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} similar
           to uniprot|Q00947 Saccharomyces cerevisiae YDR463W STP1
           and uniprot|P38704 Saccharomyces cerevisiae YHR006W STP2
           Transcription factor
          Length = 587

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRKDNLS 330
           E +  CH+C+  FK + +L RH+  H+  K Y CP+          CH+     R+D   
Sbjct: 201 EGLFVCHYCDAKFKIRGYLTRHIKKHAIQKAYHCPFFMGEAPPELRCHNSGGFSRRDTYK 260

Query: 331 QHLKLKH 337
            HL+ +H
Sbjct: 261 THLRTRH 267

>ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 849

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 35/66 (53%)

Query: 269 SNVTSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDN 328
           S  T +Q M  +S E   KCH C K+F   S LK H+ +H+  KP  C  C  R     N
Sbjct: 746 SEDTLNQHMRTHSGEKPFKCHLCGKSFSVSSSLKIHIRTHTGEKPLQCKICGKRFNESSN 805

Query: 329 LSQHLK 334
           L++HLK
Sbjct: 806 LNKHLK 811

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 288 CHF--CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
           CH+  C + F ++  + RHL  HS  KP+ C  C      +D L+QH++    E
Sbjct: 707 CHWKGCCRKFTQRQKMVRHLKVHSGYKPFKCQVCLKSFSSEDTLNQHMRTHSGE 760

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE--- 343
           KC  C K+F  +  L +H+ +HS  KP+ C  C        +L  H++    E  L+   
Sbjct: 736 KCQVCLKSFSSEDTLNQHMRTHSGEKPFKCHLCGKSFSVSSSLKIHIRTHTGEKPLQCKI 795

Query: 344 ---RLSSNPNTASHL 355
              R + + N   HL
Sbjct: 796 CGKRFNESSNLNKHL 810

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 335
           +C  C K   R S L+ H+L H+ ++P+SC W  C      K N+++HLKL
Sbjct: 448 QCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKL 498

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLK 334
           KC  C K F R    +RH+ +H+  KP+SC  P C  R  R D L +H++
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVR 64

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKH 337
           C  C +AF R+  L RH  SH+  KPY+C  C  +  R+D L +H +  H
Sbjct: 118 CEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVH 167

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE------ 339
           H+C +C + F + + L+ H+ SH   KP+ C +C  R  +  NL  H +L   E      
Sbjct: 583 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCD 642

Query: 340 MLLERLSSNPNTASHLM 356
           +  ++ S   N A+HL+
Sbjct: 643 ICDKKFSRKGNLAAHLV 659

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  + C  C+K F RK  L  HL++H  +KP+ C    C+    +  N+  H    H E 
Sbjct: 636 EKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKET 695

Query: 341 L 341
           L
Sbjct: 696 L 696

>KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|P47043 Saccharomyces
           cerevisiae YJL056C ZAP1 Zinc-regulated transcription
           factor binds to zinc-responsive promoter elements to
           induce transcription of certain genes in the presence of
           zinc regulates its own transcription contains seven
           zinc- finger domains
          Length = 781

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           KCH C K++   S L+ H+ +H+  KP SCP C+ R     NL++H++
Sbjct: 721 KCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPICNKRFNESSNLAKHIR 768

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 286 HKCHF--CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
           +KC +  C K F +K  L RHL  HS  KP+ C  C      +D L+QHL++   E
Sbjct: 662 YKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFRCAECGKCFNTQDILTQHLRVHSGE 717

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLL---- 342
           +C  C K F  +  L +HL  HS  +P+ C  C   +    +L  H++    E  L    
Sbjct: 693 RCAECGKCFNTQDILTQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPI 752

Query: 343 --ERLSSNPNTASHL 355
             +R + + N A H+
Sbjct: 753 CNKRFNESSNLAKHI 767

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE------ 339
           H+C +C + F + + L+ H+ SH   KP+ C +C  R  +  NL  H +L   E      
Sbjct: 593 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCD 652

Query: 340 MLLERLSSNPNTASHLM 356
           +  ++ S   N A+HL+
Sbjct: 653 ICDKKFSRKGNLAAHLV 669

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  + C  C+K F RK  L  HL++H  +KP+ C    C+    +  N+  H    H E 
Sbjct: 646 EKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKET 705

Query: 341 L 341
           L
Sbjct: 706 L 706

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQH 332
           C  C +AF R+  L RH  SH+  KPY C  C  +  R+D L +H
Sbjct: 120 CSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRH 164

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE------ 339
           H+C +C + F + + L+ H+ SH   KP+ C +C  R  +  NL  H +L   E      
Sbjct: 594 HECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCD 653

Query: 340 MLLERLSSNPNTASHLM 356
           +  ++ S   N A+HL+
Sbjct: 654 ICDKKFSRKGNLAAHLV 670

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  + C  C+K F RK  L  HL++H  +KP+ C    C+    +  N+  H    H E 
Sbjct: 647 EKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKET 706

Query: 341 L 341
           L
Sbjct: 707 L 707

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           C+ C ++F     L RH  + H   KP+SCP C  R KR+D++ QHL  K
Sbjct: 392 CYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKK 441

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 280 NSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKH 337
           ++FE  + C  C + F R    KRHL  H+  KPY C +  C  +  R D L++H K+ H
Sbjct: 13  DNFERPYLCEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYLNCSKKFSRSDELNRHSKVHH 72

Query: 338 AE 339
           + 
Sbjct: 73  SR 74

>ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 930

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKL------KHAE 339
           H+C +C + F + + L+ H+ SH   KP+ C  C  R  +  NL  H +L         E
Sbjct: 562 HECPYCHRFFTQSTHLEVHVRSHIGYKPFLCECCGKRFTQGGNLRTHQRLHTGEKPYECE 621

Query: 340 MLLERLSSNPNTASHLM 356
           +  +R S   N A+H++
Sbjct: 622 LCGKRFSRKGNLAAHIV 638

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  ++C  C K F RK  L  H+++H  +KP+ C    C+    +  N+  H    H   
Sbjct: 615 EKPYECELCGKRFSRKGNLAAHIVTHQKLKPFVCKLDGCNKTFTQLGNMKAHQNRFHLNT 674

Query: 341 LLE 343
           L E
Sbjct: 675 LNE 677

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE--- 343
           +C +C K F + + L+ H+ SH   KP+SC +C  R  +  NL  H++L   E   E   
Sbjct: 524 QCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEFCGKRFTQGGNLRTHIRLHTGEKPYECER 583

Query: 344 ---RLSSNPNTASHLM 356
              + S   N A+H +
Sbjct: 584 CGRKFSRKGNLAAHKL 599

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 2/61 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  ++C  C + F RK  L  H L+H  +KP+ C    C+    +  N+  H    H + 
Sbjct: 576 EKPYECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFHLQT 635

Query: 341 L 341
           L
Sbjct: 636 L 636

>KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {ON}
           Anc_4.214 YGR067C
          Length = 1010

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLL 342
           + C +C KAF R     RH  SH+  KP+ C  C     R+D + +H+K  H  ++L
Sbjct: 8   YICSYCAKAFSRSEHRTRHERSHTGYKPFQCKICQHCFVRRDLVQRHIKTVHRLLIL 64

>KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {ON}
           Anc_4.214 YGR067C
          Length = 749

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEM 340
           + C FC KAF R     RH  SH+  KP+ C  C+    R+D + +H+K  H ++
Sbjct: 8   YVCSFCAKAFSRSEHRIRHERSHTGYKPFQCNICNHAFVRRDLVQRHIKTVHKDI 62

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           ++ C  C++ F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 686 VYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 738

>Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON}
           YGR067C (REAL)
          Length = 806

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           + C FC K F R     RH  SH+ +KP+ C  C     R+D L +H++  H   LL   
Sbjct: 8   YICSFCLKPFSRSEHKMRHERSHAGVKPFQCQICKHSFVRRDLLQRHIRTVHRTFLLSSC 67

Query: 346 SSNPNTASHL 355
           +S   + + L
Sbjct: 68  ASMVESKAEL 77

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQH 332
           C  C +AF R+  L RH  SH+  KPY C  C+ +  R+D L +H
Sbjct: 88  CQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRH 132

>Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON}
           (42259..43791) [1533 nt, 511 aa]
          Length = 510

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%)

Query: 271 VTSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLS 330
           V   +LM+    +  HKC +C+K F +   L  H   H+  +PY C  C+ R  RK NL+
Sbjct: 362 VPKQELMEEVVDKRQHKCAYCDKRFSQTGNLNTHQRLHTGERPYECHICNKRFSRKGNLT 421

Query: 331 QHL 333
            H+
Sbjct: 422 AHV 424

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCP--WCHSRHKRKDNLSQHLKLKHAEMLLE 343
           ++CH C K F RK  L  H+++H  +KPY C    C+ +  +  N+  H    H E +L 
Sbjct: 405 YECHICNKRFSRKGNLTAHVITHKKLKPYICKVDGCNKKFTQLGNMKVHQNKFHYETIL- 463

Query: 344 RLSSNPN 350
           RLS + N
Sbjct: 464 RLSDSFN 470

>KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5.586
           YHR006W
          Length = 314

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 18/83 (21%)

Query: 267 GVSNVTSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW-------- 318
           G +  +SS  M+P        CH+C+  F+ + +L RH+  H+  K + CP+        
Sbjct: 48  GPARPSSSSAMEP------FVCHYCDARFRMRGYLTRHIKKHAIEKAFRCPFFQRGQPRD 101

Query: 319 --CH--SRHKRKDNLSQHLKLKH 337
             CH      R+D    HLK+KH
Sbjct: 102 LQCHPSGGFSRRDTYKTHLKVKH 124

>KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {ON}
           Anc_5.586 YHR006W
          Length = 600

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRKDNLSQHLKL 335
           CH+C+  FK + +L RH+  H+  K Y CP+          CH+     R+D    HLK 
Sbjct: 201 CHYCDATFKIRGYLTRHIKKHAIDKAYHCPFFNATLGTELKCHNTGGFSRRDTYKTHLKT 260

Query: 336 KH 337
           +H
Sbjct: 261 RH 262

>KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5.586
           YHR006W
          Length = 235

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 13/79 (16%)

Query: 272 TSSQLMDPNSFEN-IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CH 320
           +S+ L D  S  N ++ CH+C+ +F+ + +L RH+  HS  K Y CP+          CH
Sbjct: 20  SSAPLSDKTSKTNGMYVCHYCDASFRIRGYLTRHIKKHSIEKAYHCPFYNEHQPSELKCH 79

Query: 321 SR--HKRKDNLSQHLKLKH 337
           +     R+D    HLK +H
Sbjct: 80  NSGGFSRRDTYKTHLKSRH 98

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKH 337
           C  C +AF R+  L RH  SH+  KPY C  C  +  R+D L +H +  H
Sbjct: 80  CDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVH 129

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKL 335
           CH+C K F   S L+ H+ +H+  KP SC  C  R     NLS+H+K+
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSCTVCGKRFNESSNLSKHMKI 621

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 40/90 (44%), Gaps = 9/90 (10%)

Query: 275 QLMDPNSFENIHK---CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQ 331
           +L  P+   + HK   C  C K F     L +H+ +HS  +P+ C +C  +     +L  
Sbjct: 530 KLFAPHQGTHRHKPCSCPHCPKTFSTDDILAQHIRTHSGERPFHCHYCRKQFSTSSSLRV 589

Query: 332 HLKLKHAEMLL------ERLSSNPNTASHL 355
           H++    E  L      +R + + N + H+
Sbjct: 590 HIRTHTGEKPLSCTVCGKRFNESSNLSKHM 619

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           ++ C  C++ F     L RH  S HS  KPYSCP C  + KR+D++ QHL  K
Sbjct: 755 VYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 807

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 334
           +CH C+K   R + LK HLL H+   P+ CPW  C      K N+ +HLK
Sbjct: 150 QCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLK 199

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%)

Query: 291 CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLL 342
           C  +F R   L RH+  H+  KP+ CP C     R DNL QH +  HA   L
Sbjct: 52  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHKQL 103

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 291 CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHA 338
           C  +F R   L RH+  H+  KP+ CP C     R DNL QH +  HA
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHA 96

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 38/78 (48%), Gaps = 7/78 (8%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLKLKHAEML--- 341
           KC  C++ F R    KRH+ +H+  KPY C  P C     R D L +H K+ H   L   
Sbjct: 18  KCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSFPDCPKSFSRTDELKRHSKI-HGNFLSTA 76

Query: 342 -LERLSSNPNTASHLMNR 358
            ++RL    +TA   + R
Sbjct: 77  TIKRLEKKRSTAPKQVTR 94

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 335
           IH+C  C +   R   L  H+L H+  KP+ C W  C      K NLS+H+K+
Sbjct: 425 IHQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKI 477

>Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C
           (REAL)
          Length = 878

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 30/54 (55%)

Query: 281 SFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           S E  +KCH C+K F   S LK H+ +H+  KP  C  C  R     NLS+H+K
Sbjct: 789 SGEKPYKCHICDKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIK 842

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%)

Query: 289 HFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
           H C + F ++  L RHL  HS  KPY C  C      ++ L QH +    E
Sbjct: 741 HDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGE 791

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 6/76 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE-- 343
           +KC  C++ F  +  L +H  +HS  KPY C  C  +     +L  H++    E  L+  
Sbjct: 766 YKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICDKKFAISSSLKIHIRTHTGEKPLQCK 825

Query: 344 ----RLSSNPNTASHL 355
               R + + N + H+
Sbjct: 826 ICGKRFNESSNLSKHI 841

>NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586
          Length = 454

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRKDNLSQHLKL 335
           CH C   F+ K +L RHL  H+T K Y+CP+          CH+     R+D    HLK 
Sbjct: 102 CHHCNAQFRIKGYLTRHLKKHATEKAYTCPFFNTDSPPELRCHNSGGFSRRDTYKTHLKS 161

Query: 336 KH 337
           +H
Sbjct: 162 RH 163

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 2/69 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERLSS 347
           C  C + F R+  LKRH  +H++ KP+ C +C     R+D + +H    H+ ++ +  S+
Sbjct: 56  CSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLHSSLISK--SN 113

Query: 348 NPNTASHLM 356
           N NT   LM
Sbjct: 114 NDNTFEKLM 122

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 335
           KC  C K F+R S L  H   H+  KPY CP+  CH     K N+ +H KL
Sbjct: 209 KCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYENCHKSFNAKSNMFRHYKL 259

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLL---ER 344
           C  C + F R+  LKRH  +H+  KP+ C +C     R+D + +H +  H+ +     E 
Sbjct: 80  CSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLHSTLADSGPEE 139

Query: 345 LSSNPNTASHLMNR 358
           ++ N ++ SHL  R
Sbjct: 140 VAVNRDSKSHLNER 153

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKL------KHAE 339
           H+C +C + F + + L+ H+ SH   KP+ C +C  R  +  NL  H +L         E
Sbjct: 600 HECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGKRFTQGGNLRTHQRLHTGEKPYRCE 659

Query: 340 MLLERLSSNPNTASHLM 356
           +  +R S   N A+H +
Sbjct: 660 ICDKRFSRKGNLAAHKL 676

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 6/74 (8%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  ++C  C+K F RK  L  H L+H  +KP+ C    C+    +  N+  H    H + 
Sbjct: 653 EKPYRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFHLQT 712

Query: 341 LLERLSS----NPN 350
           LLE  S     NPN
Sbjct: 713 LLELTSKIAEMNPN 726

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 291 CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHA 338
           C  +F R   L RH+  H+  KP+ CP C     R DNL QH +  HA
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHA 96

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           I+ C  C++ F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 901 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953

>YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}
           STP1Transcription factor, undergoes proteolytic
           processing by SPS (Ssy1p-Ptr3p-Ssy5p)-sensor component
           Ssy5p in response to extracellular amino acids;
           activates transcription of amino acid permease genes and
           may have a role in tRNA processing
          Length = 519

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 12/71 (16%)

Query: 280 NSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRKD 327
           N+ E    CH+C+  F+ + +L RH+  H+  K Y CP+          CH+     R+D
Sbjct: 154 NNGEEEFICHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNSATPPDLRCHNSGGFSRRD 213

Query: 328 NLSQHLKLKHA 338
               HLK +H 
Sbjct: 214 TYKTHLKARHV 224

>Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON}
           YGR067C (REAL)
          Length = 810

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           + C FC K F R     RH  SH+ +KP+ C  C     R+D L +H++  H   LL   
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQICKHSFVRRDLLQRHIRTVHRSFLLSSC 67

Query: 346 SS 347
           +S
Sbjct: 68  AS 69

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           I+ C  C + F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463W
           (REAL)
          Length = 514

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 12/63 (19%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRKDNLSQHLKL 335
           CH+C+  F+ + +L RH+  H+  K Y CP+          CH+     R+D    HLK 
Sbjct: 162 CHYCDATFRIRGYLTRHIKKHAIEKAYHCPFFNGATPPDLRCHNSGGFSRRDTYKTHLKA 221

Query: 336 KHA 338
           +H 
Sbjct: 222 RHV 224

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLKLKHAEML 341
           C  C K F RK+ L  HLL H+ ++PY C  P C      K NL++HLK+   + L
Sbjct: 111 CPVCLKEFTRKTSLNTHLLIHADIRPYRCKYPDCKKTFNVKSNLNRHLKIHKKQEL 166

>NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {ON}
           Anc_4.214
          Length = 1169

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 26/54 (48%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEML 341
           C FC KAF R     RH  SH+  KPY C  C     R D   +HLK  H + +
Sbjct: 89  CSFCAKAFSRSEHKIRHERSHTGFKPYKCLLCDHSFVRSDLTIRHLKTVHKDQI 142

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           I+ C  C + F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463W
           (REAL)
          Length = 516

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 12/63 (19%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRKDNLSQHLKL 335
           CH+C+  F+ + +L RH+  H+  K Y CP+          CH+     R+D    HLK 
Sbjct: 162 CHYCDATFRIRGYLTRHIKKHAIRKAYHCPFFNCATPPDLRCHNSGGFSRRDTYKTHLKA 221

Query: 336 KHA 338
           +H 
Sbjct: 222 RHV 224

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLK 334
           KC  C K F R    +RH+ +H+  KP++C  P C  R  R D L +H++
Sbjct: 14  KCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVR 63

>CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P38704 Saccharomyces
           cerevisiae YHR006w SPT2 or uniprot|Q00947 Saccharomyces
           cerevisiae YDR463w STP1
          Length = 688

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 14/76 (18%)

Query: 274 SQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR- 322
           S+ +D +  E +  CH+C+  F+ + +L RH+  H+  K Y CP+          CH+  
Sbjct: 188 SETLDDDEKEFV--CHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFYNGQEVPSKRCHNSG 245

Query: 323 -HKRKDNLSQHLKLKH 337
              R+D    H+K +H
Sbjct: 246 GFSRRDTYKTHMKARH 261

>NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 12/74 (16%)

Query: 276 LMDPNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--H 323
           L++    E    CH+C+  F+ + +L RH+  H+  K Y CP+          CH+    
Sbjct: 263 LVEDTEEEGTFVCHYCDAKFRIRGYLTRHIKKHAIEKAYHCPFFNNDALPELRCHNSGGF 322

Query: 324 KRKDNLSQHLKLKH 337
            R+D    HLK +H
Sbjct: 323 SRRDTYKTHLKARH 336

>TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa]
           {ON} Anc_4.80 YGL035C
          Length = 390

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 36/74 (48%), Gaps = 12/74 (16%)

Query: 279 PNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLKLK 336
           PN     H C  C +AF R     RH+ +H+  KP+SC  P C  +  R D L++H    
Sbjct: 65  PNEAPRPHVCPVCNRAFHRLEHQTRHIRTHTGEKPHSCDFPGCTKKFSRSDELTRH---- 120

Query: 337 HAEMLLERLSSNPN 350
                 +R+ +NPN
Sbjct: 121 ------KRIHTNPN 128

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           I+ C  C + F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 849 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 901

>Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON}
           YER028C (REAL)
          Length = 406

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 279 PNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 334
           P++     KC FC + F R    KRH+ +H+  KP++C +  C     R D L +HL+
Sbjct: 10  PDNDRRPFKCEFCSRGFHRLEHKKRHVRTHTGEKPHACSFRGCPKSFSRSDELKRHLR 67

>Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           I+ C  C + F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {ON}
           weakly similar to uniprot|Q00947 Saccharomyces
           cerevisiae YDR463W STP1 Transcription factor activated
           by proteolytic processing in response to signals from
           the SPS sensor system for external amino acids activates
           transcription of amino acid permease genes and may have
           a role in tRNA processing
          Length = 623

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 12/62 (19%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRKDNLSQHLKL 335
           CH+C+  FK + +L RH+  H+  K Y CP+          CHS     R+D+   HL+ 
Sbjct: 244 CHYCDAEFKMRGYLTRHIKKHAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTHLRS 303

Query: 336 KH 337
           +H
Sbjct: 304 RH 305

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 267 GVSNVTSSQLMDPNSFENIHK---CHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHS 321
           G S  T  +   PNS  +  +   C  C +AF R     RH+ +H+  KP++C  P C  
Sbjct: 12  GDSASTRKKKRSPNSGPDSPRPYVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGK 71

Query: 322 RHKRKDNLSQHLKL 335
           R  R D L++H ++
Sbjct: 72  RFSRSDELTRHTRI 85

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 291 CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHA 338
           C  +F R   L RH+  H+  KP+ CP C     R DNL QH +  HA
Sbjct: 49  CAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHA 96

>Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON}
           YGR067C (REAL)
          Length = 812

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           + C FC K F R     RH  SH+ +KP+ C  C     R+D L +H++  H   LL   
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVHRSFLLSNC 67

Query: 346 SS 347
           +S
Sbjct: 68  AS 69

>TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON}
           Anc_5.586 YHR006W
          Length = 481

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 12/62 (19%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRKDNLSQHLKL 335
           CH+C+  F+ + +L RH+  H+  K + CP+          CH+     R+D    HLK+
Sbjct: 101 CHYCDAVFRIRGYLTRHIKKHAIQKAFHCPFYNDSASSKLKCHTTGGFSRRDTYKAHLKI 160

Query: 336 KH 337
           +H
Sbjct: 161 RH 162

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEML 341
           C  C + F R+  LKRH  SH+  KP+ C +C     R+D + +H +  HA ++
Sbjct: 75  CPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLM 128

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           KCH C+K+F   + LK H+ +H+  KP  C  C  R     NLS+H+K
Sbjct: 669 KCHLCDKSFSVSTSLKIHIRTHTGEKPLECKVCGRRFNESSNLSKHMK 716

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%)

Query: 289 HFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
           H C K F ++  + RHL  HS  KPY C  C       + L QH ++   E
Sbjct: 615 HGCNKEFSQRQKIVRHLKVHSGFKPYKCEVCSKCFSSDETLKQHSRVHSGE 665

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 6/81 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE-- 343
           +KC  C K F     LK+H   HS  KP+ C  C        +L  H++    E  LE  
Sbjct: 640 YKCEVCSKCFSSDETLKQHSRVHSGEKPFKCHLCDKSFSVSTSLKIHIRTHTGEKPLECK 699

Query: 344 ----RLSSNPNTASHLMNRLH 360
               R + + N + H+    H
Sbjct: 700 VCGRRFNESSNLSKHMKTHEH 720

>YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON}
           Putative protein of unknown function; contains a zinc
           finger motif similar to that of Adr1p
          Length = 804

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           + C FC K F R     RH  SH+ +KP+ C  C     R+D L +H++  H   LL   
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVHRTFLLSSY 67

Query: 346 SS 347
           +S
Sbjct: 68  AS 69

>ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No
           homolog in Saccharomyces cerevisiae
          Length = 146

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 284 NIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 335
           N   C  C K F RK+ L  HLL H+ ++PY C +  C+     K NL++HL++
Sbjct: 74  NSKTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRI 127

>Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHL-KLKHAEMLLERLS 346
           CH C + F R+  LKRH  +H+  KP+ C +C     R+D + +H  KL  A +  E ++
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKESVN 122

Query: 347 SNPNTASHLMN 357
           S   T    MN
Sbjct: 123 SKDKTEIDAMN 133

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 334
           ++CH C K   R S L+ H+L H+ +KPY C W  C+     K N+ +H K
Sbjct: 285 NQCHICGKVCSRPSTLRTHVLVHTGVKPYPCEWPGCNRSFNVKSNMIRHYK 335

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLK 334
           +KC  C + F R    KRHL +H+  KP+ C  P C     R D L +HL+
Sbjct: 20  YKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRHLR 70

>TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298
          Length = 833

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCP--WCHSRHKRKDNLSQHLKL 335
           +KC +C K F+R S LK HL  H+ ++P+ CP   C      + N+ +H KL
Sbjct: 714 NKCEYCLKKFRRPSSLKTHLNIHTGIQPFKCPSKRCDKSFNARSNMLRHYKL 765

>Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON}
           similar to Ashbya gossypii ADL051W
          Length = 223

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 335
           CH C K+F RK+ L+ H+L H+ +KPY C +  C+     K NL +H ++
Sbjct: 161 CHICLKSFTRKTSLQTHMLIHTKVKPYRCSYQRCNKTFNVKSNLYRHERI 210

>Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 bp,
           515 aa] {ON} YGL035C (REAL)
          Length = 515

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLKL 335
           H C  C++AF R     RH+  H+  KP++C  P C  R  R D L++H ++
Sbjct: 38  HACPICQRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRI 89

>YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC
           domain-containing histone demethylase; specifically
           demethylates H3K36 tri- and dimethyl modification
           states; associates with actively transcribed (RNA
           polymerase II) regions in vivo and specifically targets
           H3K36 in its trimethylation state as its substrate;
           transcriptional repressor of PHR1; Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 796

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           I+ C  C++ F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 708 IYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 760

>TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}
          Length = 224

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERL 345
           C+ C+  F R+S LKRH  +H ++ P+ C  C     RKD+L +H      +   E+L
Sbjct: 140 CNKCDMEFTRQSDLKRHEKTHMSVGPHICSQCGKDFARKDSLKRHANTMQCKKNREKL 197

>NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa]
           {ON} Anc_5.586
          Length = 367

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 13/71 (18%)

Query: 279 PNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRK 326
           PN+  N + CH+C+  F+ K +L RH+  H+  K Y CP+          CH+     R+
Sbjct: 90  PNAI-NEYVCHYCQAKFRIKGYLTRHIKKHAVEKAYHCPFFSTESPPELRCHNSGGFSRR 148

Query: 327 DNLSQHLKLKH 337
           D    HLK +H
Sbjct: 149 DTYKTHLKARH 159

>TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.162
           YOR113W
          Length = 425

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHL 333
           HKC FC   F +   LK H   H++ K + C  C+ +  RK NL+ H+
Sbjct: 279 HKCRFCNVCFTQSGNLKTHEKLHTSEKDFECEICNKKFSRKGNLASHI 326

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE--- 343
           +C FC K F + S  + H+ SH   KP+ C +C+    +  NL  H KL  +E   E   
Sbjct: 252 QCSFCLKVFNQASHFEVHIRSHIGYKPHKCRFCNVCFTQSGNLKTHEKLHTSEKDFECEI 311

Query: 344 ---RLSSNPNTASHLM--NRLH 360
              + S   N ASH+   NRL 
Sbjct: 312 CNKKFSRKGNLASHIATHNRLR 333

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 21/40 (52%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSR 322
           E   +C  C K F RK  L  H+ +H+ ++ + C + H +
Sbjct: 304 EKDFECEICNKKFSRKGNLASHIATHNRLRLHICKFDHCK 343

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQH 332
           C  C + F R+  LKRH +SH+  KP+ C +C     RKD + +H
Sbjct: 36  CSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 80

>Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W
           (REAL)
          Length = 777

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERLSS 347
           CH C + F R+  LKRH  +H+  KP+ C +C     R+D     L L+H   L   L S
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRD-----LVLRHQHKLHSALVS 117

Query: 348 NPNTASHLMNRL 359
             +  S   N +
Sbjct: 118 KESVDSRDKNEI 129

>TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON}
           Anc_4.351 YJR127C
          Length = 1384

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEML 341
           C  C + F R+  LKRH  SH+  KP+ C +C     R+D + +H +  H+ ++
Sbjct: 107 CQTCTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLILRHQRRLHSSLM 160

>Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056C
           (REAL)
          Length = 879

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 29/54 (53%)

Query: 281 SFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           S E  +KCH C K F   S LK H+ +H+  KP  C  C  R     NLS+H+K
Sbjct: 790 SGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIK 843

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%)

Query: 289 HFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
           H C + F ++  L RHL  HS  KPY C  C      ++ L QH +    E
Sbjct: 742 HDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGE 792

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 6/76 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE-- 343
           +KC  C++ F  +  L +H  +HS  KPY C  C+ +     +L  H++    E  L+  
Sbjct: 767 YKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCK 826

Query: 344 ----RLSSNPNTASHL 355
               R + + N + H+
Sbjct: 827 ICGKRFNESSNLSKHI 842

>Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W
           (REAL)
          Length = 798

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           I+ C  C++ F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 710 IYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 762

>Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W
           (REAL)
          Length = 802

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           I+ C  C++ F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 715 IYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 767

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLKL 335
           H C  C +AF R     RH+ +H+  KP++C  P C  R  R D L++H ++
Sbjct: 43  HVCPVCGRAFHRLEHQTRHMRTHTGEKPHACDFPGCTKRFSRSDELTRHKRI 94

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 335
           E   KC  C + F R    KRH+ +H+  KP+ CP   C+    R D L +H+K+
Sbjct: 13  ERPFKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMKV 67

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQH 332
           C  C +AF R   L+RH  SH+  KPY C  C     R+D L +H
Sbjct: 77  CKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLRH 121

>YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON}
           ZAP1Zinc-regulated transcription factor; binds to
           zinc-responsive promoters to induce transcription of
           certain genes in presence of zinc, represses other genes
           in low zinc; regulates its own transcription; contains
           seven zinc-finger domains
          Length = 880

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 29/54 (53%)

Query: 281 SFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLK 334
           S E  +KCH C K F   S LK H+ +H+  KP  C  C  R     NLS+H+K
Sbjct: 791 SGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIK 844

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%)

Query: 289 HFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
           H C + F ++  L RHL  HS  KPY C  C      ++ L QH +    E
Sbjct: 743 HDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGE 793

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 6/76 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE-- 343
           +KC  C++ F  +  L +H  +HS  KPY C  C+ +     +L  H++    E  L+  
Sbjct: 768 YKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCK 827

Query: 344 ----RLSSNPNTASHL 355
               R + + N + H+
Sbjct: 828 ICGKRFNESSNLSKHI 843

>KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.80
           YGL035C
          Length = 335

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLKL 335
           H C  C++AF R     RH+ +H+  KP++C  P C  R  R D L++H ++
Sbjct: 21  HVCPICQRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI 72

>NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {ON}
           Anc_5.586
          Length = 532

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRKDNLSQHLKL 335
           CH+C+  F+ + +L RH+  H+  K Y CP+          CH+     R+D    HLK 
Sbjct: 185 CHYCDAKFRIRGYLTRHIKKHAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTHLKA 244

Query: 336 KH 337
           +H
Sbjct: 245 RH 246

>TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON}
           Anc_5.586 YHR006W
          Length = 312

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CH--SRHKRKDNLSQHLKL 335
           CH+C+ +F+  S+L RH+  H+  K + CP+          CH      RKD    HLK 
Sbjct: 15  CHYCDASFRLMSYLTRHIKKHAIEKAFKCPFYNEKLPADLRCHVSGGFSRKDTFKMHLKC 74

Query: 336 KH 337
           +H
Sbjct: 75  RH 76

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEML 341
           C  C K FKR S L+ H++ H+  KPY C    C  R   K N+ +H++ KH E++
Sbjct: 251 CEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMR-KHKEVV 305

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEM 340
           I+ C  C+K F R   LK HL +H+  +P+ C  C+    R     QH + +H ++
Sbjct: 650 IYACELCDKKFTRPYNLKSHLRTHTNERPFICSICNKAFAR-----QHDRKRHEDL 700

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 9/64 (14%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSC--------PW-CHSRHKRKDNLSQHLKLKHA 338
           C  C KAF R+   KRH   H+  K Y C         W C  +  R D L +H K +  
Sbjct: 681 CSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSWGCGKKFARSDALGRHFKTESG 740

Query: 339 EMLL 342
           +  +
Sbjct: 741 KRCI 744

>Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa]
           {ON} YER169W (REAL)
          Length = 797

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 285 IHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 336
           I+ C  C++ F     L RH  S HS  KP+SCP C  R KR+D++ QHL  K
Sbjct: 709 IYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 761

>NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80
          Length = 493

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLKL 335
           H C  C++AF R     RHL +H+  KP  C  P C  R  R D L++H ++
Sbjct: 43  HVCPVCQRAFHRLEHQTRHLRTHTGEKPNVCDFPGCIKRFSRSDELTRHKRI 94

>NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256
          Length = 394

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 31/68 (45%)

Query: 291 CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERLSSNPN 350
           C  AF R   L RH+  H+  KPY C  C     R DNL QH    H + +   LS    
Sbjct: 27  CSMAFTRAEHLTRHIRKHTGEKPYHCGICSKNFSRIDNLKQHEDCVHHKGVSNCLSRGHK 86

Query: 351 TASHLMNR 358
           T +++  R
Sbjct: 87  TTTNMKRR 94

>KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON} 
          Length = 467

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKL------KHAE 339
           H+C +C + F + + L+ H+ SH   KP+ C +C  +  +  NL  H +L         E
Sbjct: 302 HECPYCHRLFSQSTHLEVHIRSHIGYKPFQCQFCGKKFTQGGNLRTHQRLHTGEKPYQCE 361

Query: 340 MLLERLSSNPNTASHLM 356
               R S   N A+H++
Sbjct: 362 SCGRRFSRKGNLAAHIL 378

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 283 ENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEM 340
           E  ++C  C + F RK  L  H+L+H  +KP+ C    C     +  N+  H    H   
Sbjct: 355 EKPYQCESCGRRFSRKGNLAAHILTHKNLKPFVCKLDNCDKSFTQLGNMKAHQNRFHLNT 414

Query: 341 LLE 343
           L+E
Sbjct: 415 LIE 417

>Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W
           (REAL)
          Length = 535

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRKDNLSQHLKL 335
           CH+C+  F+ + +L RH+  H+  K Y CP+          CH+     R+D    HLK 
Sbjct: 207 CHYCDARFRIRGYLTRHIKKHAKRKAYHCPFFDDSISQELRCHTSGGFSRRDTYKTHLKS 266

Query: 336 KH 337
           +H
Sbjct: 267 RH 268

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLERLS- 346
           C  C + F R   LKRH +SH+  KP+ C +C     RKD + +H    H  ++ ++ S 
Sbjct: 38  CSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRHQYKLHPALVSQKDSK 97

Query: 347 -SNPNTAS 353
            SN NT S
Sbjct: 98  DSNSNTNS 105

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKLKHAEMLLERL 345
           C  C K F+R    KRH+ +H+  KP+ C +  C  +  R D L +HLK+ H      R 
Sbjct: 15  CDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKI-HVNKKKNRA 73

Query: 346 SSN 348
           S N
Sbjct: 74  SKN 76

>KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} similar
           to uniprot|Q74ZT1 Ashbya gossypii AGR117C AGR117Cp and
           some similarites with YER169W uniprot|P39956
           Saccharomyces cerevisiae YER169W RPH1 Transcriptional
           repressor of PHR1 which is a photolyase induced by DNA
           damage binds to AG(4) (C(4)T) sequence upstream of PHR1
           Rph1p phosphorylation during DNA damage is under control
           of the MEC1-RAD53 pathway
          Length = 821

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 269 SNVTSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKD 327
           S +   ++M  +    ++ C  C + F     L RH  S HS  KP+SCP C  + KR+D
Sbjct: 738 SKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 797

Query: 328 NLSQHLKLK 336
           ++ QHL  K
Sbjct: 798 HVLQHLNKK 806

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEML 341
           C  C + F R+  LKRH  SH+  KP+ C +C     R+D + +H +  HA ++
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLM 135

>SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 767

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 37/80 (46%), Gaps = 2/80 (2%)

Query: 281 SFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEM 340
           S E   KC +C K F   S L+ H+ +H+  KP  C  C  R     NLS+H+K    + 
Sbjct: 681 SGERPFKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKICGKRFNESSNLSKHMKTHERKY 740

Query: 341 LLERLSSNPNTASHLMNRLH 360
             E+   + N    L  RLH
Sbjct: 741 KCEKCKRSFNQLEQL--RLH 758

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 291 CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
           C K+F ++  L RHL  HS  KP+ CP C  +   +D L QH++    E
Sbjct: 635 CSKSFTQRQKLLRHLKVHSGYKPFKCPHCTKKFSTEDILQQHIRTHSGE 683

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLL---- 342
           KC  C K F  +  L++H+ +HS  +P+ C +C  +     +L  H++    E  L    
Sbjct: 659 KCPHCTKKFSTEDILQQHIRTHSGERPFKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI 718

Query: 343 --ERLSSNPNTASHL 355
             +R + + N + H+
Sbjct: 719 CGKRFNESSNLSKHM 733

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQHLKL 335
           H C  C +AF R     RH+ +H+  KP++C  P C  R  R D L++H ++
Sbjct: 43  HVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRI 94

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEML 341
           C  C + F R+  L+RH  SH+  KP+ C +C     R+D + +H +  HA ++
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLHASLM 138

>CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly
           similar to uniprot|Q03833 Saccharomyces cerevisiae
           YDR096w GIS1 DNA damage-responsive repressor of PHR1
          Length = 625

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 267 GVSNVTSSQLMDPNSFENIHKCHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKR 325
            +  + +S++   + F+  + C  C+  F     L RH  S HS  KPY+CP C    KR
Sbjct: 544 SLGQIFNSKIRYSDGFKYFY-CEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKR 602

Query: 326 KDNLSQHLKLK 336
           KD++SQHLK K
Sbjct: 603 KDHVSQHLKKK 613

>KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1053

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 28/54 (51%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEML 341
           C  C + F R   LKRH  SH+  KPY C +C     RKD + +H    H E+L
Sbjct: 24  CPVCSRGFVRLEHLKRHQRSHTREKPYLCVFCGRCFARKDLVLRHQGKLHPEVL 77

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%)

Query: 281 SFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEM 340
           S E  +KC  C K+F   S LK H+ +H+  KP+ C  C  R     N S+H+K+   E 
Sbjct: 923 SGEKPYKCEICGKSFSISSSLKIHVRTHTGEKPFECKVCGKRFVESSNYSKHMKVHQHEK 982

Query: 341 L 341
           +
Sbjct: 983 M 983

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 280 NSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
           NS+E   K H C K FK++  + RHL +HS  KP+ C  C      K+ L QH +    E
Sbjct: 868 NSYE--CKWHNCHKVFKQRQKILRHLKTHSGFKPFKCDVCSRCFSSKETLIQHYRTHSGE 925

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 24/57 (42%)

Query: 287 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAEMLLE 343
           KC  C + F  K  L +H  +HS  KPY C  C        +L  H++    E   E
Sbjct: 901 KCDVCSRCFSSKETLIQHYRTHSGEKPYKCEICGKSFSISSSLKIHVRTHTGEKPFE 957

>CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some
           similarities with uniprot|P39943 Saccharomyces
           cerevisiae YER028c or uniprot|P53035 Saccharomyces
           cerevisiae YGL209w MIG2
          Length = 318

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 279 PNSFENIHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSC--PWCHSRHKRKDNLSQH 332
           P++F+   +C  C + F R    KRH  +H+  KP+ C  P C     R D L +H
Sbjct: 13  PDNFKRPFRCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRH 68

>NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {ON}
           Anc_6.256
          Length = 409

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 24/49 (48%)

Query: 291 CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
           C   F R+  L RH+  H+  KP+ C  C     R DNL QH +  H E
Sbjct: 23  CSMVFTREEHLARHIRKHTGEKPFQCDICLRFFSRVDNLKQHRETVHLE 71

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 335
           C  C K FKR S L  H+  H+  KPY CP+  C      K N+ +H KL
Sbjct: 280 CKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKL 329

>CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {ON}
           some similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230w USV1 or uniprot|Q00453 Saccharomyces
           cerevisiae YMR182c RGM1
          Length = 613

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 25/49 (51%)

Query: 291 CEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLSQHLKLKHAE 339
           CE +F R   L RH+  H+  KP+ C  C     R DNL QH    HA+
Sbjct: 33  CEMSFSRAEHLARHIRRHTGEKPFKCDICLKYFSRIDNLKQHKDTVHAK 81

>Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W
           (REAL)
          Length = 545

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 288 CHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW----------CHSR--HKRKDNLSQHLKL 335
           CH+C+  F+ + +L RH+  H+  K Y CP+          CH+     R+D    HLK 
Sbjct: 206 CHYCDSRFRIRGYLTRHIKKHAKRKAYHCPFFDGSISQELRCHNSGGFSRRDTYKTHLKS 265

Query: 336 KH 337
           +H
Sbjct: 266 RH 267

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.128    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,171,012
Number of extensions: 871697
Number of successful extensions: 4948
Number of sequences better than 10.0: 611
Number of HSP's gapped: 4670
Number of HSP's successfully gapped: 805
Length of query: 544
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 429
Effective length of database: 40,294,809
Effective search space: 17286473061
Effective search space used: 17286473061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)