Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_72542.534ON1671677891e-108
AGL072W2.534ON1671675094e-66
TDEL0A030802.534ON1671674904e-63
SAKL0A09504g2.534ON1671674896e-63
KNAG0C058002.534ON1671674852e-62
Skud_13.2272.534ON1671674765e-61
YMR071C (TVP18)2.534ON1671674732e-60
Suva_13.2482.534ON1671674722e-60
KLTH0D06864g2.534ON1671674712e-60
TPHA0G035202.534ON2041684682e-59
KAFR0A018702.534ON1671674618e-59
NCAS0F008902.534ON1671674574e-58
NDAI0H013902.534ON1671674541e-57
CAGL0K03025g2.534ON1671674531e-57
TBLA0G022402.534ON1671674495e-57
Smik_13.2502.534ON1671674461e-56
KLLA0E18525g2.534ON1711654106e-51
Kpol_348.92.534ON1301303363e-40
ZYRO0B02024g2.534ON1661553351e-39
Kwal_26.80252.534ON64641689e-16
KLLA0F19888g8.295ON491552663.3
TPHA0B043301.99ON74149645.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_7254
         (167 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to...   308   e-108
AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic hom...   200   4e-66
TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON...   193   4e-63
SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504...   192   6e-63
KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2....   191   2e-62
Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {O...   187   5e-61
YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}  ...   186   2e-60
Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {O...   186   2e-60
KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504...   186   2e-60
TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON...   184   2e-59
KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON...   182   8e-59
NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.53...   180   4e-58
NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.53...   179   1e-57
CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {...   179   1e-57
TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON...   177   5e-57
Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {O...   176   1e-56
KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} simil...   162   6e-51
Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON} c...   134   3e-40
ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {O...   133   1e-39
Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}...    69   9e-16
KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 a...    30   3.3  
TPHA0B04330 Chr2 (1013193..1015418) [2226 bp, 741 aa] {ON} Anc_1...    29   5.6  

>Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to
           Ashbya gossypii AGL072W
          Length = 167

 Score =  308 bits (789), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 155/167 (92%), Positives = 155/167 (92%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL
Sbjct: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
           GQG            KICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV
Sbjct: 61  GQGFFLLFVEVPFLVKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML
Sbjct: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167

>AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR071C (TVP18)
          Length = 167

 Score =  200 bits (509), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 126/167 (75%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+S KSF+NVPGI++DL+SFNFSVYGRWFGYINI+LC+ALGIANIFHF  VI F+I+A+
Sbjct: 1   MALSWKSFVNVPGILADLRSFNFSVYGRWFGYINILLCLALGIANIFHFSIVIAFAIVAI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            QG            KICPLS+ F+  VK  ++N +RT+LY  +A++Q+ SL  +VTSL+
Sbjct: 61  VQGLLLIFVEVPILLKICPLSDNFIGLVKKCDTNGRRTLLYTALAIVQYASLSVQVTSLL 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
            +AI LT+SAIFY +G+L KQEF E NV+R P    F  EA+VRE+L
Sbjct: 121 AVAIGLTISAIFYGTGYLKKQEFLEGNVIRNPTDPAFMREAAVREVL 167

>TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  193 bits (490), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 117/167 (70%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+ ++ FINV GIV DLKSFNFS+YGRWFGYINI LCIALGIAN+FH   VI F I+A+
Sbjct: 1   MALGVRQFINVAGIVKDLKSFNFSLYGRWFGYINIFLCIALGIANLFHVSAVIAFGIVAI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            QG            KICPLS+ F+  +K F +N  RT+ Y VMAVIQW S+  + TSL+
Sbjct: 61  VQGLIILFVEIPFLLKICPLSDNFIEFIKRFETNGYRTLFYVVMAVIQWCSIAVQATSLI 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           V+A+ LT+SA  YA      QEF+ +++L+ P SD FPHEA VREML
Sbjct: 121 VVAVGLTISACSYAVALTKHQEFQNTHILKDPTSDDFPHEAVVREML 167

>SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  192 bits (489), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 90/167 (53%), Positives = 116/167 (69%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+ +K FIN+ GIV DLKSFNFSVYG+WFGYINIILC+ALGIAN+FH   V+ F +L++
Sbjct: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            Q             KICPLS+ F+  +K F +N KRT+ Y  MA+IQW SL    TSL+
Sbjct: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           V+AI LT+SA  YA  W   Q+F+ +N+++ P  + FPHEA VREML
Sbjct: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167

>KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  191 bits (485), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 90/167 (53%), Positives = 118/167 (70%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+S+K F N  G++ DL+SFNFSVYGRWFG+INIILC+ALGIAN+FH   VI F I+++
Sbjct: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            QG            KICPLS+ F+  +  F +N  R M Y  MAVIQ+ S++  VTSL+
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           V+AICLTVSA+FYA  ++  QEF+ +N+++ P    FPHEA VREML
Sbjct: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167

>Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  187 bits (476), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 117/167 (70%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+SL  FINV G+V DLKSFNFSVYGRWFGYINIILCIALGIAN+FH   VI F I+++
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            QG            KICPLS+ FV  +K F +N  R + Y  MAVIQ+VS+    TSL+
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKKFETNGWRCIFYLAMAVIQYVSIAVMATSLI 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           V+A+ LT+S+I YA  +   QEF+ +N+++ P  D FPHEA VREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}
           TVP18Integral membrane protein localized to late Golgi
           vesicles along with the v-SNARE Tlg2p; may interact with
           ribosomes, based on co-purification experiments
          Length = 167

 Score =  186 bits (473), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 117/167 (70%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+SL  FINV G+V DLKSFNFSVYGRWFGYINIILCIALGIAN+FH   VI F I+++
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            QG            KICPLS+ F+  +K F +N  R + Y  MA+IQ++S+    TSL+
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFIEFIKRFETNGWRCLFYLAMAIIQYISIAVMATSLI 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           V+A+ LT+S+I YA  +   QEF+ +N+++ P  D FPHEA VREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  186 bits (472), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 93/167 (55%), Positives = 116/167 (69%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+SL  FINV G+V DLKSFNFSVYGRWFGYINIILCIALGIAN+FH   VI F I+++
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            QG            KICPLS+ FV  +K F +N  R + Y  MA IQ++S+    TSL+
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKRFETNGWRCIFYLAMATIQYISIAVMATSLI 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           V+A+ LT+S+I YA  +   QEF+ +N+L+ P  D FPHEA VREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNILKNPTDDDFPHEAVVREML 167

>KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  186 bits (471), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 88/167 (52%), Positives = 116/167 (69%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+++K FINV G+V DLKSFNFSVYG+WFGYINI LC+ALGIAN+FH   VI+F I+A+
Sbjct: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            QG            +ICPLS+ F++ +K F +N KRT+ Y  MA +QW SL    TSL+
Sbjct: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
            +AI LT+SA  Y   +   Q+F+ ++V++ P  D FPHEA VREML
Sbjct: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167

>TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON}
           Anc_2.534 YMR071C
          Length = 204

 Score =  184 bits (468), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 120/168 (71%), Gaps = 1/168 (0%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+S+K FIN  G++ DLKSFNFSVYG++FGYINIILC+ALGIAN+FH   VI F I+A+
Sbjct: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            Q             KICPLS+ FV+ VK F +N  R + +  MA++QW SL+ +VTSL+
Sbjct: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156

Query: 121 VLAICLTVSAIFYASGWLTKQEFKE-SNVLRGPGSDTFPHEASVREML 167
           V+AI L++SA FYA  +  KQEF+  SNV++ P  D FPHEA VREML
Sbjct: 157 VVAIGLSISAAFYAIAFFKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204

>KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  182 bits (461), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 116/167 (69%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+S+K FINV GIV DLKSFNFSVYGRWFGYINIILCIALGI+N+FH   VI F I+++
Sbjct: 1   MALSIKQFINVAGIVKDLKSFNFSVYGRWFGYINIILCIALGISNLFHVNAVIAFGIISI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            QG            KICPLS+ FV  +K F +N  R + Y VMA+IQ+ S++   TSL+
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFVEFIKRFETNGYRCVFYLVMAIIQYCSIILMATSLI 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           V+AICLTVS   Y      KQEF+ +N+++ P    FPHEA VREML
Sbjct: 121 VVAICLTVSCASYGIAAFKKQEFQNTNIIKNPTDTDFPHEAVVREML 167

>NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  180 bits (457), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 114/167 (68%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+ +K FIN  G+  DLKSFNFSVYGRWFGYINIILCIALG+AN+FH   VI F I+++
Sbjct: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            QG            KICPLSE F+  +K F +N  R + Y  MA+IQ+ S++   TSL+
Sbjct: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           V+AI LT+S++ YA  +   QEF+ +N+++ P    FPHEA VREM+
Sbjct: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167

>NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  179 bits (454), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 88/167 (52%), Positives = 113/167 (67%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+ +  FIN+ GIV DLKSFNFSVYGRWFGYINIILCI LGI+N+FH   VI F I+++
Sbjct: 1   MALGITQFINIAGIVKDLKSFNFSVYGRWFGYINIILCIGLGISNLFHVNAVIAFGIVSI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            QG            KICPLSERF+  +K F +N  R + Y VMA+IQ+ S+    TSL+
Sbjct: 61  IQGLVILFIEIPFLLKICPLSERFIEFIKRFETNGYRCVFYLVMAIIQYCSIALMATSLI 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           V+A+ LT+S+I YA  +   QEF+ + +L+ P    FP EA VREML
Sbjct: 121 VVAVGLTISSISYAIAFTNHQEFQNTQILKNPTDPDFPREAVVREML 167

>CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {ON}
           highly similar to uniprot|Q04767 Saccharomyces
           cerevisiae YMR071c
          Length = 167

 Score =  179 bits (453), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 112/167 (67%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+ +  FIN+ G++ DLKSFNFSVYG+WFGYINI LCIALGIAN+FH   VI F I+ +
Sbjct: 1   MALGITQFINIAGLLKDLKSFNFSVYGKWFGYINIFLCIALGIANLFHVSAVIAFGIVGI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            QG            KICPLS+RF+  +K F +N  R + Y +MA++Q+ SL    TSL+
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDRFIEFIKRFETNGYRCIFYTLMAIVQYCSLAVMTTSLL 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           VL I LT+SA+ Y   +   QEF  +N+++ P  + FPH+A VREML
Sbjct: 121 VLGITLTISAVSYGIAFTKHQEFANTNIIKNPTDEDFPHDAVVREML 167

>TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  177 bits (449), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 115/167 (68%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           M V+L+ F+N+ GIV  LKSFNFS+YG+WFGYINI+LC+ALGIAN+FH  PVI F I+++
Sbjct: 1   MGVALQEFLNINGIVRGLKSFNFSLYGQWFGYINILLCVALGIANLFHVNPVIAFGIVSI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            Q             KICPLS+ F++ +K F +N  R + Y  MA +QW S++ + TSL+
Sbjct: 61  IQSFIILFVEVPFLLKICPLSDNFIAFIKHFQTNGFRCIFYIAMATVQWCSIILKATSLI 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           V+AI LT+SAI YA  +   QEF+  ++++ P  D FP EA VREML
Sbjct: 121 VVAIGLTISAISYAVAYFKNQEFQNVSIIKNPTDDDFPREAVVREML 167

>Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  176 bits (446), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 117/167 (70%)

Query: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60
           MA+SL  FINV G+V DLKSFNFSVYGRWFGYINIILCIALGIAN+FH   VI F I+++
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  GQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120
            QG            KICPLS+ F+  +K F +N  R + Y  MA+IQ++S+    TSL+
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120

Query: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167
           V+A+ LT+S+I YA  +   QEF+ +N+++ P  D FPHEA VREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} similar
           to uniprot|Q04767 Saccharomyces cerevisiae YMR071C TVP18
           Tlg2-Vesicle Protein of 18 kDa Integral membrane vesicle
           protein
          Length = 171

 Score =  162 bits (410), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 2/165 (1%)

Query: 5   LKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILALGQGX 64
           LKS  NV G+V+DLKS NFS+YG+W  Y+NII C+A GIANIFHF  VI+FSI+A+ QG 
Sbjct: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHFSAVIVFSIIAIVQGL 66

Query: 65  XXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLVVLAI 124
                      KICPLS+ F+  V  F++N++R + Y VM  IQW S++ + TSL+V+A+
Sbjct: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126

Query: 125 CLTVSAIFYASGWLTKQEFKESNVL--RGPGSDTFPHEASVREML 167
            L+++A  YA G    QEFK S +L  RG  + +  +EA VR+ML
Sbjct: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171

>Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON}
           complement(17797..18189) [393 nt, 131 aa]
          Length = 130

 Score =  134 bits (336), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 86/130 (66%), Gaps = 1/130 (0%)

Query: 39  IALGIANIFHFGPVIIFSILALGQGXXXXXXXXXXXXKICPLSERFVSNVKIFNSNMKRT 98
           +ALGIAN+FH   VI F I+A+ Q             KICPLSE F++ +K F +N  R 
Sbjct: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60

Query: 99  MLYGVMAVIQWVSLVFEVTSLVVLAICLTVSAIFYASGWLTKQEFKE-SNVLRGPGSDTF 157
           + Y +MA++QW SL   VTSL+V+AICLT+SAIFYA  +   QEF+  +NV++ P  D F
Sbjct: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120

Query: 158 PHEASVREML 167
           PH+A VREML
Sbjct: 121 PHDAVVREML 130

>ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {ON}
           similar to uniprot|Q04767 Saccharomyces cerevisiae
           YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa Integral
           membrane vesicle protein
          Length = 166

 Score =  133 bits (335), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 97/155 (62%), Gaps = 1/155 (0%)

Query: 14  IVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILALGQGXXXXXXXXXX 73
           +V  LKS+NFS+YG++  Y+NII CIA GIAN+FH   VI F ++++ QG          
Sbjct: 12  LVQGLKSYNFSLYGKYVAYLNIIFCIAFGIANLFHVNAVIAFGVISIVQGAIILFLEVPF 71

Query: 74  XXKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLVVLAICLTVSAIFY 133
             +ICPLS+ F+  V  F +N  RT+ Y   AV+QW SL  ++TSL+V+A+ LT+SA FY
Sbjct: 72  LLRICPLSDNFIEFVSRFETNGWRTIFYIFNAVLQWASLALKITSLIVVAVGLTISAAFY 131

Query: 134 ASGWLTKQEFKESNVLRGP-GSDTFPHEASVREML 167
              +   Q F+ S+ ++ P G     +E +VREML
Sbjct: 132 GVAYFKHQNFQNSSHIKEPVGEGVEANEQNVREML 166

>Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}
           YMR071C - Hypothetical ORF [contig 55] FULL
          Length = 64

 Score = 69.3 bits (168), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 45/64 (70%)

Query: 104 MAVIQWVSLVFEVTSLVVLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASV 163
           MA +QW S+   VTSL+V+A+ LT+SA  Y+  +   Q+F+ ++V++ P  + FPHEA V
Sbjct: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60

Query: 164 REML 167
           REML
Sbjct: 61  REML 64

>KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 aa]
            {ON} similar to uniprot|Q12019 Saccharomyces cerevisiae
            YLR106C MDN1 Huge dynein-related AAA-type ATPase
            (midasin) forms extended pre-60S particle with the Rix1
            complex (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent
            remodeling of 60S subunits and subsequent export from
            nucleoplasm to cytoplasm
          Length = 4915

 Score = 30.0 bits (66), Expect = 3.3,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 27/52 (51%)

Query: 80   LSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLVVLAICLTVSAI 131
            L+ R VSN+KI N N    ++  ++  I+  S   E + +V  A+  T+  I
Sbjct: 3954 LNRRIVSNIKIANCNKIFALIDDLVTTIKSTSFTAESSPMVAAAVSFTMPFI 4005

>TPHA0B04330 Chr2 (1013193..1015418) [2226 bp, 741 aa] {ON} Anc_1.99
           YNL258C
          Length = 741

 Score = 29.3 bits (64), Expect = 5.6,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 9/49 (18%)

Query: 80  LSERFVSNVKIFNSNMKRTM---------LYGVMAVIQWVSLVFEVTSL 119
           ++E+FV   KI  S++K  M         L+    +IQW+ L+F  T L
Sbjct: 674 MNEKFVITGKILRSHLKEIMNMFYDGDFYLFSTDEIIQWIVLLFADTPL 722

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.141    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,559,276
Number of extensions: 472882
Number of successful extensions: 1739
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1748
Number of HSP's successfully gapped: 26
Length of query: 167
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 66
Effective length of database: 41,900,133
Effective search space: 2765408778
Effective search space used: 2765408778
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 61 (28.1 bits)